wdr82-2

Overview
Namewdr82-2 (AGA95406.1)
Smed IDSMED30010267
Length (bp)1041
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of wdr82-2 (SMED30010267) t-SNE clustered cells

Violin plots show distribution of expression levels for wdr82-2 (SMED30010267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of wdr82-2 (SMED30010267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for wdr82-2 (SMED30010267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010267SMESG000044331.1 SmedASXL_008379SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010267SMESG000044331.1 SmedASXL_008379SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30010267SMESG000044331.1 dd_Smed_v4_4830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010267SMESG000044331.1 KC262342smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30010267SMESG000044331.1 KC262342smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30010267SMESG000044331.1 KC262342smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30010267SMESG000044331.1 SMED_08511_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010267SMESG000044331.1 SMED_08511_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of wdr82-2 vs. Ensembl Human
Match: WDR82 (WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:28826])

HSP 1 Score: 216.468 bits (550), Expect = 1.974e-91
Identity = 106/206 (51.46%), Postives = 145/206 (70.39%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I I +NGS I++IDAF G ++  F    AN + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGY-ANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDG-KHT-----GPITCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 140.198 bits (352), Expect = 1.974e-91
Identity = 64/108 (59.26%), Postives = 86/108 (79.63%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D+ ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GHSK
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSK 108          
BLAST of wdr82-2 vs. Ensembl Human
Match: WDR82 (WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:28826])

HSP 1 Score: 113.235 bits (282), Expect = 7.997e-31
Identity = 52/74 (70.27%), Postives = 61/74 (82.43%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFE 600
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF+
Sbjct:    1 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFK 74          
BLAST of wdr82-2 vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 64.6994 bits (156), Expect = 1.932e-17
Identity = 56/203 (27.59%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 44.2838 bits (103), Expect = 1.932e-17
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS NGE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   45 TKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 2.626e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 63.929 bits (154), Expect = 1.900e-16
Identity = 56/203 (27.59%), Postives = 93/203 (45.81%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+T+++W++KT   L  +     PV A  F+  G + V+G      +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   G+ L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G  HT    S      A +P   +I+SA 
Sbjct:  135 PPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSF------------VKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQG--HTDVVIS-----AACHPTENLIASAA 316          

HSP 2 Score: 41.5874 bits (96), Expect = 1.900e-16
Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNL--MQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T+ ++S+ FS NGE L SSS D  +II+    G  ++ L    YG NL       SS+++   S   D T++   +   K ++   GHS
Sbjct:   41 TEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTL----YGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHS 125          

HSP 3 Score: 49.6766 bits (117), Expect = 3.689e-6
Identity = 37/153 (24.18%), Postives = 76/153 (49.67%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S   +S S DKT++LWD+++   L  +  H+       F+P   + ++G   E++K++++++         + +    D  +A+ F+ +G +I   S     ++ DA  G+ L   ++   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   95 SSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGK-----CLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKT-LVDDDNP---PVSFVKFSPNGKYILTATLDNTLKLWD 238          
BLAST of wdr82-2 vs. Ensembl Human
Match: WDR82 (WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:28826])

HSP 1 Score: 68.9366 bits (167), Expect = 9.717e-15
Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQI 519
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG I
Sbjct:    1 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLI 47          
BLAST of wdr82-2 vs. Ensembl Celegans
Match: swd-2.2 (Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL;Acc:Q18403])

HSP 1 Score: 166.007 bits (419), Expect = 1.894e-67
Identity = 82/201 (40.80%), Postives = 130/201 (64.68%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAED-EWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFW 978
            +SP+ DMFLS + DKTIRLWDLKTHN +G ++ +  P+  FDPEG +F AG+++  +KLYDLRS+DKGPF +F  ++  ++ EW A++FSP G+ I IC+N SQ+ ++DAF G L+   +    N Q++P+   F+P+S +++ G+ DG +  ++ E    +AL      T    +Q  +   F+P+  + ++A T LT W
Sbjct:  120 VSPMDDMFLSVAEDKTIRLWDLKTHNCIGLMNLSATPIATFDPEGLLFAAGLDNNIIKLYDLRSFDKGPFSSFGPLENEDNVEWTAMRFSPCGKYIMICTNSSQLLLVDAFTG-LIKFTLEEHQNAQKIPLMASFTPESSHIMVGSSDGYIYFYDVET-GEIAL-----KTLAPNNQTCHIAEFSPQHFVAATADTKLTLW 313          

HSP 2 Score: 109.383 bits (272), Expect = 1.894e-67
Identity = 52/112 (46.43%), Postives = 76/112 (67.86%), Query Frame = 3
Query:   27 TFLQMKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            T  ++++   ++ K  P+K   D T ++NSLS+   G+++I S+ DD M +YD  TG+  R +NSKKYG + ++F   S  A+H STK+D+TIR+LSL DNKYIRYF GH K
Sbjct:    2 TMKEVEITAESLAKLTPAKQPNDTTTRVNSLSYGLKGDHMIMSTDDDSMFLYDMNTGLRSRSVNSKKYGCSHVKFASDSMCALHGSTKVDNTIRYLSLTDNKYIRYFQGHDK 113          
BLAST of wdr82-2 vs. Ensembl Celegans
Match: swd-2.1 (Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL;Acc:Q18404])

HSP 1 Score: 132.109 bits (331), Expect = 8.713e-45
Identity = 69/197 (35.03%), Postives = 114/197 (57.87%), Query Frame = 1
Query:  394 DMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSP 984
            + FLS S+D  IR++D +T  + G +     P+ AFDP+G +F     S+++KL+D+RS+D GPF +F + +   DEW+ ++FSP G+ I I +    +K IDAFDG L+ +F     NP ++P+    S DS +++ G+ D  + I++TE       +P    TP    +P + VAFN K  +++S    +  W+P
Sbjct:  125 EKFLSSSVDGEIRMFDTRTFENYGCLLAGHTPLIAFDPDGILFAVATKSDTIKLFDMRSFDLGPFQSFIITKTDNDEWSDIEFSPCGKFILISTTAGSVKWIDAFDGTLIHSFS-QHKNPNKIPLRASVSTDSGFVMVGSADRNVYIYSTETGGVTCKLP----TP--YPEPSHVVAFNQKQFLMTSLGREVILWAP 314          

HSP 2 Score: 67.3958 bits (163), Expect = 8.713e-45
Identity = 36/98 (36.73%), Postives = 57/98 (58.16%), Query Frame = 3
Query:   63 KKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGH 356
            K   PSK F + ++K+  L++S +G NLI S+ +D +++YD   G   + +  KKYGVN +++  +    +H+    D TIR L L    Y+RYF GH
Sbjct:   16 KALTPSKKFNETSNKLLDLAYSDDGNNLIVSA-EDVVLVYDLRDGSKGKSIECKKYGVNCLEYLDTVK-CVHSGPN-DTTIRLLHLQKKSYVRYFDGH 110          
BLAST of wdr82-2 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 63.5438 bits (153), Expect = 3.927e-11
Identity = 55/198 (27.78%), Postives = 93/198 (46.97%), Query Frame = 1
Query:  403 LSGSLDKTIRLWDLKTH-NSLGFI-HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNG--SQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV-TNLTFW 978
            LSGS DKT+RLWDL    ++  FI HT      AF  + +  V+G   +S+KL++  +  K     + +  +   +W + ++FSP+ R   I S G    +KV +  + +L +N +        V +    SPD      G  DGQ  +W+      +  +PG D         IN ++F+P    + +AV +++  W
Sbjct:   85 LSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWNTLAQCK-----YTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVTV----SPDGSLCASGGKDGQAMLWDLNEGKHLYTLPGND--------VINAMSFSPNRYWLCAAVGSSIKIW 265          
BLAST of wdr82-2 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 63.5438 bits (153), Expect = 3.927e-11
Identity = 55/198 (27.78%), Postives = 93/198 (46.97%), Query Frame = 1
Query:  403 LSGSLDKTIRLWDLKTH-NSLGFI-HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNG--SQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV-TNLTFW 978
            LSGS DKT+RLWDL    ++  FI HT      AF  + +  V+G   +S+KL++  +  K     + +  +   +W + ++FSP+ R   I S G    +KV +  + +L +N +        V +    SPD      G  DGQ  +W+      +  +PG D         IN ++F+P    + +AV +++  W
Sbjct:   85 LSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWNTLAQCK-----YTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVTV----SPDGSLCASGGKDGQAMLWDLNEGKHLYTLPGND--------VINAMSFSPNRYWLCAAVGSSIKIW 265          
BLAST of wdr82-2 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 63.5438 bits (153), Expect = 3.927e-11
Identity = 55/198 (27.78%), Postives = 93/198 (46.97%), Query Frame = 1
Query:  403 LSGSLDKTIRLWDLKTH-NSLGFI-HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNG--SQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV-TNLTFW 978
            LSGS DKT+RLWDL    ++  FI HT      AF  + +  V+G   +S+KL++  +  K     + +  +   +W + ++FSP+ R   I S G    +KV +  + +L +N +        V +    SPD      G  DGQ  +W+      +  +PG D         IN ++F+P    + +AV +++  W
Sbjct:   85 LSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWNTLAQCK-----YTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVTV----SPDGSLCASGGKDGQAMLWDLNEGKHLYTLPGND--------VINAMSFSPNRYWLCAAVGSSIKIW 265          
BLAST of wdr82-2 vs. Ensembl Fly
Match: Wdr82 (gene:FBgn0032030 transcript:FBtr0079650)

