SMED30010284

Overview
NameSMED30010284
Smed IDSMED30010284
Length (bp)1020
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010284 (SMED30010284) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010284 (SMED30010284) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010284

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010284SMESG000007755.1 SmedASXL_008239SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010284SMESG000007755.1 dd_Smed_v6_38541_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010284 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003052:1132..2200 +4976
Homology
BLAST of SMED30010284 vs. TrEMBL
Match: A0A1I8IV72 (C-type lectin domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.591e-9
Identity = 55/183 (30.05%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  329 AFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVI--TFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDALIFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNT 871
            ++CDA+  C  IGG L +D  +  I    + N T   G+ DL  E  ++ S W    G L  ++  + W T  PNS     D     + GL D + +    F C   PI+  +SK   + + L  G  S + CY   SV S++HC  LC+Q+  C +  F+  S  C  +  A S++   + T
Sbjct:  513 SWCDAARLCLGIGGELLMD--LTAIRAANHWNDTYFIGVTDLLVEAGTSRSGWRFANGSLFPILDNSDWKTGLPNSLTEDDDFVASAKAGLRDREANLDKKFVC--QPIATPNSKYLERAEFLRLGNISPVYCYTDASVSSELHCLWLCVQRWECRAVLFNRASGACRMLDFADSSVGDAIET 691          
BLAST of SMED30010284 vs. TrEMBL
Match: A0A1I8J9T8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.600e-7
Identity = 53/212 (25.00%), Postives = 93/212 (43.87%), Query Frame = 2
Query:  263 TCPKNYSTCRNM--CIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRP-IYTCMNTNL-TILTGINDLFYERLSNGSSW---SQGYGILSEVITFWSTSQPNSGGYGQDCTMFNR--YGLNDIDCSARYVFACVY---DPXXXXXXXXXXXNDALIFGKDSQLGCYETFSVQSQIH--CAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLN 856
            +CP  Y+   N+  C+       + +C    TC ++G R+     ++P  Y  +  +L  + TGIND   ER S+ + W       G L  +   W+T QP+ G   +DC   N     L+D  C+A     C +   D   + +         ++      +GC E  +++  I   CA  C +K  CV FYF+   ++CV + +  + ++
Sbjct:   19 SCPSGYTAAPNLTTCLSGSVATDVNYCQCLKTCAQLGQRI-----LQPDTYAAVRLSLGEVWTGINDQLVERGSSPTGWQVVPNRAGSLLTLTDLWNTGQPD-GTSIEDCVNHNPTTKKLHDAGCTATIACRCEHPMGDERPVPAHYELFVESPVVDFTQGAVGCTEKIALELPIELLCAGECREKLGCVGFYFNPLRRECVLLLYMDAAVS 224          
BLAST of SMED30010284 vs. TrEMBL
Match: A0A1I8HX01 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.978e-7
Identity = 54/184 (29.35%), Postives = 84/184 (45.65%), Query Frame = 2
Query:  329 AFCDASLTCNKIGGRLPLD-TEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVI--TFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDALIFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNT 871
            ++CDA+  C  IGG L +D T IR +   ++       G+ DL  E   + S W    G L  V+  T W    PN+     D  + +  GL D   ++   F C   PI+  +S+   + + L  G  S + CY   SV S+ HC  LC+Q+  C +  F+  S  C  +  A S++   + T
Sbjct:  484 SWCDAARLCLGIGGELLIDLTAIRAVNHWLDY---YYIGVTDLLVEAKWSRSGWRFANGSLFPVLNDTEWMNHSPNNNSPDDDFLVVSNAGLRDQPANSATKFVC--QPIATPNSEYLRRAEFLRLGNISPVYCYTDASVSSEFHCLWLCVQRWECRAVLFNRASSACRMLDFADSSVGDAIET 662          
BLAST of SMED30010284 vs. TrEMBL
Match: A0A1I8J6T3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.161e-7
Identity = 54/184 (29.35%), Postives = 84/184 (45.65%), Query Frame = 2
Query:  329 AFCDASLTCNKIGGRLPLD-TEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVI--TFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDALIFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNT 871
            ++CDA+  C  IGG L +D T IR +   ++       G+ DL  E   + S W    G L  V+  T W    PN+     D  + +  GL D   ++   F C   PI+  +S+   + + L  G  S + CY   SV S+ HC  LC+Q+  C +  F+  S  C  +  A S++   + T
Sbjct:  484 SWCDAARLCLGIGGELLIDLTAIRAVNHWLDY---YYIGVTDLLVEAKWSRSGWRFANGSLFPVLNDTEWMNHSPNNNSPDDDFLVVSNAGLRDQPANSATKFVC--QPIATPNSEYLRRAEFLRLGNISPVYCYTDASVSSEFHCLWLCVQRWECRAVLFNRASSACRMLDFADSSVGDAIET 662          
BLAST of SMED30010284 vs. Planmine SMEST
Match: SMESG000007755.1 (SMESG000007755.1)

