Forkhead box protein D3

Overview
NameForkhead box protein D3
Smed IDSMED30010268
Length (bp)900
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box protein D3 (SMED30010268) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box protein D3 (SMED30010268) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010268

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
GABAergic neuronSMED30010268h1SMcG0012074 BK013027smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010268h1SMcG0012074 BK013027smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010268h1SMcG0012074 dd_Smed_v4_30720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010268h1SMcG0012074 dd_Smed_v4_30720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010268h1SMcG0012074 dd_Smed_v4_30720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010268h1SMcG0012074 dd_Smed_v6_30720_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box protein D3 vs. Ensembl Human
Match: FOXD3 (forkhead box D3 [Source:HGNC Symbol;Acc:HGNC:3804])

HSP 1 Score: 158.303 bits (399), Expect = 2.911e-44
Identity = 68/88 (77.27%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:  141 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 228          
BLAST of Forkhead box protein D3 vs. Ensembl Human
Match: FOXD1 (forkhead box D1 [Source:HGNC Symbol;Acc:HGNC:3802])

HSP 1 Score: 156.377 bits (394), Expect = 1.500e-43
Identity = 66/88 (75.00%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:  125 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 212          
BLAST of Forkhead box protein D3 vs. Ensembl Human
Match: FOXD4L1 (forkhead box D4 like 1 [Source:HGNC Symbol;Acc:HGNC:18521])

HSP 1 Score: 154.451 bits (389), Expect = 2.237e-43
Identity = 67/101 (66.34%), Postives = 78/101 (77.23%), Query Frame = 1
Query:  244 RQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            R  + SE  +  +KPPYSYIALI MAI  SP K+LTLS IC FI  +F YYR +FP WQNSIRHNLSLNDCF+KIPR+  +PGKG +WSLDP S+ MFDNG
Sbjct:   94 RSAAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNG 194          
BLAST of Forkhead box protein D3 vs. Ensembl Human
Match: FOXD4L6 (forkhead box D4 like 6 [Source:HGNC Symbol;Acc:HGNC:31986])

HSP 1 Score: 154.066 bits (388), Expect = 4.273e-43
Identity = 67/101 (66.34%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  244 RQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            R  + SE  +  +KPPYSYIALI MAI  +P K+LTLS IC FI  +F YYR +FP WQNSIRHNLSLNDCF+KIPR+  +PGKGN+WSLDP S+ MFDNG
Sbjct:   95 RSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNG 195          
BLAST of Forkhead box protein D3 vs. Ensembl Human
Match: FOXD4L3 (forkhead box D4 like 3 [Source:HGNC Symbol;Acc:HGNC:18523])

HSP 1 Score: 154.066 bits (388), Expect = 4.364e-43
Identity = 67/101 (66.34%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  244 RQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            R  + SE  +  +KPPYSYIALI MAI  +P K+LTLS IC FI  +F YYR +FP WQNSIRHNLSLNDCF+KIPR+  +PGKGN+WSLDP S+ MFDNG
Sbjct:   95 RSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNG 195          
BLAST of Forkhead box protein D3 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 151.754 bits (382), Expect = 1.689e-43
Identity = 65/89 (73.03%), Postives = 77/89 (86.52%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +KPPYSYIALIAM+I +SP KKLTLSEIC+FI+ KF YY+++FP WQNSIRHNLSLNDCF+K+ R   NPGKGN+W+LDP  E MFDNG
Sbjct:  126 AKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNG 214          
BLAST of Forkhead box protein D3 vs. Ensembl Celegans
Match: lin-31 (pep chromosome:WBcel235:II:3982549:3986944:1 gene:WBGene00003017.1 transcript:K10G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 114.39 bits (285), Expect = 3.835e-30
Identity = 51/91 (56.04%), Postives = 65/91 (71.43%), Query Frame = 1
Query:  274 NASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +  KPPYSYI L  MAI  S  K L L+EI  +IM +F +YR     WQNS+RHNLS NDCFIKIPR ++ PGKG++W++ P + GMF+NG
Sbjct:   10 DEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAVHPNASGMFENG 100          
BLAST of Forkhead box protein D3 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 115.931 bits (289), Expect = 2.159e-29
Identity = 52/89 (58.43%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            SKPPYSYI+LI MAI  S S++LTLSEI ++IM  F YY++    WQNSIRH+LS NDCF+K+ R  + PGKG+FW+L      MF+NG
Sbjct:  140 SKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENG 228          
BLAST of Forkhead box protein D3 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 115.931 bits (289), Expect = 2.756e-29
Identity = 52/89 (58.43%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            SKPPYSYI+LI MAI  S S++LTLSEI ++IM  F YY++    WQNSIRH+LS NDCF+K+ R  + PGKG+FW+L      MF+NG
Sbjct:  171 SKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENG 259          
BLAST of Forkhead box protein D3 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 116.316 bits (290), Expect = 4.413e-29
Identity = 52/89 (58.43%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            SKPPYSYI+LI MAI  S S++LTLSEI ++IM  F YY++    WQNSIRH+LS NDCF+K+ R  + PGKG+FW+L      MF+NG
Sbjct:  235 SKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENG 323          
BLAST of Forkhead box protein D3 vs. Ensembl Fly
Match: fd59A (gene:FBgn0004896 transcript:FBtr0071898)