HSP 1 Score: 229.18 bits (583), Expect = 2.967e-98
Identity = 110/206 (53.40%), Postives = 148/206 (71.84%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            +SPV D FLSGSLDKT+RLWDL++ N  G +H +GRP+ A+DPEG IF AGVNSES+KLYDLRS+DKGPFVTF++ QE E +W  LKFS +G+ I I +NGS I+++DAF G  L  F     N + +PI+  FSPDSQ++  G+ DG++ IWN +  N+V+++ G DH       P+ CV FNPK+ M++SA TN+ FW P  +E
Sbjct:  117 ISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGY-PNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNG-DH-----PGPVQCVQFNPKYMMLASACTNMAFWLPTSEE 315          

HSP 2 Score: 149.443 bits (376), Expect = 2.967e-98
Identity = 67/110 (60.91%), Postives = 92/110 (83.64%), Query Frame = 3
Query:   33 LQMKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            +++KL D+ ++ F  +K F++NTDKIN++ F+ NGE+LIS S DDQ++IYDC  G   R +NSKKYGV+L+ FTH++NTAIH+STK+DDTIR+LSLHDNKY+RYF GH+K
Sbjct:    1 MKIKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNKYLRYFPGHTK 110          
BLAST of wdr82-2 vs. Ensembl Fly
Match: CG3515 (gene:FBgn0031431 transcript:FBtr0077750)

HSP 1 Score: 113.62 bits (283), Expect = 4.230e-33
Identity = 57/198 (28.79%), Postives = 100/198 (50.51%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSP 984
             ++F+S   D  + +WD++       I    RP+ AFDPEG        +E +++ D+R     P   F     A+  W  L+F+PNG+ + + ++ S    + A DG    +F    +N  R+P+D  ++PDSQ+++ GA  G++ IW   +   VA++ G      +   P+ C+ FNP+  M  S+ + + FW P
Sbjct:  121 ENVFISAGRDDQVYMWDIRVKTHTHRIKNLRRPLCAFDPEGLFLATSSGTEGIQIRDVRMMGGEPSRKFVYQVNAKANWTQLQFAPNGKSLLLSTDHSWCFSVSAIDGTYQQSFTGY-SNKLRLPLDATYTPDSQFILSGADKGRIHIWRAADGFPVAVLKG------NNMGPVRCMRFNPRATMFVSSDSRIVFWMP 311          

HSP 2 Score: 47.3654 bits (111), Expect = 4.230e-33
Identity = 29/113 (25.66%), Postives = 56/113 (49.56%), Query Frame = 3
Query:   33 LQMKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSKSGN 371
            + ++LND+ +++F  +K F +      ++ FSS+G  L+   +   + I+     V    +    Y  ++  F       +H+++K D TIR L L+    +R F GH+K+ N
Sbjct:    1 MSIRLNDDAMRQFRVAKVFPETKHHTLAMEFSSDGLRLLVCDHS-ALSIFSSTRQVQVCKVPMHHYLPDVACFVQQDTRVLHSTSKHDYTIRCLDLNTRHCVRVFGGHAKTIN 112          
BLAST of wdr82-2 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 68.1662 bits (165), Expect = 1.190e-17
Identity = 55/203 (27.09%), Postives = 94/203 (46.31%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD++T   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN ++K  V  + G   T       + C A +P   +I+SA 
Sbjct:  166 PQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDT-------VLCTACHPTENIIASAA 347          

HSP 2 Score: 40.4318 bits (93), Expect = 1.190e-17
Identity = 25/87 (28.74%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++++ FS NGE L SSS D  + I+    G  ++ ++  K G++ + +  SS++ +  S   D T++   L   K ++   GHS
Sbjct:   72 TKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAW--SSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156          

HSP 3 Score: 50.447 bits (119), Expect = 1.178e-6
Identity = 35/111 (31.53%), Postives = 52/111 (46.85%), Query Frame = 1
Query:  628 NALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSA 957
            +A+KFSPNG  +A  S    IK+  A+DGK          +  ++ I DV +S DS+ LV G+ D  L +W       +  + G        S  + C  FNP+  +I S 
Sbjct:   76 SAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTI-----SGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGH-------SNYVFCCNFNPQSNLIVSG 174          
BLAST of wdr82-2 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 68.1662 bits (165), Expect = 1.190e-17
Identity = 55/203 (27.09%), Postives = 94/203 (46.31%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD++T   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN ++K  V  + G   T       + C A +P   +I+SA 
Sbjct:  166 PQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDT-------VLCTACHPTENIIASAA 347          

HSP 2 Score: 40.4318 bits (93), Expect = 1.190e-17
Identity = 25/87 (28.74%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++++ FS NGE L SSS D  + I+    G  ++ ++  K G++ + +  SS++ +  S   D T++   L   K ++   GHS
Sbjct:   72 TKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAW--SSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156          

HSP 3 Score: 50.447 bits (119), Expect = 1.178e-6
Identity = 35/111 (31.53%), Postives = 52/111 (46.85%), Query Frame = 1
Query:  628 NALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSA 957
            +A+KFSPNG  +A  S    IK+  A+DGK          +  ++ I DV +S DS+ LV G+ D  L +W       +  + G        S  + C  FNP+  +I S 
Sbjct:   76 SAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTI-----SGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGH-------SNYVFCCNFNPQSNLIVSG 174          
BLAST of wdr82-2 vs. Ensembl Fly
Match: CG10931 (gene:FBgn0034274 transcript:FBtr0089545)

HSP 1 Score: 58.9214 bits (141), Expect = 1.715e-15
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNA----LKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQ-------YLVCGAPDGQLCIWNTENKNRVALI 870
            P +++  S S D+T+RLWD++T  +L  +H    P+ +  F  +G IFV       ++L+D          T  V++   D  N     +KFSPNGR I   +  + +++ +    K +  +        R  ++  +  +S        ++V G+ D  LCIWN + +  V  I
Sbjct:  149 PQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSS--------TGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTY--------RGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKI 307          

HSP 2 Score: 42.3578 bits (98), Expect = 1.715e-15
Identity = 27/85 (31.76%), Postives = 40/85 (47.06%), Query Frame = 3
Query:  108 INSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            +  L FSSNGENL+SSS D  + ++D       + L     GVN + +   S   + AS   D T+R         ++   GHS+
Sbjct:   59 VTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAW---SAAGLIASCSDDMTVRLWDARSKLCVKVLEGHSR 140          

HSP 3 Score: 50.0618 bits (118), Expect = 1.280e-6
Identity = 33/151 (21.85%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  397 MFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            +  S S D T+RLWD ++   +  +  H+       F+P+  +  +    E+++L+D+R+       T ++V   +D   ++ F  +G +    S    +++ D+  G +L   +    +   +P+  V FSP+ +Y++    +  L +WN
Sbjct:  111 LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGK-----TLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLV----DVDNIPVGYVKFSPNGRYILSSTLNNTLRLWN 252          
BLAST of wdr82-2 vs. Ensembl Zebrafish
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:321614])

HSP 1 Score: 217.238 bits (552), Expect = 1.060e-91
Identity = 104/206 (50.49%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  E   EW  LKFS +G++I + +NG  ++V+DAF G +L +F     N + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VAL+ G  HT      P+ C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKLQYERTCEWTGLKFSNDGKLILVSTNGGTLRVLDAFKGAVLHSFGGYN-NSKGVILEASFTPDSQFIMIGSEDGKIHVWNAESGMKVALLDG-KHT-----GPVTCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 139.813 bits (351), Expect = 1.060e-91
Identity = 64/108 (59.26%), Postives = 87/108 (80.56%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D+ ++ F  +K F++N+DKIN   FSSNGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNK 108          
BLAST of wdr82-2 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 65.4698 bits (158), Expect = 3.172e-17
Identity = 56/203 (27.59%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 42.3578 bits (98), Expect = 3.172e-17
Identity = 25/87 (28.74%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS +GE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   45 TKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 1.913e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Ensembl Zebrafish
Match: katnb1 (katanin p80 (WD repeat containing) subunit B 1 [Source:NCBI gene;Acc:406291])

HSP 1 Score: 64.6994 bits (156), Expect = 1.469e-11
Identity = 48/182 (26.37%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  394 DMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFD--PEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNP 933
            +  ++GSL  ++RLWDL+    L  +      + + D  P G+   +G    ++KL+D+R   KG    ++   +A      L FSP+G+ +A  S+ S +K+ D   GK+++ F    ++   V + V F P+   L  G+ D  + +W+ E  N +    G        +  +  V FNP
Sbjct:   76 ERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRR--KGCVFRYKGHTQAV---RCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFT---SHTSAVNV-VQFHPNEYLLASGSADRTVKLWDLEKFNMIGSSEG-------ETGVVRSVLFNP 241          

HSP 2 Score: 47.3654 bits (111), Expect = 8.609e-6
Identity = 38/143 (26.57%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI--DVCFSPDSQYL 801
            P+ +   SGS+D  I+LWD++    +     HT      AF P+G+   +  +  ++KL+DL +   G  +T E         N ++F PN  ++A   +GS  + +  +D   L  F ++G++     +   V F+PD   L
Sbjct:  115 PMGEYLASGSVDSNIKLWDVRRKGCVFRYKGHTQAVRCLAFSPDGKWLASASDDSTVKLWDLIA---GKMIT-EFTSHTSAV-NVVQFHPNEYLLA---SGSADRTVKLWD---LEKFNMIGSSEGETGVVRSVLFNPDGSCL 246          
BLAST of wdr82-2 vs. Ensembl Zebrafish
Match: katnb1 (katanin p80 (WD repeat containing) subunit B 1 [Source:NCBI gene;Acc:406291])