HSP 1 Score: 388.652 bits (997), Expect = 2.346e-137
Identity = 199/202 (98.51%), Postives = 200/202 (99.01%), Query Frame = 2
Query:  296 MCIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDALIFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNTTNRKWHGYHS 901
            MCIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSA YVFACVYDPISISSSKSFIKNDALIFGKDSQLGCYE FSVQSQIHCAALCLQKNYCVSFYFDEGSK+CVNVYHAKSTLNKLMNTTNRKWHGYHS
Sbjct:    1 MCIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSASYVFACVYDPISISSSKSFIKNDALIFGKDSQLGCYENFSVQSQIHCAALCLQKNYCVSFYFDEGSKECVNVYHAKSTLNKLMNTTNRKWHGYHS 202          
BLAST of SMED30010284 vs. Planmine SMEST
Match: SMESG000030594.1 (SMESG000030594.1)

HSP 1 Score: 139.813 bits (351), Expect = 1.125e-38
Identity = 71/216 (32.87%), Postives = 116/216 (53.70%), Query Frame = 2
Query:  248 GWNSLTCPKNYSTCRNMCIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXN-DALIFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNTTNRKWHG 892
            G+ +  CP +YS C N CI + T +++ +CDA   C    GRL L+ E+RP   C N +      +ND+  ER +N S W    G     ++ W+  QP+S    +DC  F +YGL D+ C  ++ F CV D    S++K F +  DA IF ++++ GC E    +S++ CA +C++  +C  FY+D  +  C  + +  S L+ + + +  KW G
Sbjct:   14 GFVNSICPVSYSKCDNFCINIST-ISVKYCDAWKHCTDNSGRLALEKELRPTLNCFNKSDNFYVALNDMMIERHNNTSGWDFSDGTTLNDLSLWAKDQPDSKNGAEDCVTFGKYGLEDVSCDEKHYFVCVSDHFQHSNTKLFSQELDAHIFRENTEKGCTEPHKAKSKVECAIICMKDKHCKLFYYDPSTDQCFFIKYVYSKLSYIYDDSQTKWLG 228          
BLAST of SMED30010284 vs. Planmine SMEST
Match: SMESG000024541.1 (SMESG000024541.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.698e-34
Identity = 70/211 (33.18%), Postives = 107/211 (50.71%), Query Frame = 2
Query:  263 TCPKNYSTCRNMCIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDALIFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNTTNRKWHGY 895
             CP  Y  C + C    ++  + FCDA+  C  I GRL ++ E+ PI +C  TN  I  G+NDL YE  +    W    G   + ++ W T +PN G   +DC   N  G+ DI C+      CV D     SS+ F  + ++IF  D++ GCYE+    S+ +CA  C+    C SF++++    CV+  +A STL K  +   +KW  +
Sbjct:   20 VCPNPYQVCGDFCFIEISQ-RVQFCDAAKICESINGRLLIEKELNPIKSCRATNDEIFIGLNDLAYEMTNAKDGWKFIDGSTIKNLSLWLTWEPNGGYISEDCVGMNNAGMYDIKCTEYLGTICVLDDGFRPSSRVFQLDSSIIFNGDAEKGCYESIGPLSRFNCAMKCVNTKKCKSFFYEDNEGFCVHADYADSTLPKDWDYYTKKWRRF 229          
BLAST of SMED30010284 vs. Planmine SMEST
Match: SMESG000058775.1 (SMESG000058775.1)

HSP 1 Score: 110.923 bits (276), Expect = 1.118e-28
Identity = 66/209 (31.58%), Postives = 104/209 (49.76%), Query Frame = 2
Query:  278 YSTCRNMCIRVFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTC-MNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDAL-IFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNTTNRKWHGYH 898
            Y  C+ + + + T     +C+A   C  IGGRL  +++I  +  C M  N+    G+NDL +ER  N + W    G      ++W   +PNS   G+DC + N     D  C   + + C+ +      ++    N    IF  D ++GCY+  S +S + C A+ L K Y  SFYFD+   DCV V +  STL    NT++R+W G++
Sbjct:   20 YKPCQQLQVYIST-TQETYCNAWSKCFDIGGRLASESDISTVMDCNMLPNVHFYIGLNDLLFERYKNQTGWLFSDGSQLNDTSYWYNQEPNSMPSGEDCVVINT-KFYDTSCKGNFNYFCIANSYDEIHARFLKSNSIRPIFNNDVEVGCYDIVSARSVLECGAISLTKPYYRSFYFDKIQSDCVLVKYVDSTLPLSFNTSDRQWIGFY 226          
BLAST of SMED30010284 vs. Planmine SMEST
Match: SMESG000058758.1 (SMESG000058758.1)