HSP 1 Score: 158.303 bits (399), Expect = 8.941e-45
Identity = 69/88 (78.41%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS ICDFIM +F YY+D+FP WQNSIRHNLSLNDCFIK+PR+  NPGKGNFW+LDP +E MFDNG
Sbjct:   85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNG 172          
BLAST of Forkhead box protein D3 vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 131.339 bits (329), Expect = 2.151e-34
Identity = 58/92 (63.04%), Postives = 71/92 (77.17%), Query Frame = 1
Query:  271 KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            K   KPPYSYIALIAMAI ++  KK+TL+ I  +IM++F YYRD    WQNSIRHNLSLN+CF+K+ RD   PGKG++W+LDP S  MFDNG
Sbjct:   66 KEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNG 157          
BLAST of Forkhead box protein D3 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0300259)

HSP 1 Score: 124.02 bits (310), Expect = 7.839e-32
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +KPPYSYI+LI MAI ++P++ LTLSEI  FIM  F +YR     WQNSIRH+LS NDCF+KIPR  + PGKG+FW+L P S  MF+NG
Sbjct:  209 AKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENG 297          
BLAST of Forkhead box protein D3 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0345227)

HSP 1 Score: 124.02 bits (310), Expect = 7.839e-32
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +KPPYSYI+LI MAI ++P++ LTLSEI  FIM  F +YR     WQNSIRH+LS NDCF+KIPR  + PGKG+FW+L P S  MF+NG
Sbjct:  209 AKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENG 297          
BLAST of Forkhead box protein D3 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0085321)

HSP 1 Score: 124.02 bits (310), Expect = 7.839e-32
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +KPPYSYI+LI MAI ++P++ LTLSEI  FIM  F +YR     WQNSIRH+LS NDCF+KIPR  + PGKG+FW+L P S  MF+NG
Sbjct:  209 AKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENG 297          
BLAST of Forkhead box protein D3 vs. Ensembl Zebrafish
Match: foxd3 (forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-143])

HSP 1 Score: 162.925 bits (411), Expect = 4.170e-47
Identity = 85/125 (68.00%), Postives = 99/125 (79.20%), Query Frame = 1
Query:  226 SSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNGXXXXXXXXXXXXXPEIMR 600
            SST   +   KS ++K    PPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNGSFLRRR+RFK   P+I+R
Sbjct:   81 SSTGPMQNKPKSSLVK----PPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQPDILR 201          
BLAST of Forkhead box protein D3 vs. Ensembl Zebrafish
Match: foxd1 (forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2094])

HSP 1 Score: 157.918 bits (398), Expect = 1.615e-45
Identity = 67/88 (76.14%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEICDFI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   74 KPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 161          
BLAST of Forkhead box protein D3 vs. Ensembl Zebrafish
Match: foxd5 (forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4])

HSP 1 Score: 156.762 bits (395), Expect = 2.876e-45
Identity = 70/88 (79.55%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS ICDFI  KF YY+++FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+WSLDP SE MFDNG
Sbjct:   73 KPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNG 160          
BLAST of Forkhead box protein D3 vs. Ensembl Zebrafish
Match: foxd5 (forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4])

HSP 1 Score: 156.762 bits (395), Expect = 2.876e-45
Identity = 70/88 (79.55%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS ICDFI  KF YY+++FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+WSLDP SE MFDNG
Sbjct:   73 KPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNG 160          
BLAST of Forkhead box protein D3 vs. Ensembl Zebrafish
Match: foxd2 (forkhead box D2 [Source:ZFIN;Acc:ZDB-GENE-980605-6])

HSP 1 Score: 155.992 bits (393), Expect = 1.604e-44
Identity = 70/112 (62.50%), Postives = 85/112 (75.89%), Query Frame = 1
Query:  214 KISSSSTKESRQLSKSEVIKNA-SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            ++       +  L+  +  KNA  KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   71 RVGQRDDSRTGALTGDKPGKNALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 182          
BLAST of Forkhead box protein D3 vs. Ensembl Xenopus
Match: FOXD2 (forkhead box D2 [Source:NCBI gene;Acc:100495241])

HSP 1 Score: 157.918 bits (398), Expect = 3.033e-45
Identity = 71/107 (66.36%), Postives = 83/107 (77.57%), Query Frame = 1
Query:  226 SSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            SS  ES Q ++        KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   59 SSGSESNQRAEKPPKNALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 165          
BLAST of Forkhead box protein D3 vs. Ensembl Xenopus
Match: foxd3 (forkhead box D3 [Source:NCBI gene;Acc:496851])

HSP 1 Score: 158.303 bits (399), Expect = 3.169e-45
Identity = 68/88 (77.27%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:   92 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 179          
BLAST of Forkhead box protein D3 vs. Ensembl Xenopus
Match: foxd1 (forkhead box D1 [Source:NCBI gene;Acc:493510])

HSP 1 Score: 157.147 bits (396), Expect = 3.467e-45
Identity = 72/116 (62.07%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  202 LMVYKISSSSTKESRQLSKSEVIKNA-SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            L+     SS+TK+  + +     ++A  KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   40 LLPTSPQSSATKDPYKGTGGGGGRSALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 155          
BLAST of Forkhead box protein D3 vs. Ensembl Xenopus
Match: ankra2 (ankyrin repeat family A member 2 [Source:Xenbase;Acc:XB-GENE-1002386])

HSP 1 Score: 156.377 bits (394), Expect = 1.405e-44
Identity = 70/88 (79.55%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS ICDFI  KF YY+D+FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDP SE MFDNG
Sbjct:   97 KPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASEDMFDNG 184          
BLAST of Forkhead box protein D3 vs. Ensembl Xenopus
Match: arhgef28 (Rho guanine nucleotide exchange factor 28 [Source:Xenbase;Acc:XB-GENE-952324])