HSP 1 Score: 63.5438 bits (153), Expect = 1.346e-10
Identity = 52/202 (25.74%), Postives = 93/202 (46.04%), Query Frame = 1
Query:  394 DMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFD--PEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTN---LTFWSP 984
            +  ++GSL  ++RLWDL+    L  +      + + D  P G+   +G    ++KL+D+R   KG    ++   +A      L FSP+G+ +A  S+ S +K+ D   GK+++ F    ++   V + V F P+   L  G+ D  + +W+ E  N +    G        +  +  V FNP  + + S   N   +  W P
Sbjct:   76 ERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRR--KGCVFRYKGHTQAV---RCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFT---SHTSAVNV-VQFHPNEYLLASGSADRTVKLWDLEKFNMIGSSEG-------ETGVVRSVLFNPDGSCLYSGSENTLRVYGWEP 261          
BLAST of wdr82-2 vs. Ensembl Zebrafish
Match: katnb1 (katanin p80 (WD repeat containing) subunit B 1 [Source:NCBI gene;Acc:406291])

HSP 1 Score: 63.5438 bits (153), Expect = 1.481e-10
Identity = 52/202 (25.74%), Postives = 93/202 (46.04%), Query Frame = 1
Query:  394 DMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFD--PEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTN---LTFWSP 984
            +  ++GSL  ++RLWDL+    L  +      + + D  P G+   +G    ++KL+D+R   KG    ++   +A      L FSP+G+ +A  S+ S +K+ D   GK+++ F    ++   V + V F P+   L  G+ D  + +W+ E  N +    G        +  +  V FNP  + + S   N   +  W P
Sbjct:   76 ERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRR--KGCVFRYKGHTQAV---RCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFT---SHTSAVNV-VQFHPNEYLLASGSADRTVKLWDLEKFNMIGSSEG-------ETGVVRSVLFNPDGSCLYSGSENTLRVYGWEP 261          
BLAST of wdr82-2 vs. Ensembl Xenopus
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:Xenbase;Acc:XB-GENE-993827])

HSP 1 Score: 213.772 bits (543), Expect = 1.649e-90
Identity = 102/206 (49.51%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW ALKFS +G++I + +NG  ++++DAF G ++  F     N + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTALKFSNDGKLILMSTNGGFLRLVDAFKGAVMHTFGGYN-NSKAVTLEATFTPDSQFIMIGSEDGKIHVWNCESGMKVAVLDG-KHT-----GPITCLQFNPKFMTFTSACSNMAFWLPTIDD 313          

HSP 2 Score: 139.813 bits (351), Expect = 1.649e-90
Identity = 64/108 (59.26%), Postives = 85/108 (78.70%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   FS  GE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GHSK
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPTGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSK 108          
BLAST of wdr82-2 vs. Ensembl Xenopus
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:Xenbase;Acc:XB-GENE-993827])

HSP 1 Score: 201.83 bits (512), Expect = 3.973e-87
Identity = 97/197 (49.24%), Postives = 138/197 (70.05%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNL 969
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW ALKFS +G++I + +NG  ++++DAF G ++  F     N + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTALKFSNDGKLILMSTNGGFLRLVDAFKGAVMHTFGGYN-NSKAVTLEATFTPDSQFIMIGSEDGKIHVWNCESGMKVAVLDG-KHTG-----PITCLQFNPKFMTFTSACSNM 304          

HSP 2 Score: 140.584 bits (353), Expect = 3.973e-87
Identity = 64/108 (59.26%), Postives = 85/108 (78.70%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   FS  GE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GHSK
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPTGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSK 108          
BLAST of wdr82-2 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 64.6994 bits (156), Expect = 2.165e-17
Identity = 52/185 (28.11%), Postives = 87/185 (47.03%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQ 906
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +       ++  I   FS    +++V G+ D  + IWN + K  V  + G  HT +S S+
Sbjct:  137 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTC--HKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQG--HTDDSISE 305          

HSP 2 Score: 43.8986 bits (102), Expect = 2.165e-17
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS NGE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   43 TKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 127          

HSP 3 Score: 53.1434 bits (126), Expect = 2.536e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   97 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 240          
BLAST of wdr82-2 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 62.003 bits (149), Expect = 1.024e-16
Identity = 55/203 (27.09%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +       ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTC--HKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 44.2838 bits (103), Expect = 1.024e-16
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 3
Query:   54 NNIKKFVPSKY-------FKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            NN  K  P K           +T  ++S+ FS NGE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 2.424e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 62.003 bits (149), Expect = 1.024e-16
Identity = 55/203 (27.09%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +       ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTC--HKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 44.2838 bits (103), Expect = 1.024e-16
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 3
Query:   54 NNIKKFVPSKY-------FKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            NN  K  P K           +T  ++S+ FS NGE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   23 NNQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 2.424e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Ensembl Mouse
Match: Wdr82 (WD repeat domain containing 82 [Source:MGI Symbol;Acc:MGI:1924555])

HSP 1 Score: 216.468 bits (550), Expect = 1.432e-91
Identity = 106/206 (51.46%), Postives = 145/206 (70.39%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I I +NGS I++IDAF G ++  F    AN + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGY-ANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDG-KHT-----GPITCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 140.198 bits (352), Expect = 1.432e-91
Identity = 64/108 (59.26%), Postives = 86/108 (79.63%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D+ ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GHSK
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSK 108          
BLAST of wdr82-2 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 64.6994 bits (156), Expect = 1.401e-17
Identity = 56/203 (27.59%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 44.2838 bits (103), Expect = 1.401e-17
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS NGE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   45 TKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 1.803e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Ensembl Mouse
Match: Wdr82 (WD repeat domain containing 82 [Source:MGI Symbol;Acc:MGI:1924555])

HSP 1 Score: 61.6178 bits (148), Expect = 8.313e-12
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHL 215
            MKL D+ ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G  K HL
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEG--KDHL 57          
BLAST of wdr82-2 vs. Ensembl Mouse
Match: Wdr82 (WD repeat domain containing 82 [Source:MGI Symbol;Acc:MGI:1924555])

HSP 1 Score: 60.4622 bits (145), Expect = 1.269e-11
Identity = 27/53 (50.94%), Postives = 38/53 (71.70%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITG 197
            MKL D+ ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEG 53          
BLAST of wdr82-2 vs. Ensembl Mouse
Match: Wdr82 (WD repeat domain containing 82 [Source:MGI Symbol;Acc:MGI:1924555])

HSP 1 Score: 58.5362 bits (140), Expect = 4.158e-11
Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = 3
Query:  264 NTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSKSGN 371
            NT +++S K+DDTIR+LSLHDNKYIRYF GHSK  +
Sbjct:    1 NTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRAS 36          
BLAST of wdr82-2 vs. UniProt/SwissProt
Match: sp|Q9VLN1|WDR82_DROME (WD repeat-containing protein 82 OS=Drosophila melanogaster OX=7227 GN=Wdr82 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.219e-97
Identity = 110/206 (53.40%), Postives = 148/206 (71.84%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            +SPV D FLSGSLDKT+RLWDL++ N  G +H +GRP+ A+DPEG IF AGVNSES+KLYDLRS+DKGPFVTF++ QE E +W  LKFS +G+ I I +NGS I+++DAF G  L  F     N + +PI+  FSPDSQ++  G+ DG++ IWN +  N+V+++ G DH       P+ CV FNPK+ M++SA TN+ FW P  +E
Sbjct:  117 ISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGY-PNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNG-DH-----PGPVQCVQFNPKYMMLASACTNMAFWLPTSEE 315          

HSP 2 Score: 149.443 bits (376), Expect = 2.219e-97
Identity = 67/110 (60.91%), Postives = 92/110 (83.64%), Query Frame = 3
Query:   33 LQMKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            +++KL D+ ++ F  +K F++NTDKIN++ F+ NGE+LIS S DDQ++IYDC  G   R +NSKKYGV+L+ FTH++NTAIH+STK+DDTIR+LSLHDNKY+RYF GH+K
Sbjct:    1 MKIKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNKYLRYFPGHTK 110          
BLAST of wdr82-2 vs. UniProt/SwissProt
Match: sp|Q6NV31|WDR82_DANRE (WD repeat-containing protein 82 OS=Danio rerio OX=7955 GN=wdr82 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 6.382e-91
Identity = 104/206 (50.49%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  E   EW  LKFS +G++I + +NG  ++V+DAF G +L +F     N + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VAL+ G  HT      P+ C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKLQYERTCEWTGLKFSNDGKLILVSTNGGTLRVLDAFKGAVLHSFGGYN-NSKGVILEASFTPDSQFIMIGSEDGKIHVWNAESGMKVALLDG-KHT-----GPVTCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 139.813 bits (351), Expect = 6.382e-91
Identity = 64/108 (59.26%), Postives = 87/108 (80.56%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D+ ++ F  +K F++N+DKIN   FSSNGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNK 108          
BLAST of wdr82-2 vs. UniProt/SwissProt
Match: sp|Q8BFQ4|WDR82_MOUSE (WD repeat-containing protein 82 OS=Mus musculus OX=10090 GN=Wdr82 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.465e-91
Identity = 106/206 (51.46%), Postives = 145/206 (70.39%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I I +NGS I++IDAF G ++  F    AN + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGY-ANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDG-KHT-----GPITCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 140.198 bits (352), Expect = 8.465e-91
Identity = 64/108 (59.26%), Postives = 86/108 (79.63%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D+ ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GHSK
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSK 108          
BLAST of wdr82-2 vs. UniProt/SwissProt
Match: sp|Q6UXN9|WDR82_HUMAN (WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.465e-91
Identity = 106/206 (51.46%), Postives = 145/206 (70.39%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I I +NGS I++IDAF G ++  F    AN + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGY-ANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDG-KHT-----GPITCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 140.198 bits (352), Expect = 8.465e-91
Identity = 64/108 (59.26%), Postives = 86/108 (79.63%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D+ ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GHSK
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSK 108          
BLAST of wdr82-2 vs. UniProt/SwissProt
Match: sp|Q5ZMV7|WDR82_CHICK (WD repeat-containing protein 82 OS=Gallus gallus OX=9031 GN=WDR82 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.453e-90
Identity = 105/206 (50.97%), Postives = 143/206 (69.42%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I I +NG  I++IDAF G +L  F     N + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VA++ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGGFIRLIDAFKGAVLHTFGGYN-NSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGMKVAVLDG-KHT-----GPITCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 140.584 bits (353), Expect = 1.453e-90
Identity = 64/108 (59.26%), Postives = 86/108 (79.63%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   FS NGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTK 108          
BLAST of wdr82-2 vs. TrEMBL
Match: L0H9P2 (Wdr82-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 4.006e-136
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFA 942
            MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFA
Sbjct:   41 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFA 228          