HSP 1 Score: 107.071 bits (266), Expect = 2.806e-25
Identity = 66/202 (32.67%), Postives = 106/202 (52.48%), Query Frame = 2
Query:  302 IRVFTKVTLA-FCDASLTCNKIGGRLPLDTEIRPIYTC-MNTNLTILTGINDLFYERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDIDCSARYVFACVYDPXXXXXXXXXXXNDAL-IFGKDSQLGCYETFSVQSQIHCAALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNTTNRKWHGYH 898
            ++V+   T   +C+A   C  IGGRL  +++I  +  C +  N+    G+NDL +ER  N + W    G      ++W+T +PNS    +DC + N   L D  C   + + C+ +      +++  +N    IF  D ++GCY+  S +S + C A+ L K Y  SFYFD+   DCV V +  STL    NT++R+W GY+
Sbjct:  698 LQVYISTTQETYCNAWSKCFDIGGRLASESDISTVMDCNILPNVHFYIGLNDLLFERYKNQTGWLFSDGSQLNNTSYWNTQEPNSMDCVEDCVVINT-KLYDTSCKGNFNYFCIANSYDEIHARNLKRNSTRPIFNNDVEVGCYDIVSARSVLECGAISLTKPYYRSFYFDKIQSDCVLVKYVDSTLPLSFNTSDRQWIGYY 898          
The following BLAST results are available for this feature:
BLAST of SMED30010284 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A1I8IV726.591e-930.05C-type lectin domain-containing protein OS=Macrost... [more]
A0A1I8J9T82.600e-725.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HX013.978e-729.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J6T34.161e-729.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30010284 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010284 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007755.12.346e-13798.51SMESG000007755.1[more]
SMESG000030594.11.125e-3832.87SMESG000030594.1[more]
SMESG000024541.11.698e-3433.18SMESG000024541.1[more]
SMESG000058775.11.118e-2831.58SMESG000058775.1[more]
SMESG000058758.12.806e-2532.67SMESG000058758.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010284 ID=SMED30010284|Name=SMED30010284|organism=Schmidtea mediterranea sexual|type=transcript|length=1020bp
GAATTTCTCCTTTTAGTTTTTTTTAAATCTTCAGAAAACGTTGCATTGTT
ATCATTTGCTGAACAGTAGTAGATTTGGTCTTGGAAAATTATAATTATTT
ATAACCAATAAGAATCTTTTAAAAACAAATTATTATTTATTGGATTCTTA
ACAATACATGTGGAGAGATATAAATAATTTTACAAAATATGTTAATAAAT
ATTTTATGAATTGGTTTATTCTATTTATCCTAATTTTACGAATTCTGGGT
TGGAATTCCTTGACTTGCCCGAAAAATTATTCCACGTGCCGTAACATGTG
TATCAGAGTATTTACCAAAGTCACCTTAGCATTTTGTGATGCGTCACTTA
CATGTAATAAAATTGGAGGACGCCTCCCTTTGGACACAGAAATAAGGCCA
ATTTATACTTGCATGAATACAAACTTGACAATTTTGACAGGAATCAACGA
TTTGTTCTATGAAAGATTATCCAATGGTTCCAGTTGGTCACAGGGTTATG
GGATACTATCAGAAGTAATTACATTTTGGTCTACTAGTCAACCAAACAGC
GGTGGGTATGGACAAGACTGTACAATGTTTAATAGATATGGTTTGAACGA
CATAGATTGTAGTGCCAGATATGTATTTGCCTGTGTTTATGATCCAATTT
CCATTTCTAGCTCTAAATCTTTTATTAAAAATGATGCACTGATATTCGGA
AAGGACAGCCAATTAGGATGCTATGAGACTTTTTCGGTTCAAAGTCAGAT
TCATTGCGCAGCCTTATGCTTACAAAAGAACTATTGCGTATCATTTTATT
TCGACGAAGGATCAAAAGACTGTGTAAACGTTTACCACGCGAAAAGCACA
TTGAATAAATTAATGAATACCACCAATCGAAAATGGCATGGATATCATTC
ATAAATTTTATTTTACACTTTTTATTGATAATTTCAATAAAAACTTGCAT
CTTATTATTGAAAATTAATGCAAATTTGATTATAGTTATATTTGTAACTT
TGTTATATATAGATTAAAAG
back to top

protein sequence of SMED30010284-orf-1

>SMED30010284-orf-1 ID=SMED30010284-orf-1|Name=SMED30010284-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MWRDINNFTKYVNKYFMNWFILFILILRILGWNSLTCPKNYSTCRNMCIR
VFTKVTLAFCDASLTCNKIGGRLPLDTEIRPIYTCMNTNLTILTGINDLF
YERLSNGSSWSQGYGILSEVITFWSTSQPNSGGYGQDCTMFNRYGLNDID
CSARYVFACVYDPISISSSKSFIKNDALIFGKDSQLGCYETFSVQSQIHC
AALCLQKNYCVSFYFDEGSKDCVNVYHAKSTLNKLMNTTNRKWHGYHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR001304C-type_lectin-like
IPR016187CTDL_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 35..180
e-value: 3.8E-10
score: 41.8
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 138..159
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 44..160
score: 9.268
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 18..164
NoneNo IPR availableSUPERFAMILYSSF57414Hairpin loop containing domain-likecoord: 189..235
NoneNo IPR availableTMHMMTMhelixcoord: 15..37