HSP 1 Score: 154.066 bits (388), Expect = 6.488e-44
Identity = 68/88 (77.27%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP +KLTLS ICDFI  KF YY+D+FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDP S+ MFDNG
Sbjct:   97 KPPYSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASKDMFDNG 184          
BLAST of Forkhead box protein D3 vs. Ensembl Mouse
Match: Foxd3 (forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473])

HSP 1 Score: 159.073 bits (401), Expect = 1.073e-44
Identity = 68/88 (77.27%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:  131 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 218          
BLAST of Forkhead box protein D3 vs. Ensembl Mouse
Match: Foxd3 (forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473])

HSP 1 Score: 159.073 bits (401), Expect = 1.073e-44
Identity = 68/88 (77.27%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:  131 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 218          
BLAST of Forkhead box protein D3 vs. Ensembl Mouse
Match: Foxd1 (forkhead box D1 [Source:MGI Symbol;Acc:MGI:1347463])

HSP 1 Score: 157.147 bits (396), Expect = 3.522e-44
Identity = 66/88 (75.00%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:  130 KPPYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 217          
BLAST of Forkhead box protein D3 vs. Ensembl Mouse
Match: Foxd2 (forkhead box D2 [Source:MGI Symbol;Acc:MGI:1347471])

HSP 1 Score: 155.606 bits (392), Expect = 2.866e-43
Identity = 66/88 (75.00%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:  129 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 216          
BLAST of Forkhead box protein D3 vs. Ensembl Mouse
Match: Foxd4 (forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467])

HSP 1 Score: 151.369 bits (381), Expect = 5.363e-42
Identity = 65/89 (73.03%), Postives = 74/89 (83.15%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +KPPYSYIALI MAI  SP K+LTLS IC FI  +F YYR +FP WQNSIRHNLSLNDCF+KIPR+  +PGKGN+WSLDP S+ MFDNG
Sbjct:  102 AKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNG 190          
BLAST of Forkhead box protein D3 vs. UniProt/SwissProt
Match: sp|Q63245|FOXD3_RAT (Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 7.086e-46
Identity = 68/88 (77.27%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:    3 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 90          
BLAST of Forkhead box protein D3 vs. UniProt/SwissProt
Match: sp|Q9PSY4|FOXD1_XENLA (Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 2.340e-45
Identity = 73/118 (61.86%), Postives = 89/118 (75.42%), Query Frame = 1
Query:  199 FLMVYKISSSSTKESRQLSKSEVIKNAS--KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
             LM      SSTK+  + + S  +  ++  KPPYSYIALI M+I  SP K+LTLSEICDFI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   38 LLMPRSPHCSSTKDPYKAAGSGGVGRSALVKPPYSYIALITMSILQSPKKRLTLSEICDFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 155          
BLAST of Forkhead box protein D3 vs. UniProt/SwissProt
Match: sp|Q63251|FOXD1_RAT (Forkhead box protein D1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.745e-45
Identity = 66/88 (75.00%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:    3 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 90          
BLAST of Forkhead box protein D3 vs. UniProt/SwissProt
Match: sp|Q9PRJ8|FXD5A_XENLA (Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 9.040e-45
Identity = 73/107 (68.22%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  226 SSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +S   S   + S+  +   KPPYSYIALI MAI  SP KKLTLS ICDFI  KF YY+D+FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDP SE MFDNG
Sbjct:   78 TSKDSSTTPTGSKAKRTLVKPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASEDMFDNG 184          
BLAST of Forkhead box protein D3 vs. UniProt/SwissProt
Match: sp|Q9DEN3|FXD3B_XENLA (Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.420e-44
Identity = 68/88 (77.27%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI M+I  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:   94 KPPYSYIALITMSILQSPQKKLTLSGICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPQSEDMFDNG 181          
BLAST of Forkhead box protein D3 vs. TrEMBL
Match: A0A5P8I4N4 (FoxD-like protein OS=Hofstenia miamia OX=442651 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.788e-45
Identity = 74/107 (69.16%), Postives = 88/107 (82.24%), Query Frame = 1
Query:  226 SSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            S T E ++   ++  K +SKPPYSYIALI+MAI +SP KKLTLS ICDFIM KF YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP SE MF+NG
Sbjct:   23 SRTNECKE-DATQAKKKSSKPPYSYIALISMAILASPHKKLTLSGICDFIMTKFPYYREKFPAWQNSIRHNLSLNDCFLKIPREPGNPGKGNYWTLDPNSENMFENG 128          
BLAST of Forkhead box protein D3 vs. TrEMBL
Match: A0A0P7YB21 (Forkhead box protein D5-A-like OS=Scleropages formosus OX=113540 GN=Z043_118390 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.411e-45
Identity = 75/108 (69.44%), Postives = 83/108 (76.85%), Query Frame = 1
Query:  223 SSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            S+   E+       + KNA KPPYSYIALI MAI  SP KKLTLS ICDFI  KF YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+WSLDP SE MFDNG
Sbjct:   52 SAEEGEAPVCVSGRLCKNAVKPPYSYIALITMAILQSPQKKLTLSGICDFISSKFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWSLDPASEDMFDNG 159          
BLAST of Forkhead box protein D3 vs. TrEMBL
Match: A0A0A9WTF6 (Fork head domain-containing protein FD3 (Fragment) OS=Lygus hesperus OX=30085 GN=fd59A PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.625e-45
Identity = 83/126 (65.87%), Postives = 102/126 (80.95%), Query Frame = 1
Query:  220 SSSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNGXXXXXXXXXXXXXPEIM 597
            S SS +E+++ + + ++K    PPYSYIALI MAI  SP KKLTLS IC+FIM +F YYR++FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDP +E MFDNGSFLRRR+R+K + PE M
Sbjct:   48 SQSSPEEAKKSTTTTLVK----PPYSYIALITMAILQSPHKKLTLSGICEFIMTRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPMAEDMFDNGSFLRRRKRYKRQPPEFM 169          
BLAST of Forkhead box protein D3 vs. TrEMBL
Match: A0A183ANY6 (Fork-head domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8671 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 5.238e-45
Identity = 76/113 (67.26%), Postives = 88/113 (77.88%), Query Frame = 1
Query:  220 SSSSTKESRQLSKSEVI----KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            S SS  +S++L  S  +    +++ KPPYSYIALI MAI  SP +KLTLS IC+FIM KF YYR+RFP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W LDP SE MFDNG
Sbjct:   40 SPSSLDDSQKLEHSPFVPTGPRHSVKPPYSYIALITMAILHSPQRKLTLSGICNFIMDKFPYYRERFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWILDPNSEDMFDNG 152          
BLAST of Forkhead box protein D3 vs. TrEMBL
Match: A0A183FP24 (Fork-head domain-containing protein OS=Heligmosomoides polygyrus OX=6339 GN=HPBE_LOCUS9318 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.055e-44
Identity = 68/91 (74.73%), Postives = 80/91 (87.91%), Query Frame = 1
Query:  274 NASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
             A+KP YSYIALIAMAI ++  KKLTLS+ICDFIM +F YYRD+FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+WSLDP+++ MFDNG
Sbjct:  145 GATKPAYSYIALIAMAILNAEDKKLTLSQICDFIMSRFQYYRDKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWSLDPKAQDMFDNG 235          
BLAST of Forkhead box protein D3 vs. Ensembl Cavefish
Match: foxd1 (forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2094])