HSP 2 Score: 71.2478 bits (173), Expect = 1.572e-10
Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 3
Query:  264 NTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            NTAIHASTKLDDTIR+LSLHDNKYIRYFVGHSK
Sbjct:    2 NTAIHASTKLDDTIRYLSLHDNKYIRYFVGHSK 34          
BLAST of wdr82-2 vs. TrEMBL
Match: A0A1S3H4D9 (WD repeat-containing protein 82 OS=Lingula unguis OX=7574 GN=LOC106151330 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 9.947e-98
Identity = 109/206 (52.91%), Postives = 146/206 (70.87%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D FLSGSLDKTIRLWDL++ N  G +H  GRPV AFDPEG IF AG+NSE +KLYDLRS+DKGPF TF++ Q+ + +W  LKFSP+G+M+ I +NG  I++IDAF G  L  FM    N + +P++  FSPDSQ++  G+ DG++  WN E  ++V ++   +HT      P+ C+ FNP+F M+SSA  N+ FW PQ+DE
Sbjct:  115 MSPVDDTFLSGSLDKTIRLWDLRSPNCQGLMHVPGRPVAAFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKLQQDRDCDWTGLKFSPDGKMVLISTNGQVIRLIDAFQGHPLQTFM-GHTNQKGLPLEASFSPDSQFVFSGSTDGKIHCWNAETGSKVCVLNA-EHT-----GPVQCIQFNPRFMMLSSACINMAFWLPQMDE 313          

HSP 2 Score: 157.147 bits (396), Expect = 9.947e-98
Identity = 72/108 (66.67%), Postives = 90/108 (83.33%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL D  ++ F  +K F++N++K+NSL FS+NGE LISSS DDQ++IYDC  G  KR LNSKKYGV+L+ FTH+ NTAIH+STK+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDTVVRSFRVAKVFRENSEKVNSLDFSANGELLISSSEDDQIVIYDCQNGTPKRTLNSKKYGVDLIHFTHAPNTAIHSSTKVDDTIRYLSLHDNKYIRYFPGHTK 108          
BLAST of wdr82-2 vs. TrEMBL
Match: A0A0R3W4X2 (WD40 protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5129 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.063e-97
Identity = 104/209 (49.76%), Postives = 142/209 (67.94%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEV--VQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNST--SQPINCVAFNPKFAMISSAVTNLTFWSPQID 993
            MSP+ D FLSG+LD T+RLWDL++ N  G +H  GRP  AFDP+G IF AG+NSE +KLYDLRS+DKGPF TF++  V+    EW +LKFSP+G+ I IC+NG+ ++++DAF G  L    +   N +R  +D CF+P SQ+++  APD  L IW+ E   RVA +P F+     T  S  +NCVAFNP+FAM+++     +FW P ID
Sbjct:  115 MSPIDDTFLSGALDGTVRLWDLRSQNCHGVMHVPGRPTAAFDPDGLIFAAGINSECLKLYDLRSFDKGPFATFKLTTVEAQGIEWTSLKFSPDGKTILICTNGNFLRLVDAFSGVHLHTLTV-ANNTERQTLDACFTPTSQFVISTAPDAYLQIWSVETGGRVAALPSFEAASQMTGPSGMLNCVAFNPRFAMLATGSVQTSFWLPNID 322          

HSP 2 Score: 163.696 bits (413), Expect = 1.063e-97
Identity = 77/108 (71.30%), Postives = 90/108 (83.33%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL  + +K F P KYFK+N DKINSLS++ NGE +ISSS DDQMI+YDC +G  KR +NSKKYGVNL+QFTHS+ TAIHASTK+DDTIR+LSLHDNKYIRYF  H K
Sbjct:    1 MKLTVSEVKTFRPVKYFKENCDKINSLSYTDNGEAIISSSDDDQMIMYDCNSGTPKRTINSKKYGVNLIQFTHSATTAIHASTKIDDTIRYLSLHDNKYIRYFQSHVK 108          
BLAST of wdr82-2 vs. TrEMBL
Match: A0A0R3X4Z9 (WD_REPEATS_REGION domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8502 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.905e-97
Identity = 103/209 (49.28%), Postives = 142/209 (67.94%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEV--VQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNST--SQPINCVAFNPKFAMISSAVTNLTFWSPQID 993
            MSP+ D FLSG+LD T+RLWDL++ N  G +H  GRP  AFDP+G IF AG+NSE +KLYDLRS+DKGPF TF++  V+    EW +LKFSP+G+ I IC+NG+ ++++DAF G  L    +   N +R  +D CF+P SQ+++  APD  L +W+ E   RVA +P F+     T  S  +NCVAFNP+FAM+++     +FW P ID
Sbjct:  115 MSPIDDTFLSGALDGTVRLWDLRSQNCHGVMHVPGRPTAAFDPDGLIFAAGINSECLKLYDLRSFDKGPFATFKLTTVEAQGIEWTSLKFSPDGKTILICTNGNFLRLVDAFSGVHLHTLTV-ANNTERQTLDACFTPTSQFVISTAPDAFLQVWSVETGGRVAALPSFEAASQMTGPSGMLNCVAFNPRFAMLATGSVQTSFWLPNID 322          

HSP 2 Score: 163.696 bits (413), Expect = 2.905e-97
Identity = 77/108 (71.30%), Postives = 90/108 (83.33%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL  + +K F P KYFK+N DKINSLS++ NGE +ISSS DDQMI+YDC +G  KR +NSKKYGVNL+QFTHS+ TAIHASTK+DDTIR+LSLHDNKYIRYF  H K
Sbjct:    1 MKLTVSEVKTFRPVKYFKENCDKINSLSYTDNGEAIISSSDDDQMIMYDCNSGTPKRTINSKKYGVNLIQFTHSATTAIHASTKIDDTIRYLSLHDNKYIRYFQSHVK 108          
BLAST of wdr82-2 vs. TrEMBL
Match: U6JD40 (WD repeat-containing protein 82 OS=Echinococcus granulosus OX=6210 GN=EGR_07199 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.951e-97
Identity = 103/209 (49.28%), Postives = 142/209 (67.94%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEV--VQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNST--SQPINCVAFNPKFAMISSAVTNLTFWSPQID 993
            MSP+ D FLSG+LD T+RLWDL++ N  G +H  GRP  AFDP+G IF AG+NSE +KLYDLRS+DKGPF TF++  V+    EW +LKFSP+G+ I IC+NG+ ++++DAF G  L    +   N +R  +D CF+P SQ+++  APD  L +W+ E   RVA +P F+     T  S  +NCVAFNP+FAM+++     +FW P ID
Sbjct:  115 MSPIDDTFLSGALDGTVRLWDLRSQNCHGVMHVPGRPTAAFDPDGLIFAAGINSECLKLYDLRSFDKGPFATFKLTTVEAQGIEWTSLKFSPDGKTILICTNGNFLRLVDAFSGVHLHTLTV-ANNTERQTLDACFTPTSQFVISTAPDAFLQVWSVETGGRVAALPSFEAASQMTGPSGVLNCVAFNPRFAMLATGSVQTSFWLPNID 322          

HSP 2 Score: 162.925 bits (411), Expect = 3.951e-97
Identity = 77/108 (71.30%), Postives = 89/108 (82.41%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL  + +K F P KYFK+N DKINSLS++ NGE +ISSS DDQMI+YDC +G  KR +NSKKYGVNL+QFTHS  TAIHASTK+DDTIR+LSLHDNKYIRYF  H K
Sbjct:    1 MKLTVSEVKTFRPVKYFKENCDKINSLSYTDNGEAIISSSDDDQMIMYDCNSGTPKRTINSKKYGVNLIQFTHSPTTAIHASTKIDDTIRYLSLHDNKYIRYFQSHVK 108          
BLAST of wdr82-2 vs. Ensembl Cavefish
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:103023310])

HSP 1 Score: 217.238 bits (552), Expect = 2.787e-92
Identity = 104/206 (50.49%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AGVNSE +KLYDLRS+DKGPF TF++  E   EW  LKFS +G++I + SNG  ++++DAF G +L +F     N + V ++  F+PDSQ+++ G+ DG++ +WN E+  +VAL+ G  HT      P+ C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKLQYERTCEWTGLKFSNDGKLILVSSNGGTLRLLDAFKGAILHSFGGYN-NSKGVVLEASFTPDSQFVMIGSEDGKIHVWNAESGMKVALLDG-KHTG-----PVTCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 141.354 bits (355), Expect = 2.787e-92
Identity = 65/108 (60.19%), Postives = 87/108 (80.56%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   FSSNGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNK 108          
BLAST of wdr82-2 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 63.5438 bits (153), Expect = 5.404e-18
Identity = 48/175 (27.43%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPG 876
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  +   FS    +++V G+ D  + IWN + K  V  + G
Sbjct:  136 PQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQG 296          

HSP 2 Score: 46.595 bits (109), Expect = 5.404e-18
Identity = 28/87 (32.18%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  I+S+ FS NGE L SSS D  + I+    G  ++ L+  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   42 TKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASD--DKTLKIWDMGSGKCLKTLKGHS 126          

HSP 3 Score: 55.4546 bits (132), Expect = 2.777e-8
Identity = 40/156 (25.64%), Postives = 80/156 (51.28%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            SP S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D+  G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   93 SPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 239          

