SMED30010266

Overview
NameSMED30010266
Smed IDSMED30010266
Length (bp)629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010266 (SMED30010266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010266 (SMED30010266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010266h1SMcG0009890 SmedASXL_017257SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010266h1SMcG0009890 SmedASXL_004369SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010266h1SMcG0009890 SmedASXL_017252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30010266h1SMcG0009890 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010266h1SMcG0009890 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010266h1SMcG0009890 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010266h1SMcG0009890 dd_Smed_v4_11640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010266h1SMcG0009890 dd_Smed_v4_11640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010266h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010266h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010266h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010266h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010266h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010266h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010266h1SMcG0009890 dd_Smed_v4_16650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010266h1SMcG0009890 dd_Smed_v4_16650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010266h1SMcG0009890 dd_Smed_v4_16650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010266h1SMcG0009889 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010266h1SMcG0009889 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010266h1SMcG0009890 Contig53784newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010266h1SMcG0009890 Contig53784uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010266h1SMcG0009890 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010266h1SMcG0009890 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30010266h1SMcG0009890 dd_Smed_v6_9830_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30010266h1SMcG0009890 dd_Smed_v6_16650_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30010266h1SMcG0009890 Contig53784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010266h1SMcG0009890 Contig53784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010266 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000055:314438..315271 -2723
v31.000055:312502..313083 -1733
v31.000055:314801..315352 -1011
v31.000055:312821..313452 -685
Homology
BLAST of SMED30010266 vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 273.092 bits (697), Expect = 2.016e-84
Identity = 174/181 (96.13%), Postives = 177/181 (97.79%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            ET++S DQIERE AESNI+E  EEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIE
Sbjct: 2621 ETEYSVDQIERESAESNIDEVDEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIE 2801          

HSP 2 Score: 182.57 bits (462), Expect = 7.836e-53
Identity = 107/158 (67.72%), Postives = 125/158 (79.11%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI---EGEITHKKINLDEVPKVDENNDSVD 465
            GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNL+++SKV E D S D NESEPS S INE+ +GE    ++VN ++VSK +E D+S DPN+S   + YI EI   +  IT   +NL+E+ KVDE + S D
Sbjct: 3254 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITD-PVNLNEISKVDEEDHSAD 3410          

HSP 3 Score: 120.939 bits (302), Expect = 2.325e-31
Identity = 115/212 (54.25%), Postives = 147/212 (69.34%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGE-EEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHK-KINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            GENN+AD V VDE S            +E  HSAD  E EP+E NINE  E E   QE+FN +EV KV++ D+S DPN+SE   S+I EI QGE NI+D VNVD+VSK +E+DH+ + N+SEP +S I E+ EGE   + ++N +EV KV+E  DS D NE EIVE NI+NV EG+T++SEE N+NE S IDE D SV  N+S+L+EHYIIE
Sbjct: 3049 GENNIADSVNVDEVSKV----------DEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIE 3250          

HSP 4 Score: 117.087 bits (292), Expect = 4.640e-30
Identity = 89/151 (58.94%), Postives = 118/151 (78.15%), Query Frame = 1
Query:  175 FNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
             N+ EVSKV+ETD + + NESEP  SNI E+  GE    ++VN+++VSK +E+D+S DPN SEP  S INE+ G++TH+K NL+EV K  EN+DSVDPNE EIV+ NI+ ++EG+TN+SEESN+NE S IDE D SV PN+S+L+EHYIIE
Sbjct: 2813 VNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINELGGKMTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIE 2963          

HSP 5 Score: 103.219 bits (256), Expect = 2.855e-25
Identity = 101/242 (41.74%), Postives = 132/242 (54.55%), Query Frame = 1
Query:    4 ENNVADPVYVDEGSNFYGKDDSGDLNE-------------------------------ETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI---EGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            E N++DPV VDE S     D + +LNE                               E D+S D    EP +SNINE G + +T EKFNL+EVSK  E D SVDPNE E    NI  + +GE NIS++ NV+++SK DE D SV PN+S+  + YI EI   +  IT   +NL+E+ KVDE   S D NE E  E NI  V+EG+    E+ N    S ++E D S DPN+ EL++H I E
Sbjct: 2806 EKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINELGGK-MTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITD-PVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITE 3045          