HSP 1 Score: 160.614 bits (405), Expect = 1.712e-46
Identity = 70/108 (64.81%), Postives = 85/108 (78.70%), Query Frame = 1
Query:  223 SSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            ++++   R   KS ++K    PPYSYIALI MAI  SP K+LTLSEICDFI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   52 ATASSACRPAGKSALVK----PPYSYIALITMAILQSPKKRLTLSEICDFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 155          
BLAST of Forkhead box protein D3 vs. Ensembl Cavefish
Match: foxd3 (forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-143])

HSP 1 Score: 158.688 bits (400), Expect = 1.165e-45
Identity = 71/93 (76.34%), Postives = 79/93 (84.95%), Query Frame = 1
Query:  271 KNA-SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KNA  KPPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDPQSE MFDNG
Sbjct:   60 KNALVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNG 152          
BLAST of Forkhead box protein D3 vs. Ensembl Cavefish
Match: zgc:162612 (zgc:162612 [Source:ZFIN;Acc:ZDB-GENE-070410-88])

HSP 1 Score: 154.836 bits (390), Expect = 3.452e-45
Identity = 66/88 (75.00%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEICDFI ++F YYR++FP WQNSIRHNLSLNDCF+K+PR+  NPGKGN+W+LDP S  MFDNG
Sbjct:   44 KPPYSYIALITMAILQSPKKRLTLSEICDFISRRFPYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSADMFDNG 131          
BLAST of Forkhead box protein D3 vs. Ensembl Cavefish
Match: foxd2 (forkhead box protein D2 [Source:NCBI gene;Acc:103022344])

HSP 1 Score: 155.221 bits (391), Expect = 7.367e-44
Identity = 70/108 (64.81%), Postives = 86/108 (79.63%), Query Frame = 1
Query:  223 SSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            S +T  + + SK+ ++K    PPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP+S  MFDNG
Sbjct:   97 SVATVPTDKSSKNALVK----PPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNG 200          
BLAST of Forkhead box protein D3 vs. Ensembl Cavefish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 132.109 bits (331), Expect = 4.360e-37
Identity = 58/92 (63.04%), Postives = 73/92 (79.35%), Query Frame = 1
Query:  271 KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            K+A KPPYSYIALI MAI SS  K++TL+ I  FIM++F +YR+    WQNSIRHNLSLN+CF+K+PRD   PGKG++W+LDP S  MF+NG
Sbjct:   68 KDAVKPPYSYIALITMAIQSSAEKRVTLNGIYQFIMERFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENG 159          
BLAST of Forkhead box protein D3 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 132.88 bits (333), Expect = 1.346e-38
Identity = 60/95 (63.16%), Postives = 73/95 (76.84%), Query Frame = 1
Query:  262 EVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +  K+  KPPYSYIALI MAI S+P KK+TL+ I  FIM KF +YR+    WQNSIRHNLSLN+CF+K+PRD   PGKG++WSLDP S  MF+NG
Sbjct:   70 QAPKDLVKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENG 164          
BLAST of Forkhead box protein D3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002547.1 (pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gene:ENSPMAG00000002324.1 transcript:ENSPMAT00000002547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 7.702e-36
Identity = 56/92 (60.87%), Postives = 68/92 (73.91%), Query Frame = 1
Query:  271 KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            K+  KPPYSYIALIAMAI +S   + TLS I  FI  +F +YR+    WQNSIRHNLSLN+CF+ + RD   PGKG+FW+LDP S GMF+NG
Sbjct:   22 KDLVKPPYSYIALIAMAIQNSAEGRATLSAIYQFIAGRFPFYRENKQGWQNSIRHNLSLNECFVTVARDDRRPGKGSFWTLDPDSHGMFENG 113          
BLAST of Forkhead box protein D3 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 123.25 bits (308), Expect = 1.282e-35
Identity = 50/92 (54.35%), Postives = 71/92 (77.17%), Query Frame = 1
Query:  271 KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +   KPP+SYIALI MAI SSP+K++TLSEI  F+  +F ++R  +  W+NS+RHNLSLN+CF+K+P+    PGKG++W++DP SE MF+ G
Sbjct:    1 RRPEKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEG 92          
BLAST of Forkhead box protein D3 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 124.02 bits (310), Expect = 1.583e-35
Identity = 50/92 (54.35%), Postives = 71/92 (77.17%), Query Frame = 1
Query:  271 KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +   KPP+SYIALI MAI SSP+K++TLSEI  F+  +F ++R  +  W+NS+RHNLSLN+CF+K+P+    PGKG++W++DP SE MF+ G
Sbjct:    2 RRPEKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEG 93          
BLAST of Forkhead box protein D3 vs. Ensembl Sea Lamprey
Match: foxg1a (forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-267])