HSP 4 Score: 48.9062 bits (115), Expect = 3.513e-6
Identity = 34/111 (30.63%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  628 NALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSA 957
            +++KFSPNG  +A  S    IK+  +FDGK   +      +  ++ I DV +SPDS  LV  + D  L IW+  +   +  + G        S  + C  FNP+  ++ S 
Sbjct:   46 SSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSL-----SGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGH-------SNYVFCCNFNPQSNLVVSG 144          
BLAST of wdr82-2 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 65.855 bits (159), Expect = 1.958e-17
Identity = 50/167 (29.94%), Postives = 80/167 (47.90%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPG 876
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V    S S +L      D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIV----SSSPQLLLFNWDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQG 287          

HSP 2 Score: 42.3578 bits (98), Expect = 1.958e-17
Identity = 25/87 (28.74%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS +GE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   45 TKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          
BLAST of wdr82-2 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 65.4698 bits (158), Expect = 2.627e-17
Identity = 56/203 (27.59%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 42.3578 bits (98), Expect = 2.627e-17
Identity = 25/87 (28.74%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS +GE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   45 TKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 1.711e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 55.8398 bits (133), Expect = 1.003e-15
Identity = 51/213 (23.94%), Postives = 85/213 (39.91%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLL--------------SNFMILGANPQRV-------------------------PIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPG 876
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L              +NF + G   +R+                          I+       Q++V G+ D  + IWN + K  V  + G
Sbjct:  136 PQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKVRRLLFLDLVTFSAAFGRGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQG 336          

HSP 2 Score: 46.595 bits (109), Expect = 1.003e-15
Identity = 28/87 (32.18%), Postives = 46/87 (52.87%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  I+S+ FS NGE L SSS D  + I+    G  ++ L+  K G++ + ++  SN  + AS   D T++   +   K ++   GHS
Sbjct:   42 TKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASD--DKTLKIWDMGSGKCLKTLKGHS 126          

HSP 3 Score: 55.4546 bits (132), Expect = 3.296e-8
Identity = 40/156 (25.64%), Postives = 80/156 (51.28%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            SP S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D+  G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   93 SPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 239          

HSP 4 Score: 49.2914 bits (116), Expect = 3.013e-6
Identity = 34/111 (30.63%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  628 NALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSA 957
            +++KFSPNG  +A  S    IK+  +FDGK   +      +  ++ I DV +SPDS  LV  + D  L IW+  +   +  + G        S  + C  FNP+  ++ S 
Sbjct:   46 SSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSL-----SGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGH-------SNYVFCCNFNPQSNLVVSG 144          
BLAST of wdr82-2 vs. Ensembl Sea Lamprey
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:321614])

HSP 1 Score: 213.386 bits (542), Expect = 1.722e-91
Identity = 100/206 (48.54%), Postives = 141/206 (68.45%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+S SLDKTIRLWDL++ N  G +H  GRPV +FDPEG IF AG+NSE +KLYDLRS+DKGPF TF + Q+   +W  LK S +G+ I I +NG  ++++DAF G  L  F     N + + ++  FSPDSQ+++ G+ DG++ +W+TE+  +VA++ G  HT      P+ C+ FNPK+ M++SA  N+ FW P ID+
Sbjct:  115 MSPVDDTFISASLDKTIRLWDLRSPNCQGLMHLQGRPVCSFDPEGLIFAAGLNSEMVKLYDLRSFDKGPFATFRLQQDRTCDWTGLKISNDGKFILIATNGGVLRLVDAFQGSALHMF-TGHTNSKGITLEASFSPDSQFIMTGSEDGKIHVWHTESGTKVAILDG-KHT-----GPVTCLQFNPKYMMVASACANMAFWLPTIDD 313          

HSP 2 Score: 140.584 bits (353), Expect = 1.722e-91
Identity = 63/108 (58.33%), Postives = 86/108 (79.63%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   F+ NGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDNVMRSFRVAKVFRENSDKINCFDFAPNGETMISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTK 108          
BLAST of wdr82-2 vs. Ensembl Sea Lamprey
Match: wdr61 (WD repeat domain 61 [Source:NCBI gene;Acc:393827])

HSP 1 Score: 62.7734 bits (151), Expect = 2.091e-11
Identity = 48/178 (26.97%), Postives = 78/178 (43.82%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA----FDPEGQIFVAGVNSESMKLYDLRSYDK-------GPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPG 876
            +SP   +  S SLD  +RLWDL+  + L  I     PV A    F P+ +    G +   + ++ + S  K       G F+             +L +SP+G+ +A  +    I + D   GKLL            +PI  + FSPDSQ L+  + DG + I++ ++    A + G
Sbjct:   72 ISPTGALAASSSLDANLRLWDLECGSELKTI--DAGPVDAWSVAFSPDSRFLSTGSHMGKINIFGIESGKKESTLDTRGKFIL------------SLAYSPDGKHLASGAIDGIINIFDISTGKLLHTLEAWARGGHAMPIRSLTFSPDSQLLITASDDGYIKIYDVQHAKLAATLSG 235          
BLAST of wdr82-2 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 62.3882 bits (150), Expect = 4.474e-11
Identity = 44/156 (28.21%), Postives = 68/156 (43.59%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNT 843
            SP   + +SGS D+T+R+WD  +   +   +  G  V    F P G    A     ++K++D+R          +  Q      N+L F P G  +   SN S +KV+D  +G+L   F  L  + Q     V FS    +   G  D Q+ +W T
Sbjct:  153 SPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNK-----LLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRL---FYTLHGH-QGPATAVAFSRAGDFFASGGSDEQVMVWKT 299          

HSP 2 Score: 51.2174 bits (121), Expect = 1.717e-7
Identity = 38/156 (24.36%), Postives = 67/156 (42.95%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLW--DLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWN 840
            SP   + +S S DKT+RLW   +K  +++   HT      +F  +GQ  V   + +S+K++ +          F         W  + KFSP+GR+I   S+   ++V D+   + +  F   G    +V     F P    +     D  + +W+
Sbjct:   69 SPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQK------FLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVD----FHPSGTCIAAAGTDNTVKVWD 214          
BLAST of wdr82-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.645e-10
Identity = 51/191 (26.70%), Postives = 84/191 (43.98%), Query Frame = 1
Query:  403 LSGSLDKTIRLWDLKTHNSL-GFI-HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGR--MIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            LSGS D T+RLWDL T  +   F+ HT      AF  + +  V+G   +++KL++     K     + + ++   EW + ++FSPN    +I  C     +KV +  + KL +N +        V +    SPD      G  DGQ  +W+      +  + G D         IN + F+P    + +A 
Sbjct:   79 LSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCK-----YTIQEDGHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNLTNCKLKTNHIGHTGYLNTVTV----SPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGD--------TINALCFSPNRYWLCAAT 252          
BLAST of wdr82-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 3.131e-9
Identity = 43/162 (26.54%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNS----LGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLR------SYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWN 840
            P S   L+ S DKT+ LWD +T        G +H+     G F+ +G   V+  +   +K++D+R      + + GP              N L F P+G ++A+ S+ + ++++D   G    +   L  +   V   V FSPD   L  G  DG + +W 
Sbjct:  471 PYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNH--GTFNLKGDTVVSCDSYGVIKVWDVRKGTATMTLNLGPHPA-----------NRLSFHPSGHVMAVASDDACVRIVDLLTG----HVETLSGHEDAVQA-VVFSPDGDTLFSGGSDGTIRMWE 614          
BLAST of wdr82-2 vs. Ensembl Yeast
Match: SWD2 (Subunit of the COMPASS (Set1C) histone H3K4 methyltransferase complex; required for Set1C stability and optimal activity; COMPASS methylates histone H3 on lys 4 and is involved in telomeric silencing; subunit of CPF (cleavage and polyadenylation factor), a complex involved in RNAP II transcription termination [Source:SGD;Acc:S000001501])

HSP 1 Score: 113.235 bits (282), Expect = 1.774e-39
Identity = 69/207 (33.33%), Postives = 113/207 (54.59%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMK--LYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID---VCFSPDSQYLVCGAPDGQLCIWNTEN--KNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFW 978
            M+PV+D FLS S D+++RLWDLK       I +      A+DP G +F  G N E+ +  LY+L+   +GPF+  ++      +WN L+FS NG+ + + S+  +  + DAF G+ L   +   A P R  +D    CF+PD ++++    DG++ IWN  +   N+V    GF    +  + P   +AFNPK++M  +A   + F+
Sbjct:  121 MNPVNDTFLSSSYDESVRLWDLKISKPQVIIPSLVPNCIAYDPSGLVFALG-NPENFEIGLYNLKKIQEGPFLIIKINDATFSQWNKLEFSNNGKYLLVGSSIGKHLIFDAFTGQQLFELIGTRAFPMREFLDSGSACFTPDGEFVLGTDYDGRIAIWNHSDSISNKVLRPQGFIPCVSHETCP-RSIAFNPKYSMFVTADETVDFY 325          