HSP 6 Score: 99.7525 bits (247), Expect = 4.892e-24
Identity = 77/159 (48.43%), Postives = 100/159 (62.89%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGE-EEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHK-KINLDEVPKVDENNDSVDP 468
             +NN+ DPV ++E S     D+ G       HSAD  E EP+E NINE  E E   QE+ N + VSKV+E D+S DPNE E +  NI EI QGE NI+D VNVD+VSK DE  HS D  +SEP +  INE+ EGE   + + N +EV KV++ ++S DP
Sbjct: 2967 SKNNITDPVNLNEISKV---DEKG-------HSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDP 3115          

HSP 7 Score: 96.2857 bits (238), Expect = 8.052e-23
Identity = 88/209 (42.11%), Postives = 130/209 (62.20%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHK-KINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYI 621
            GE N+++   ++E SN +  D S DLNE           EP ESNIN+  EEE TQE+   +EVSKV E D SVDPNES+    NI ++ + EK    ++N+D VSK DE+DHSVD N+S+P +S I E+ +GE T + ++N +EV  VD+   SVD NE E+   NI  +++G+     ++ +++ + + + D SVDPNK +L+E  I
Sbjct: 1837 GERNISEQDNLEEVSNVFETDPSVDLNE----------NEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGE-----KNILDQVNVLYKTDHSVDPNKIKLAEFNI 2029          

HSP 8 Score: 94.3597 bits (233), Expect = 3.697e-22
Identity = 95/204 (46.57%), Postives = 127/204 (62.25%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI---EGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSE 603
            GE N++D V VD+ S    KDD      E+DHS D  + EP +S INE  E EIT +K NL EV KVDE + SVDPNE E   SNI  + +G+ N+S++ N+++ S  DE D SVDPNKSE  + YI EI   E  I+   +N+DEV KV+E + + + NE E  ESNI+ V+ G+    E+ N+ E S ++E D S DPN SE
Sbjct: 2684 GEKNISDKVNVDQVS----KDD------ESDHSVDPNKSEPGKSYINEI-EGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISD-PVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSE 2875          

HSP 9 Score: 92.0485 bits (227), Expect = 2.440e-21
Identity = 64/127 (50.39%), Postives = 90/127 (70.87%), Query Frame = 1
Query:   94 HSADQIEREPAESNINEAGEEEITQEK-FNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHKKINLDEVPKVDENNDSVDP 468
            +SAD  E EPAESNINE  + E  Q+K  +L+EVS VD+TDHS D NES+ +  NI E+  GE+NIS++ N+++VS   E+D SVD N++EP +S IN++ E E T +++  +EV KV E + SVDP
Sbjct: 1776 YSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDP 1902          

HSP 10 Score: 91.2781 bits (225), Expect = 4.635e-21
Identity = 84/182 (46.15%), Postives = 114/182 (62.64%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQ-EKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHK-KINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYI 621
            ETDHS D  E E AESNI+E  E E  Q E+ N +EVS VD TDHS +PNE E +  NI  +   ++NIS+KVN+D+VSK DE D  VDPN+SE  +S IN++ EGE   + ++N +EV  V E  +SV  NE  + ES  + V+  +   +  +N  E S +DE D S+ PN+SE +E  I
Sbjct: 1445 ETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNI 1626          