HSP 1 Score: 122.479 bits (306), Expect = 1.932e-34
Identity = 58/109 (53.21%), Postives = 73/109 (66.97%), Query Frame = 1
Query:  220 SSSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            +S    ES++    +  K   KPP+SY ALI MAI  SP K+LTLS I ++IM  F YYR     WQNSIRHNLSLN CF+K+PR  ++PGKGN+W LDP S+ +F  G
Sbjct:   13 ASDGGGESKE--DGDGAKGGDKPPFSYNALIMMAIRQSPEKRLTLSGIYEYIMHNFPYYRQNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGG 119          
BLAST of Forkhead box protein D3 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 93.2041 bits (230), Expect = 9.565e-22
Identity = 47/90 (52.22%), Postives = 57/90 (63.33%), Query Frame = 1
Query:  277 ASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            A KPPYSY  LI +AI  S   KLTLS+I  +I   F YY+ +   WQNSIRHNLSLND FIK  +  +  GKG+FW + P +E  F  G
Sbjct:  107 AKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFFKG 194          
BLAST of Forkhead box protein D3 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 85.1149 bits (209), Expect = 5.903e-19
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSL 513
            KPP+SY  +I  AI SSP   ++L++I  +I   ++YYR     WQNSIRHNLSLN  F K+PR  N PGKG  W +
Sbjct:  340 KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRI 416          
BLAST of Forkhead box protein D3 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 77.411 bits (189), Expect = 1.705e-16
Identity = 34/77 (44.16%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSL 513
            KPP SY ++I  AI S+P   ++L++I  FI   +++YR     WQNS+RHNLSLN  F K+P+ +   GKG  W +
Sbjct:  303 KPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKI 379          
BLAST of Forkhead box protein D3 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 58.9214 bits (141), Expect = 3.182e-10
Identity = 34/82 (41.46%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISS-SPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQ 522
            +KP  SY A++   I   S +K ++LSEI   I + F YY+     WQ+S+RHNLSLN  F K+ ++    GKG  W LD +
Sbjct:  460 TKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLDEE 537          
BLAST of Forkhead box protein D3 vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 155.221 bits (391), Expect = 6.751e-48
Identity = 67/89 (75.28%), Postives = 79/89 (88.76%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            SKPPYSYIALI MAI  SP +KLTLS+IC+FI ++F YYR++FP WQNSIRHNLSLNDCF+K+PR+  NPGKGN+W+LDP SEGMFDNG
Sbjct:    2 SKPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPASEGMFDNG 90          
BLAST of Forkhead box protein D3 vs. Ensembl Nematostella
Match: EDO45102 (Forkhead domain protein E; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q3LUS8])

HSP 1 Score: 134.42 bits (337), Expect = 1.046e-36
Identity = 62/104 (59.62%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  235 KESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KE     +S   ++  KPPYSYIALI MAI+SSP ++LTLSEI DFI ++F +Y+     W+NSIRHNL+LNDCFIK+PR+ N PGKGN+W++DP S  MFDNG
Sbjct:   27 KEVGDKKQSRRQQSRGKPPYSYIALICMAITSSPQRQLTLSEIYDFISQRFPFYQTCSIKWKNSIRHNLTLNDCFIKLPREPNRPGKGNYWTIDPTSVDMFDNG 130          
BLAST of Forkhead box protein D3 vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 134.806 bits (338), Expect = 2.428e-36
Identity = 61/98 (62.24%), Postives = 74/98 (75.51%), Query Frame = 1
Query:  253 SKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            S+    ++  KPPYSYIALIAMAI S+P K++TLS I  FIM +F YYR+    WQNSIRHNLSLN+CF+K+PRD   PGKG+FW LDP S  MF+NG
Sbjct:   69 SQHPTRQDMVKPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLDPDSLNMFENG 166          
BLAST of Forkhead box protein D3 vs. Ensembl Nematostella
Match: EDO45104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX0])

HSP 1 Score: 124.405 bits (311), Expect = 6.828e-36
Identity = 59/90 (65.56%), Postives = 68/90 (75.56%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPV--WQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALIAMAI  +P K+ TLSEI +FI ++FSYYR   P+  WQNSIRHNLSLNDCFIK  RD  NP KG+ W+L P S  MF+ G
Sbjct:    1 KPPYSYIALIAMAIVEAPDKRRTLSEIVEFIKRRFSYYRGDCPIKGWQNSIRHNLSLNDCFIKTWRDPTNPSKGHLWTLHPNSVDMFEGG 90          
BLAST of Forkhead box protein D3 vs. Ensembl Nematostella
Match: EDO39562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S5])