HSP 2 Score: 65.855 bits (159), Expect = 1.774e-39
Identity = 39/110 (35.45%), Postives = 62/110 (56.36%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKD---NTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            + +N  N+ KF   K F+    +   + SL+F  NG+ L++SS +D M +Y          + SKKYG +   FTH+ N  I++ST  +  I++L+L  N+Y+RYF GH 
Sbjct:    4 VSINKPNLLKFKHVKSFQPQEKDCGPVTSLNFDDNGQFLLTSSSNDTMQLYSATNCKFLDTIASKKYGCHSAIFTHAQNECIYSSTMKNFDIKYLNLETNQYLRYFSGHG 113          
BLAST of wdr82-2 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 60.4622 bits (145), Expect = 1.702e-10
Identity = 43/167 (25.75%), Postives = 73/167 (43.71%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVG--AFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPG 876
            SP +   LSGS DKT+RLW + TH +L        PV   +F P G  F    + ++ +L+              +     ++ + + F PNG  +   S+    ++ D   G  +   + LG     + I VC  PD ++L  G+ DG + +W+     R+  + G
Sbjct:  534 SPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH-----IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR--LFLGHTAPVISIAVC--PDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 691          
BLAST of wdr82-2 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 56.6102 bits (135), Expect = 2.449e-9
Identity = 53/199 (26.63%), Postives = 80/199 (40.20%), Query Frame = 1
Query:  397 MFLSGSLDKTIRLWD----------LKTH----NSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDE-----WNALK-------------------FSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGF 879
            +  SGS D+T+R+WD          LK+H    N L         +GAFD  G+       ++   L +     K    + E++  A D+     WN LK                   FSP+GR I   S  + IK+ D  DGK +S F    A+  +    V +S D + LV  + D  L +W+   +     +PG 
Sbjct:  291 LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQ----VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485          
BLAST of wdr82-2 vs. Ensembl Nematostella
Match: EDO40534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6W9])

HSP 1 Score: 207.608 bits (527), Expect = 3.371e-89
Identity = 100/206 (48.54%), Postives = 141/206 (68.45%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLD T+R+WDL++ N  G +H  GRPV AFDPEG IF AG++ E +KLYDLRS+DKGPF TF +  +   EWN++KFS +G+MI + +NG  I +IDAF G  L  F    A  +  P +V FSPDSQY++ G+ DG++  W +++ ++++ + G  + P ST     CV FNPKF M++SA TN+ FW P +++
Sbjct:  115 MSPVEDTFVSGSLDCTLRIWDLRSPNCQGLMHVNGRPVAAFDPEGLIFAAGIDCEMIKLYDLRSFDKGPFSTFHIQTDPNIEWNSIKFSYDGKMILLSTNGGSIYLIDAFQGTQLHAF-TGHAVSKTNPCEVTFSPDSQYVISGSQDGKVHFWASDSGHKISTLEG--NHPGST----RCVKFNPKFMMLASACTNMAFWLPNLED 313          

HSP 2 Score: 139.043 bits (349), Expect = 3.371e-89
Identity = 63/116 (54.31%), Postives = 90/116 (77.59%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSKSGNIKHVS 386
            MKL+D+ ++    +K F++N+D +N ++FS+NGE+LI+SS DD ++IYDC+ G  K+ + SKKYGV  +Q+TH+ NT IH STK+DDTIR+LSLHDNKY+RYF GH+K     H+S
Sbjct:    1 MKLDDSVVRSLRVAKVFRENSDNVNHMAFSANGESLITSSNDDSIVIYDCVDGKPKKTIYSKKYGVANIQYTHAQNTVIHTSTKVDDTIRYLSLHDNKYLRYFPGHTKRVTTLHMS 116          
BLAST of wdr82-2 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 67.0106 bits (162), Expect = 6.588e-17
Identity = 54/203 (26.60%), Postives = 94/203 (46.31%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  +   FS    +++V G+ D ++ IWN ++K  V  + G        S  + C A +P   +I+S  
Sbjct:  159 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGH-------SDVVLCCACHPTENIIASGA 340          

HSP 2 Score: 37.7354 bits (86), Expect = 6.588e-17
Identity = 24/84 (28.57%), Postives = 42/84 (50.00%), Query Frame = 3
Query:  108 INSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            ++S+ FS NGE L SSS D  + I+    G  ++ +   K G++ + ++  S   + AS   D T++       K ++   GHS
Sbjct:   68 VSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASD--DKTLKIWDFATGKCLKTLKGHS 149          
BLAST of wdr82-2 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 68.5514 bits (166), Expect = 7.708e-13
Identity = 47/159 (29.56%), Postives = 74/159 (46.54%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVG-----AFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNT 843
            SP   + +SGS DKTI+LWD     S   +HT   P G      F P G    AG    ++K++D+R          +  Q      N++ F P+G  +   S+ + +K++D  +G+L   F  L  + Q     V FS + +Y   G+ D Q+ +W T
Sbjct:  153 SPDGRLIVSGSDDKTIKLWD---RTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNK-----LLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRL---FYTLHGH-QGPATSVVFSRNGEYFASGSSDEQVMVWKT 299          
BLAST of wdr82-2 vs. Ensembl Nematostella
Match: EDO39721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9A5])

HSP 1 Score: 62.3882 bits (150), Expect = 4.934e-11
Identity = 56/199 (28.14%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTH-NSLGFI-HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNG--SQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            MS      LSGS DKT+RLWDL     +  F+ HT      AF  + +  V+G     +KL++     K     + + +E   EW + ++FSPN     I S+G    IKV +  + +L +N +        V +    SPD      G  DGQ  +W+  +   +  + G D         IN + F+P    + +AV
Sbjct:   71 MSSDGQFALSGSWDKTLRLWDLNAGVTTRRFVGHTKDVLSVAFSADNRQIVSGARDHHIKLWNTLGVCK-----YTIQEETHSEWVSCVRFSPNTSNPIIVSSGWDKLIKVWNLTNCRLKTNHIGHTGYLNCVTV----SPDGSLCASGGKDGQAMLWDLNDGKHLYTLSGGD--------IINAMTFSPNRYWLCAAV 252          
BLAST of wdr82-2 vs. Ensembl Nematostella
Match: EDO46560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPT3])

HSP 1 Score: 54.6842 bits (130), Expect = 1.620e-8
Identity = 53/188 (28.19%), Postives = 83/188 (44.15%), Query Frame = 1
Query:  406 SGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA----FDPEGQIFVAGVNSESMKLYDLR------SYD-KGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNP 933
            S SLD  +R+WDL +   L  I     PV      F P+ +I   G +S  + L +L       S D +G F              +L +SP+G  IA    G+   +I+ FD  L +N ++       +PI  + FSPDSQ L+  + DG + +++ ++ N    + G        S  +  VAF P
Sbjct:   78 SSSLDSHVRIWDLVSGKQLKTIDC--DPVDTWTVTFSPDSKILATGSHSGKVNLINLELGKKESSLDTRGKFTM------------SLAYSPDGHYIAC---GAIDGIINIFD--LTTNKLLHTLEGHAMPIRSLTFSPDSQLLITASDDGHIKMYDVQHANLAGTLSGH-------SSWVLSVAFCP 239          
BLAST of wdr82-2 vs. Ensembl Medaka
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:110015105])

HSP 1 Score: 211.846 bits (538), Expect = 5.333e-91
Identity = 101/206 (49.03%), Postives = 143/206 (69.42%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AG+NSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I + +NG  ++++DAF G +L +F     N + V ++  F+PDS +++ G+ DG++ +WN E+  +VAL+ G  HT      PI C+ FNPKF   +SA +N+ FW P ID+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKLQYDRTCEWTGLKFSNDGKLILLSTNGGALRILDAFKGVVLHSFGGYN-NSKGVTLEASFTPDSLFVMIGSEDGKIHVWNAESGMKVALLDG-KHT-----GPITCLQFNPKFMTFASACSNMAFWLPTIDD 313          

HSP 2 Score: 142.51 bits (358), Expect = 5.333e-91
Identity = 65/108 (60.19%), Postives = 87/108 (80.56%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   FSSNGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETIISSSDDDSLVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTK 108          
BLAST of wdr82-2 vs. Ensembl Medaka
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:110015105])

HSP 1 Score: 199.904 bits (507), Expect = 1.097e-87
Identity = 96/197 (48.73%), Postives = 137/197 (69.54%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNL 969
            MSPV D F+SGSLDKTIRLWDL++ N  G +H  G+PV +FDPEG IF AG+NSE +KLYDLRS+DKGPF TF++  +   EW  LKFS +G++I + +NG  ++++DAF G +L +F     N + V ++  F+PDS +++ G+ DG++ +WN E+  +VAL+ G  HT      PI C+ FNPKF   +SA +N+
Sbjct:  115 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKLQYDRTCEWTGLKFSNDGKLILLSTNGGALRILDAFKGVVLHSFGGYN-NSKGVTLEASFTPDSLFVMIGSEDGKIHVWNAESGMKVALLDG-KHTG-----PITCLQFNPKFMTFASACSNM 304          

HSP 2 Score: 143.665 bits (361), Expect = 1.097e-87
Identity = 65/108 (60.19%), Postives = 87/108 (80.56%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKL DN ++ F  +K F++N+DKIN   FSSNGE +ISSS DD +++YDC  G  KR L SKKYGV+L+++TH++NT +++S K+DDTIR+LSLHDNKYIRYF GH+K
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETIISSSDDDSLVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTK 108          
BLAST of wdr82-2 vs. Ensembl Medaka
Match: ENSORLT00000042356.1 (WD repeat-containing protein 82 [Source:NCBI gene;Acc:101173843])

HSP 1 Score: 192.2 bits (487), Expect = 6.561e-77
Identity = 92/202 (45.54%), Postives = 134/202 (66.34%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSP 984
            MSPV +MF+S SLDKTIR+WDL+T +  G  +  GRP+ +FDP+G IF AGV S ++KLYDLR++DKGPF  FE       +W  LKFS +G+ I I +NG  I++++AF G +L  F     N   + ++ CF+PDSQ+++ G+ DG++ +W+TE+  +VA++ G          PIN + FNP+F   +SA TN+TFW P
Sbjct:  116 MSPVDEMFISSSLDKTIRIWDLRTPDCQGLTNPLGRPICSFDPDGLIFAAGVESRAIKLYDLRAFDKGPFANFETRFNRVCDWTGLKFSNDGKQILIYTNGGAIRILNAFSGSVLHTFSGYN-NSTGMALEACFTPDSQFVMIGSEDGRVHVWSTESGMKVAVLDG------KHPGPINTLQFNPRFMTFASACTNMTFWLP 310          