HSP 11 Score: 90.5077 bits (223), Expect = 8.077e-21
Identity = 104/253 (41.11%), Postives = 135/253 (53.36%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNE-------------------------------ETDHSADQIEREPAESNINEA--GEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVS----KDD------ESDHSVDPNKSEPGKSYINEI-EGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            GENN+AD V VDE S     D +G+LNE                               E   S D  E E  E NI     GE +I++E  N+ E+SK+DE D SV  NES+ +   I EI QGE N++D V VD+ S    KDD      E+DHS D  + EP +S INE  E EIT +K NL+++ KV E +DS D NE E  ES I  V+EG+    E+ N  E S ++E D S DPN+S L+E+YI+E
Sbjct: 3131 GENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEP-NVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVE 3382          

HSP 12 Score: 86.6557 bits (213), Expect = 1.844e-19
Identity = 69/172 (40.12%), Postives = 90/172 (52.33%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQ------------------------------------------EKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKK--INLDEVPKVDENNDSVDP 468
            ETDHS    + EPAESNIN+  EEE  Q                                          E+ N+KE+ KV ET+HSVD NE E    NI EI + EKNISD+VNVD++SK DE DHS DPN+SE   S INE+  + T ++  +N  E+ +V E ++S +P
Sbjct: 2335 ETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNP 2506          

HSP 13 Score: 86.2705 bits (212), Expect = 2.410e-19
Identity = 80/180 (44.44%), Postives = 111/180 (61.67%), Query Frame = 1
Query:   91 DHSADQIEREPAESNINEAGEEEITQ-EKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHK-KINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYI 621
            D S +  E E AESNI+E  E E  Q E+ N +EVS VD TDHS +PNE E +  NI E+   ++NIS+KVN+D+VSK DE D  VDPN+SE  +S IN++ EGE   + ++N +EV  V E  +SV  NE  + E   + V+  +   +  +N  E S +DE D S+ PN+SE +E  I
Sbjct: 2173 DRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNI 2352          

HSP 14 Score: 81.6481 bits (200), Expect = 7.800e-18
Identity = 60/138 (43.48%), Postives = 91/138 (65.94%), Query Frame = 1
Query:   64 DSGDLNEETDHSADQIEREPAESNINEAGEEEITQE-KFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITH--KKINLDEVPKVDENNDSVDP 468
            D  ++ +ETDHSA+  + EP+ES INE  E +  Q+ K +L  VSKVD+ D S++ NESE + SNI+E+ + E    ++VN ++VS  D +DHS +PN+ E  +  I E++ +  +  +K+NLDEV KVDE +  VDP
Sbjct: 2123 DQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDP 2260          

HSP 15 Score: 79.337 bits (194), Expect = 4.555e-17
Identity = 100/249 (40.16%), Postives = 129/249 (51.81%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEA--GEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNV------------------------------------DQVSKDDESDHSVDPNKSEPGKSYINEI-EGEI-THKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            GE N+ D V V      Y          +TDHS D  + + AE NINE   GE +  QE+ N  EVSKVD  D SVD NESE    N+ EI + EKNIS+K NV                                    DQV+  DE+DHS + NKSEP +S INE+ E +    KK++LD V KVD+ + S++ NE E+ ESNI  V+E +T   E+ N  E S +D  D S +PN+ EL+E  IIE
Sbjct: 1999 GEKNILDQVNV-----LY----------KTDHSVDPNKIKLAEFNINEVDNGEPK-QQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIE 2231          

HSP 16 Score: 76.6406 bits (187), Expect = 4.076e-16
Identity = 82/183 (44.81%), Postives = 113/183 (61.75%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEE--ITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEG--EITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYI 621
            E +HS DQI+ E AE NI    EEE  IT +  NLKE SKVD+ DHSV+ NE   +     EI + E+  +D V  ++ SK DE  +S DPN+SEP +S INE++       KKI+L+EV  VD+ + S D NE ++ E NI  V+ G+ N+SE+ N+ E S + E D SVD N++E +E  I
Sbjct: 1691 EKEHSTDQIKSELAEPNIRNVDEEERNITADA-NLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNI 1872          