HSP 1 Score: 125.561 bits (314), Expect = 1.768e-34
Identity = 56/91 (61.54%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  274 NASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
             ++KPPYSYI+L AMAI SSP K L+LSEI  FIM  F +YRD    WQNS+RHNLS NDCF+KIPR  + PGKG+ W+L P    MF+NG
Sbjct:   10 GSAKPPYSYISLTAMAIQSSPQKMLSLSEIYQFIMDHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPDCGTMFENG 100          
BLAST of Forkhead box protein D3 vs. Ensembl Medaka
Match: foxd3 (forkhead box D3 [Source:NCBI gene;Acc:100301607])

HSP 1 Score: 159.458 bits (402), Expect = 1.286e-45
Identity = 82/126 (65.08%), Postives = 99/126 (78.57%), Query Frame = 1
Query:  223 SSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNGXXXXXXXXXXXXXPEIMR 600
            S++   + Q  KS ++K    PPYSYIALI MAI  SP KKLTLS IC+FI  +F YYR++FP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W++DP SE MFDNGSFLRRR+RFK   P+++R
Sbjct:  103 STTPGGTMQKPKSSLVK----PPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTMDPASEDMFDNGSFLRRRKRFKRVQPDVLR 224          
BLAST of Forkhead box protein D3 vs. Ensembl Medaka
Match: ENSORLT00000004708.2 (forkhead box protein D1-like [Source:NCBI gene;Acc:101160044])

HSP 1 Score: 155.221 bits (391), Expect = 4.318e-45
Identity = 67/92 (72.83%), Postives = 78/92 (84.78%), Query Frame = 1
Query:  271 KNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            + ASKPPYSYIALI MAI  SP KKLTL EIC+FI ++F YY++RFP WQNSIRHNLSLNDCFIK+PR+  NPGKGN+W+LDP S  MF+NG
Sbjct:   51 RGASKPPYSYIALITMAILQSPKKKLTLGEICEFISQRFVYYQERFPAWQNSIRHNLSLNDCFIKMPREPGNPGKGNYWTLDPMSADMFENG 142          
BLAST of Forkhead box protein D3 vs. Ensembl Medaka
Match: zgc:162612 (forkhead box D4 [Source:NCBI gene;Acc:100301608])

HSP 1 Score: 154.066 bits (388), Expect = 2.532e-44
Identity = 65/88 (73.86%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEICDFI ++F YYR++FP WQNSIRHNLSLNDCF+K+PR+  NPGKGN+W+LDP S  MF+NG
Sbjct:   65 KPPYSYIALITMAILQSPKKRLTLSEICDFISQRFVYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENG 152          
BLAST of Forkhead box protein D3 vs. Ensembl Medaka
Match: FOXD2 (forkhead box D1 [Source:NCBI gene;Acc:100302451])

HSP 1 Score: 154.066 bits (388), Expect = 6.265e-44
Identity = 66/88 (75.00%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP K+LTLSEIC+FI  +F YYR++FP WQNSIRHNLSLNDCF+KIPR+  NPGKGN+W+LDP S  MFDNG
Sbjct:   89 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPDSADMFDNG 176          
BLAST of Forkhead box protein D3 vs. Ensembl Medaka
Match: foxe3 (forkhead box E3 [Source:NCBI gene;Acc:100301611])

HSP 1 Score: 140.198 bits (352), Expect = 2.556e-38
Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
             KPPYSYIALIAMAI++SP +KLTL  I  FIM++F +YR+    WQNSIRHNL+LNDCF+KIPR+   PGKGN+W+LDP +E MFDNG
Sbjct:   79 GKPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPREPGRPGKGNYWTLDPAAEDMFDNG 167          
BLAST of Forkhead box protein D3 vs. Planmine SMEST
Match: SMESG000021761.1 (SMESG000021761.1)

HSP 1 Score: 372.859 bits (956), Expect = 1.251e-131
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 1
Query:  205 MVYKISSSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNGXXXXXXXXXXXXXPEIMRAXXXXXXXXXXXLSKILNSTIYEYLNPCTKLLFMNLVPNEAFQNVFFRDNISGSSEISLKSQSSHKSLNNKFLIANIINKV 843
            MVYKISSSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNGSFLRRRRRFKSRLPEIMRANIRRININNEILSKILNSTIYEYLNPCTKLLFMNLVPNEAFQNVFFRDNISGSSEISLKSQSSHKSLNNKFLIANIINKV
Sbjct:    1 MVYKISSSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNGSFLRRRRRFKSRLPEIMRANIRRININNEILSKILNSTIYEYLNPCTKLLFMNLVPNEAFQNVFFRDNISGSSEISLKSQSSHKSLNNKFLIANIINKV 213          
BLAST of Forkhead box protein D3 vs. Planmine SMEST
Match: SMESG000077075.1 (SMESG000077075.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.436e-44
Identity = 69/88 (78.41%), Postives = 77/88 (87.50%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MAI  SP +KLTLS IC+FIM +F YY+DRFP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDP+SE MFDNG
Sbjct:  151 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNG 238          
BLAST of Forkhead box protein D3 vs. Planmine SMEST
Match: SMESG000065690.1 (SMESG000065690.1)

HSP 1 Score: 135.961 bits (341), Expect = 1.858e-39
Identity = 60/89 (67.42%), Postives = 72/89 (80.90%), Query Frame = 1
Query:  280 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            SKPPYSYIALI M+I  S  K+LTL+EIC FI+  F YYR+RFP WQNSIRHNLSLNDCF+K PR+  + GKGN+W+LDP +  MF+NG
Sbjct:    8 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENG 96          
BLAST of Forkhead box protein D3 vs. Planmine SMEST
Match: SMESG000015673.1 (SMESG000015673.1)