HSP 2 Score: 115.161 bits (287), Expect = 6.561e-77
Identity = 56/108 (51.85%), Postives = 81/108 (75.00%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHS-SNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            MK+ D+ ++ F  ++ ++ N++K+N L +S NGE++ISSS DD +++YD   G   R L SKKYGV+L+++T+  SNT ++ S KLDDTIR+LSL DNKYIRYF GHS
Sbjct:    1 MKITDSVLRSFRVARTYRCNSEKVNCLDYSPNGESVISSSNDDCIVLYDMQEGKPSRTLFSKKYGVDLIRYTYGDSNTVVYTSNKLDDTIRYLSLTDNKYIRYFPGHS 108          
BLAST of wdr82-2 vs. Ensembl Medaka
Match: ENSORLT00000023503.2 (WD repeat-containing protein 82 [Source:NCBI gene;Acc:101173843])

HSP 1 Score: 192.2 bits (487), Expect = 8.787e-75
Identity = 92/202 (45.54%), Postives = 134/202 (66.34%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSP 984
            MSPV +MF+S SLDKTIR+WDL+T +  G  +  GRP+ +FDP+G IF AGV S ++KLYDLR++DKGPF  FE       +W  LKFS +G+ I I +NG  I++++AF G +L  F     N   + ++ CF+PDSQ+++ G+ DG++ +W+TE+  +VA++ G          PIN + FNP+F   +SA TN+TFW P
Sbjct:  110 MSPVDEMFISSSLDKTIRIWDLRTPDCQGLTNPLGRPICSFDPDGLIFAAGVESRAIKLYDLRAFDKGPFANFETRFNRVCDWTGLKFSNDGKQILIYTNGGAIRILNAFSGSVLHTFSGYN-NSTGMALEACFTPDSQFVMIGSEDGRVHVWSTESGMKVAVLDG------KHPGPINTLQFNPRFMTFASACTNMTFWLP 304          

HSP 2 Score: 108.227 bits (269), Expect = 8.787e-75
Identity = 53/100 (53.00%), Postives = 75/100 (75.00%), Query Frame = 3
Query:   63 KKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHS-SNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            + F  ++ ++ N++K+N L +S NGE++ISSS DD +++YD   G   R L SKKYGV+L+++T+  SNT ++ S KLDDTIR+LSL DNKYIRYF GHS
Sbjct:    3 ESFRVARTYRCNSEKVNCLDYSPNGESVISSSNDDCIVLYDMQEGKPSRTLFSKKYGVDLIRYTYGDSNTVVYTSNKLDDTIRYLSLTDNKYIRYFPGHS 102          
BLAST of wdr82-2 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 65.0846 bits (157), Expect = 2.329e-17
Identity = 56/203 (27.59%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  385 PVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGA--FDPEGQIFVAGVNSESMKLYDLRSY--------DKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFS-PDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAV 960
            P S++ +SGS D+++R+WD+KT   L  +     PV A  F+ +G + V+       +++D  S         D  P V+F            +KFSPNG+ I   +  + +K+ D   GK L  +   G   ++  I   FS    +++V G+ D  + IWN + K  V  + G      ST       A +P   +I+SA 
Sbjct:  139 PQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVIST-------ACHPTENIIASAA 320          

HSP 2 Score: 42.743 bits (99), Expect = 2.329e-17
Identity = 25/87 (28.74%), Postives = 47/87 (54.02%), Query Frame = 3
Query:   99 TDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHS 359
            T  ++S+ FS +GE L SSS D  + I+    G  ++ ++  K G++ + ++  SN  + AS   D T++   ++  K ++   GHS
Sbjct:   45 TKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVNSGKCLKTLKGHS 129          

HSP 3 Score: 53.1434 bits (126), Expect = 1.540e-7
Identity = 38/153 (24.84%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  391 SDMFLSGSLDKTIRLWDLKTHNSLGFI--HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPID-VCFSPDSQYLVCGAPDGQLCIWN 840
            S++ +S S DKT+++WD+ +   L  +  H+       F+P+  + V+G   ES++++D+++         + +    D  +A+ F+ +G +I   S     ++ D   G+ L   +I   NP   P+  V FSP+ +Y++    D  L +W+
Sbjct:   99 SNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGK-----CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-LIDDDNP---PVSFVKFSPNGKYILAATLDNTLKLWD 242          
BLAST of wdr82-2 vs. Planmine SMEST
Match: SMESG000044331.1 (SMESG000044331.1)

HSP 1 Score: 434.491 bits (1116), Expect = 0.000e+0
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 996
            MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE
Sbjct:  115 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFWSPQIDE 320          

HSP 2 Score: 221.476 bits (563), Expect = 0.000e+0
Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIR+LSLHDNKYIRYFVGHSK
Sbjct:    1 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRYLSLHDNKYIRYFVGHSK 108          
BLAST of wdr82-2 vs. Planmine SMEST
Match: SMESG000059185.1 (SMESG000059185.1)

HSP 1 Score: 180.644 bits (457), Expect = 2.321e-77
Identity = 89/221 (40.27%), Postives = 139/221 (62.90%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEV----VQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIP---------GFDHTPNS-TSQPINCVAF--NPKFAMISSAVTNLTFWSPQID 993
            MSP +D FLSGSLDKTIRLWDL+T N    +   G+ + A DPEG IF   ++S++ KLYDLR++++GPF+TF +     +    + ++L+FSP+G+M+ +   G+QI ++D+F G+ L    ILG N  ++ I+ CF+PDS+Y++ G+P+G+L IW   N  R+AL+          GF+ +  + T  P+N  A   NP+F+ I+      + W PQI+
Sbjct:  115 MSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSGAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 335          

HSP 2 Score: 127.872 bits (320), Expect = 2.321e-77
Identity = 60/108 (55.56%), Postives = 83/108 (76.85%), Query Frame = 3
Query:   39 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRFLSLHDNKYIRYFVGHSK 362
            MKLND++++ +   K FKDN+DK+N+++F+SNGE LISSS DD + +YD I G   + + SKKYGV +++FTH S   IHAS K+DD +R+LSLHDNKYIR + GH+K
Sbjct:    1 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTK 108          
BLAST of wdr82-2 vs. Planmine SMEST
Match: SMESG000076568.1 (SMESG000076568.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.259e-8
Identity = 53/206 (25.73%), Postives = 92/206 (44.66%), Query Frame = 1
Query:  379 MSPVSDMFLSGSLDKTIRLWDLKT-HNSLGFI-HTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNG--SQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNP-KFAMISSAVTNLTFW 978
            MS      LSGS D T+RLWDL +   +  F+ HT      AF  + +  V+G    ++KL++     K     + + ++   +W + ++FSP     +I S G    +KV +  + KL +N    G N     + V  SPD      G  DGQ  +W+      +  + G D         IN + F+P ++ + ++  +++  W
Sbjct:   71 MSSDGQFALSGSWDGTLRLWDLTSGQTTRRFVGHTKDVLSVAFSADNRQIVSGSRDGTIKLWNTLGVCK-----YTIQEDGHTDWVSCVRFSPTSENPSIVSCGWDKVVKVWNLSNCKLRTNH--FGHNGYLNTVAV--SPDGSLCASGGKDGQAMLWDLSEGRHLYTLEGGD--------IINALIFSPNRYWLCAATGSSIKIW 259          
BLAST of wdr82-2 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.787e-8
Identity = 46/187 (24.60%), Postives = 80/187 (42.78%), Query Frame = 1
Query:  382 SPVSDMFLSGSLDKTIRLW--DLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEW-NALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNP 933
            SP   +  S S DKT+RLW   +K  + +   HT          +    V G + +++K++ +          F         W   ++FS +G++IA  S+   IK+ D  + + +  F   G     VP  + F P+  Y+  G  D  + IW+      + +     H  + TS P+N V+F+P
Sbjct:   65 SPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQ------KFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGG---FVP-SLAFHPNGSYIASGGTDSHVNIWD------IRMNKLLQHYTSHTS-PVNAVSFHP 234          