HSP 1 Score: 135.191 bits (339), Expect = 3.302e-36
Identity = 59/88 (67.05%), Postives = 70/88 (79.55%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALI MA+ + P KK+TLS I  FIM+KF YYR+    WQNSIRHNLSLN+CFIKIPRD   PGKG++W+L PQ+  MF+NG
Sbjct:   73 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENG 160          
BLAST of Forkhead box protein D3 vs. Planmine SMEST
Match: SMESG000021434.1 (SMESG000021434.1)

HSP 1 Score: 125.561 bits (314), Expect = 6.481e-34
Identity = 59/88 (67.05%), Postives = 67/88 (76.14%), Query Frame = 1
Query:  283 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 546
            KPPYSYIALIAMAI ++P KK+TLS I  FI   F +Y      WQNSIRHNLSLNDCFIKI RD NNPGKGN+W+L+   E MFD+G
Sbjct:   64 KPPYSYIALIAMAIRNTPDKKITLSGIYKFITDNFPFYHRNKQGWQNSIRHNLSLNDCFIKIARDKNNPGKGNYWTLNENFEEMFDHG 151          
The following BLAST results are available for this feature:
BLAST of Forkhead box protein D3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXD32.911e-4477.27forkhead box D3 [Source:HGNC Symbol;Acc:HGNC:3804][more]
FOXD11.500e-4375.00forkhead box D1 [Source:HGNC Symbol;Acc:HGNC:3802][more]
FOXD4L12.237e-4366.34forkhead box D4 like 1 [Source:HGNC Symbol;Acc:HGN... [more]
FOXD4L64.273e-4366.34forkhead box D4 like 6 [Source:HGNC Symbol;Acc:HGN... [more]
FOXD4L34.364e-4366.34forkhead box D4 like 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1301.689e-4373.03pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
lin-313.835e-3056.04pep chromosome:WBcel235:II:3982549:3986944:1 gene:... [more]
pha-42.159e-2958.43Defective pharyngeal development protein 4 [Sourc... [more]
pha-42.756e-2958.43Defective pharyngeal development protein 4 [Sourc... [more]
pha-44.413e-2958.43Defective pharyngeal development protein 4 [Sourc... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd59A8.941e-4578.41gene:FBgn0004896 transcript:FBtr0071898[more]
croc2.151e-3463.04gene:FBgn0014143 transcript:FBtr0078395[more]
fkh7.839e-3261.80gene:FBgn0000659 transcript:FBtr0300259[more]
fkh7.839e-3261.80gene:FBgn0000659 transcript:FBtr0345227[more]
fkh7.839e-3261.80gene:FBgn0000659 transcript:FBtr0085321[more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd34.170e-4768.00forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
foxd11.615e-4576.14forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
foxd52.876e-4579.55forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4... [more]
foxd52.876e-4579.55forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4... [more]
foxd21.604e-4462.50forkhead box D2 [Source:ZFIN;Acc:ZDB-GENE-980605-6... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXD23.033e-4566.36forkhead box D2 [Source:NCBI gene;Acc:100495241][more]
foxd33.169e-4577.27forkhead box D3 [Source:NCBI gene;Acc:496851][more]
foxd13.467e-4562.07forkhead box D1 [Source:NCBI gene;Acc:493510][more]
ankra21.405e-4479.55ankyrin repeat family A member 2 [Source:Xenbase;A... [more]
arhgef286.488e-4477.27Rho guanine nucleotide exchange factor 28 [Source:... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxd31.073e-4477.27forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473... [more]
Foxd31.073e-4477.27forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473... [more]
Foxd13.522e-4475.00forkhead box D1 [Source:MGI Symbol;Acc:MGI:1347463... [more]
Foxd22.866e-4375.00forkhead box D2 [Source:MGI Symbol;Acc:MGI:1347471... [more]
Foxd45.363e-4273.03forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467... [more]
back to top
BLAST of Forkhead box protein D3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63245|FOXD3_RAT7.086e-4677.27Forkhead box protein D3 (Fragment) OS=Rattus norve... [more]
sp|Q9PSY4|FOXD1_XENLA2.340e-4561.86Forkhead box protein D1 OS=Xenopus laevis OX=8355 ... [more]
sp|Q63251|FOXD1_RAT4.745e-4575.00Forkhead box protein D1 (Fragment) OS=Rattus norve... [more]
sp|Q9PRJ8|FXD5A_XENLA9.040e-4568.22Forkhead box protein D5-A OS=Xenopus laevis OX=835... [more]
sp|Q9DEN3|FXD3B_XENLA1.420e-4477.27Forkhead box protein D3-B OS=Xenopus laevis OX=835... [more]
back to top
BLAST of Forkhead box protein D3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4N41.788e-4569.16FoxD-like protein OS=Hofstenia miamia OX=442651 PE... [more]
A0A0P7YB213.411e-4569.44Forkhead box protein D5-A-like OS=Scleropages form... [more]
A0A0A9WTF63.625e-4565.87Fork head domain-containing protein FD3 (Fragment)... [more]
A0A183ANY65.238e-4567.26Fork-head domain-containing protein OS=Echinostoma... [more]
A0A183FP241.055e-4474.73Fork-head domain-containing protein OS=Heligmosomo... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd11.712e-4664.81forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
foxd31.165e-4576.34forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
zgc:1626123.452e-4575.00zgc:162612 [Source:ZFIN;Acc:ZDB-GENE-070410-88][more]
foxd27.367e-4464.81forkhead box protein D2 [Source:NCBI gene;Acc:1030... [more]
foxc1b4.360e-3763.04forkhead box C1b [Source:NCBI gene;Acc:79375][more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXC21.346e-3863.16forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
ENSPMAT00000002547.17.702e-3660.87pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gen... [more]
foxf2a1.282e-3554.35forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2a1.583e-3554.35forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxg1a1.932e-3453.21forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM19.565e-2252.22Forkhead transcription factor; drives S-phase acti... [more]
FKH25.903e-1950.65Forkhead family transcription factor; rate-limitin... [more]
FKH11.705e-1644.16Forkhead family transcription factor; rate-limitin... [more]
FHL13.182e-1041.46Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451056.751e-4875.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451021.046e-3659.62Forkhead domain protein E; Predicted protein [Sou... [more]
EDO339002.428e-3662.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451046.828e-3665.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395621.768e-3461.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Forkhead box protein D3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd31.286e-4565.08forkhead box D3 [Source:NCBI gene;Acc:100301607][more]
ENSORLT00000004708.24.318e-4572.83forkhead box protein D1-like [Source:NCBI gene;Acc... [more]
zgc:1626122.532e-4473.86forkhead box D4 [Source:NCBI gene;Acc:100301608][more]
FOXD26.265e-4475.00forkhead box D1 [Source:NCBI gene;Acc:100302451][more]
foxe32.556e-3867.42forkhead box E3 [Source:NCBI gene;Acc:100301611][more]
back to top
BLAST of Forkhead box protein D3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021761.11.251e-131100.00SMESG000021761.1[more]
SMESG000077075.11.436e-4478.41SMESG000077075.1[more]
SMESG000065690.11.858e-3967.42SMESG000065690.1[more]
SMESG000015673.13.302e-3667.05SMESG000015673.1[more]
SMESG000021434.16.481e-3467.05SMESG000021434.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010268 ID=SMED30010268|Name=Forkhead box protein D3|organism=Schmidtea mediterranea sexual|type=transcript|length=900bp
TTTAGAAAATATTTAAAAATTATTTAACATTATAATTTTAAATTGTAAAT
TTTCATTCTATTTCATTCGTTATAATAATTTGATATGATGCGTTATCCAG
CCAATAATAATAAATTCCGTTTTTGTATATATACACATTTAGATATACAT
ATTTTGATATATATTATATATCAAGAGTTTCATATTTTATAGTTTCACTT
CTTAATGGTATATAAAATCAGTAGTTCAAGTACCAAGGAAAGCCGGCAAC
TTTCAAAATCTGAAGTAATAAAAAATGCTTCCAAACCTCCATATTCGTAT
ATAGCTCTAATAGCAATGGCTATCTCTAGTTCTCCTTCAAAAAAACTTAC
ATTAAGTGAAATATGTGATTTCATTATGAAGAAATTCTCTTATTATCGAG
ATAGATTTCCTGTATGGCAAAATAGTATCCGACACAATCTTTCTTTAAAT
GATTGTTTCATAAAGATTCCCAGAGATTCAAATAATCCGGGTAAAGGCAA
CTTTTGGAGTTTAGATCCCCAATCTGAAGGAATGTTTGATAATGGAAGTT
TTCTAAGACGCAGAAGGAGATTCAAAAGTAGATTGCCAGAGATAATGAGA
GCAAATATTAGACGGATAAATATCAACAATGAGATTCTATCAAAAATTCT
AAACTCAACAATTTACGAATATTTGAATCCGTGCACAAAACTTTTATTTA
TGAACTTAGTGCCAAATGAGGCTTTTCAAAATGTGTTCTTCCGTGACAAT
ATTTCAGGATCGTCTGAAATCAGTTTGAAATCACAATCTTCCCATAAATC
TTTAAACAATAAATTTTTGATTGCAAACATAATAAATAAAGTGTGAGTTC
TACTTAACAAAAGATTTGAATAAAGTTATGCAAGAATTAAAAGTTTAATA
back to top

protein sequence of SMED30010268-orf-1

>SMED30010268-orf-1 ID=SMED30010268-orf-1|Name=SMED30010268-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=214bp
MVYKISSSSTKESRQLSKSEVIKNASKPPYSYIALIAMAISSSPSKKLTL
SEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNF
WSLDPQSEGMFDNGSFLRRRRRFKSRLPEIMRANIRRININNEILSKILN
STIYEYLNPCTKLLFMNLVPNEAFQNVFFRDNISGSSEISLKSQSSHKSL
NNKFLIANIINKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0014034neural crest cell fate commitment
GO:0030154cell differentiation
GO:0050768negative regulation of neurogenesis
GO:0050769positive regulation of neurogenesis
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR018122TF_fork_head_CS_1
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 71..88
score: 79.94
coord: 48..65
score: 52.25
coord: 27..40
score: 77.89
IPR001766Fork head domainSMARTSM00339forkneu4coord: 25..115
e-value: 6.5E-54
score: 195.1
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 26..111
e-value: 3.7E-38
score: 129.6
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 27..121
score: 38.112
IPR001766Fork head domainCDDcd00059FHcoord: 27..104
e-value: 1.18804E-48
score: 151.938
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 25..126
e-value: 1.7E-44
score: 152.0
NoneNo IPR availablePANTHERPTHR11829:SF346FORK HEAD DOMAIN-CONTAINING PROTEIN FD3coord: 13..159
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 13..159
IPR018122Fork head domain conserved site1PROSITEPS00657FORK_HEAD_1coord: 27..40
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 71..77
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 26..121