HSP 2 Score: 51.6026 bits (122), Expect = 4.531e-7
Identity = 40/150 (26.67%), Postives = 61/150 (40.67%), Query Frame = 1
Query:  397 MFLSGSLDKTIRLWDLKTHNSLGFIHTTGR--PVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPI-DVCFSPDSQYLVCGAPDGQLCIW 837
            +  S S DKTI+LWD      +      G   P  AF P G    +G     + ++D+R        T           NA+ F P+G  +   S+ S +K+ D  +G+LL  + + G      PI    FS   +    G  D Q+ +W
Sbjct:  154 LIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHT-----SPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLL--YTVQG---HEGPILGTAFSHCGEMFASGGADHQVFLW 293          
BLAST of wdr82-2 vs. Planmine SMEST
Match: SMESG000075662.1 (SMESG000075662.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.517e-7
Identity = 46/194 (23.71%), Postives = 83/194 (42.78%), Query Frame = 1
Query:  400 FLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEG-QIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQ-RVPIDV---CFSPDSQYLVCGAPDGQLCIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTN 966
             ++GS D+T++LWD +T + +  +             G  + ++G   + ++++D R    G   T ++V         L  S +   +  C     ++ ID    + + NF      PQ +V  D+   CFSPD QY+  G+ DG + IWN+            + T    +  I CV + P   +++S   N
Sbjct:  270 IVTGSTDRTLKLWDTRTRSCVKTMLAMSACHDVVVCSGLGLMISGHFDKKLRMWDHR----GDLNTDQLV--LSHRITGLDISRDQNTLLACLKDDSLQTIDLRMNQFIQNF----TAPQFKVGNDLWRPCFSPDGQYVAAGSQDGSVFIWNSRT-------GKLEKTLKDQTAGIICVHWCPGSNVLASCERN 446          
The following BLAST results are available for this feature:
BLAST of wdr82-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR821.974e-9151.46WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR827.997e-3170.27WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR51.932e-1727.59WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR5B1.900e-1627.59WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR829.717e-1565.96WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
swd-2.21.894e-6740.80Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL... [more]
swd-2.18.713e-4535.03Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL... [more]
rack-13.927e-1127.78Guanine nucleotide-binding protein subunit beta-2-... [more]
rack-13.927e-1127.78Guanine nucleotide-binding protein subunit beta-2-... [more]
rack-13.927e-1127.78Guanine nucleotide-binding protein subunit beta-2-... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr822.967e-9853.40gene:FBgn0032030 transcript:FBtr0079650[more]
CG35154.230e-3328.79gene:FBgn0031431 transcript:FBtr0077750[more]
wds1.190e-1727.09gene:FBgn0040066 transcript:FBtr0308566[more]
wds1.190e-1727.09gene:FBgn0040066 transcript:FBtr0070438[more]
CG109311.715e-1525.71gene:FBgn0034274 transcript:FBtr0089545[more]
back to top
BLAST of wdr82-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr821.060e-9150.49WD repeat domain 82 [Source:NCBI gene;Acc:321614][more]
wdr53.172e-1727.59WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
katnb11.469e-1126.37katanin p80 (WD repeat containing) subunit B 1 [So... [more]
katnb11.346e-1025.74katanin p80 (WD repeat containing) subunit B 1 [So... [more]
katnb11.481e-1025.74katanin p80 (WD repeat containing) subunit B 1 [So... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agxt21.649e-9049.51alanine--glyoxylate aminotransferase 2 [Source:Xen... [more]
agxt23.973e-8749.24alanine--glyoxylate aminotransferase 2 [Source:Xen... [more]
ppp4r1l2.165e-1728.11protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l1.024e-1627.09protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l1.024e-1627.09protein phosphatase 4 regulatory subunit 1 like (p... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr821.432e-9151.46WD repeat domain containing 82 [Source:MGI Symbol;... [more]
Wdr51.401e-1727.59WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Wdr828.313e-1250.85WD repeat domain containing 82 [Source:MGI Symbol;... [more]
Wdr821.269e-1150.94WD repeat domain containing 82 [Source:MGI Symbol;... [more]
Wdr824.158e-1169.44WD repeat domain containing 82 [Source:MGI Symbol;... [more]
back to top
BLAST of wdr82-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VLN1|WDR82_DROME2.219e-9753.40WD repeat-containing protein 82 OS=Drosophila mela... [more]
sp|Q6NV31|WDR82_DANRE6.382e-9150.49WD repeat-containing protein 82 OS=Danio rerio OX=... [more]
sp|Q8BFQ4|WDR82_MOUSE8.465e-9151.46WD repeat-containing protein 82 OS=Mus musculus OX... [more]
sp|Q6UXN9|WDR82_HUMAN8.465e-9151.46WD repeat-containing protein 82 OS=Homo sapiens OX... [more]
sp|Q5ZMV7|WDR82_CHICK1.453e-9050.97WD repeat-containing protein 82 OS=Gallus gallus O... [more]
back to top
BLAST of wdr82-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L0H9P24.006e-136100.00Wdr82-2 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A1S3H4D99.947e-9852.91WD repeat-containing protein 82 OS=Lingula unguis ... [more]
A0A0R3W4X21.063e-9749.76WD40 protein OS=Taenia asiatica OX=60517 GN=TASK_L... [more]
A0A0R3X4Z92.905e-9749.28WD_REPEATS_REGION domain-containing protein OS=Hyd... [more]
U6JD403.951e-9749.28WD repeat-containing protein 82 OS=Echinococcus gr... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr822.787e-9250.49WD repeat domain 82 [Source:NCBI gene;Acc:10302331... [more]
ENSAMXT00000007963.25.404e-1827.43WD repeat-containing protein 5-like [Source:NCBI g... [more]
wdr51.958e-1729.94WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
wdr52.627e-1727.59WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007962.21.003e-1523.94WD repeat-containing protein 5-like [Source:NCBI g... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr821.722e-9148.54WD repeat domain 82 [Source:NCBI gene;Acc:321614][more]
wdr612.091e-1126.97WD repeat domain 61 [Source:NCBI gene;Acc:393827][more]
POC1A4.474e-1128.21POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
ENSPMAT00000002506.11.645e-1026.70pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
ENSPMAT00000004902.13.131e-926.54pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SWD21.774e-3933.33Subunit of the COMPASS (Set1C) histone H3K4 methyl... [more]
TAF51.702e-1025.75Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
RSA42.449e-926.63WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405343.371e-8948.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332976.588e-1726.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453467.708e-1329.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397214.934e-1128.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465601.620e-828.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of wdr82-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr825.333e-9149.03WD repeat domain 82 [Source:NCBI gene;Acc:11001510... [more]
wdr821.097e-8748.73WD repeat domain 82 [Source:NCBI gene;Acc:11001510... [more]
ENSORLT00000042356.16.561e-7745.54WD repeat-containing protein 82 [Source:NCBI gene;... [more]
ENSORLT00000023503.28.787e-7545.54WD repeat-containing protein 82 [Source:NCBI gene;... [more]
wdr52.329e-1727.59WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
back to top
BLAST of wdr82-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044331.10.000e+0100.00SMESG000044331.1[more]
SMESG000059185.12.321e-7740.27SMESG000059185.1[more]
SMESG000076568.11.259e-825.73SMESG000076568.1[more]
SMESG000024482.11.787e-824.60SMESG000024482.1[more]
SMESG000075662.11.517e-723.71SMESG000075662.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010267
GenBankAGA95406.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010267 ID=SMED30010267|Name=wdr82-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1041bp
CATTCATTTTTGAAATAAAGCAGAAGACATTTTTGCAGATGAAGTTGAAT
GACAACAATATAAAGAAATTTGTTCCATCAAAATATTTTAAGGACAATAC
AGATAAGATAAATTCTTTAAGTTTTTCATCGAATGGAGAAAATTTAATAT
CTTCAAGTTATGATGATCAAATGATTATATATGATTGTATTACTGGAGTT
GCAAAACGCCATCTAAATAGCAAAAAATATGGTGTTAATCTGATGCAATT
TACTCATTCGTCTAATACTGCTATTCACGCTTCCACTAAACTTGATGATA
CAATTCGATTTTTGTCTCTCCATGATAATAAGTATATAAGATATTTTGTT
GGTCATTCTAAGAGTGGTAACATTAAGCATGTCTCCTGTTAGTGACATGT
TTCTATCTGGATCGCTAGATAAAACTATCAGACTTTGGGATTTAAAGACA
CACAATTCACTCGGATTTATACATACAACTGGGCGGCCAGTTGGCGCTTT
CGATCCGGAAGGTCAAATATTCGTCGCTGGAGTCAATTCCGAAAGCATGA
AACTTTATGATCTCCGATCCTATGACAAAGGACCATTTGTGACATTTGAG
GTTGTCCAAGAGGCTGAAGACGAATGGAATGCTTTGAAATTTAGCCCCAA
CGGTAGAATGATTGCAATTTGTAGCAATGGTTCTCAAATCAAAGTTATCG
ATGCATTTGACGGTAAACTGCTGTCTAATTTTATGATTTTGGGTGCTAAT
CCTCAGCGCGTGCCAATTGATGTGTGTTTCAGTCCAGACAGCCAGTATTT
GGTATGTGGAGCTCCAGATGGTCAATTGTGCATTTGGAACACGGAAAACA
AGAATCGGGTGGCTTTGATTCCCGGATTTGATCATACCCCCAACAGCACA
TCTCAACCGATAAATTGCGTTGCGTTCAACCCGAAATTTGCTATGATATC
CTCAGCTGTAACCAATCTCACATTTTGGTCCCCGCAAATAGACGAGTAAC
TGTGCATATGTATATTGATCTGTATGTGAAGATAGCTAGAG
back to top

protein sequence of SMED30010267-orf-1

>SMED30010267-orf-1 ID=SMED30010267-orf-1|Name=SMED30010267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
FIFEIKQKTFLQMKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLIS
SSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDT
IRFLSLHDNKYIRYFVGHSKSGNIKHVSC*
back to top

protein sequence of SMED30010267-orf-2

>SMED30010267-orf-2 ID=SMED30010267-orf-2|Name=SMED30010267-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
MSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVA
GVNSESMKLYDLRSYDKGPFVTFEVVQEAEDEWNALKFSPNGRMIAICSN
GSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQL
CIWNTENKNRVALIPGFDHTPNSTSQPINCVAFNPKFAMISSAVTNLTFW
SPQIDE*
back to top
Aliases
The feature 'wdr82-2' has the following synonyms
Synonym
wdr82-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037867Swd2/WDR82
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0035097histone methyltransferase complex
GO:0048188Set1C/COMPASS complex
Vocabulary: biological process
TermDefinition
GO:0019233sensory perception of pain
GO:0051568histone H3-K4 methylation
GO:0080182histone H3-K4 trimethylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 24..61
e-value: 260.0
score: 1.8
coord: 157..201
e-value: 48.0
score: 6.4
coord: 72..108
e-value: 0.73
score: 17.9
coord: 111..154
e-value: 0.011
score: 24.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 130..154
e-value: 1.9E-4
score: 22.2
coord: 3..21
e-value: 0.021
score: 15.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1..30
score: 11.979
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 132..163
score: 9.874
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 72..203
e-value: 1.4E-19
score: 72.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..71
e-value: 1.7E-11
score: 45.3
NoneNo IPR availablePANTHERPTHR19861WD40 REPEAT PROTEIN SWD2coord: 1..205
IPR037867COMPASS component Swd2/WDR82PANTHERPTHR19861:SF0WD REPEAT-CONTAINING PROTEIN 82coord: 1..205
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1..206
score: 16.348
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 2..193