HSP 17 Score: 74.7146 bits (182), Expect = 1.816e-15
Identity = 67/166 (40.36%), Postives = 87/166 (52.41%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNE-------------------------------ETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGE-KNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYI-NEIEGE 399
            G+NN+ DPV ++E S    +D S DLNE                               E D+S D  E EPAESNINE G E +T EKFNL E SK+ E D S DPN+SE +  NIN + + E K      N ++ SK  E D+S DPN++E  + +I N +EGE
Sbjct: 3386 GKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGE-MTNEKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGE 3550          

HSP 18 Score: 71.633 bits (174), Expect = 2.319e-14
Identity = 80/181 (44.20%), Postives = 114/181 (62.98%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHK--KINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYI 621
            ETDHS DQ + E A+  I E  E     EK  L +V+ VDETDHS + N+SEPS S INE+ + +     KV++D VSK D+ D S++ N+SE  +S I+E++   T +  ++N +EV  VD  + S +PNE E+ E NI  V+  K N+SE+ N++E S +DE D  VDPN+SE +E  I
Sbjct: 2094 ETDHSDDQNDGELAKQIIIEIDE----VEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNI 2270          

HSP 19 Score: 71.633 bits (174), Expect = 2.364e-14
Identity = 77/201 (38.31%), Postives = 119/201 (59.20%), Query Frame = 1
Query:   31 VDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNK---SEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYII 624
            V+E  N Y         ++ D+S D  E    E+ IN+  EE I Q++ NL+EV KVDET+  ++PN SE +  NI ++ +  K   +++N+++V+  DE D+SVD N+   +EP    +  +E  I  +++N +E  K+DE + SVD NE E+ ESNI  V+EG+T   E+ N  E S +D  D S +PN+ EL+E  II
Sbjct: 1310 VNETFNLYVMTKM----DQKDNSVDPYESAHIEAKINKIDEETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKK-QEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVEN-IQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNII 1504          

HSP 20 Score: 67.781 bits (164), Expect = 4.555e-13
Identity = 48/128 (37.50%), Postives = 79/128 (61.72%), Query Frame = 1
Query:   88 TDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEI-THKKINLDEVPKVDENNDSVD 465
            T+HS +Q++ +  E NI +           NL+++S+VDE DHSV+ NE   +G N+ E+ +G+KN  +  N++++SK DE  HS +PN+SE  +S I E+ EGE    K++N +E   ++ N + VD
Sbjct: 3675 TEHSVNQMKCKIEERNITDDA---------NLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVD 3793          

HSP 21 Score: 66.2402 bits (160), Expect = 1.619e-12
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKS---EPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSE 603
            GE    + V  +E SN +  ++S  LNE T         EP +  ++    E I     N +E SKVDETDHS+ PN+SEP+ SNIN++ + E    ++VN D+V   D  D SV+P++S   EP    I E++  I+ +  N+ E+ KV E N SVD NE E+ E NI  +++ + N+S++ N++E S +DE D S DPN+SE
Sbjct: 2276 GETKQQEQVNFEEVSNVFELENSVILNENT-------LTEPIKKEVDNV--ENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEES-NVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESE 2469          

HSP 22 Score: 65.0846 bits (157), Expect = 3.516e-12
Identity = 75/170 (44.12%), Postives = 107/170 (62.94%), Query Frame = 1
Query:  118 EPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITH-KKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYI 621
            E A+ NI +  EE   QE+ NL+EV+ VDE D+SVD NE   +   + E+   E     +VN ++ SK DE+DHSVD N+SE  +S I+E+ EGE    +++N +EV  VD  + S +PNE E+ E NI  V+  K N+SE+ N++E S +DE D  VDPN+SE +E  I
Sbjct: 1375 ELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNI 1544          

HSP 23 Score: 65.0846 bits (157), Expect = 4.453e-12
Identity = 74/196 (37.76%), Postives = 113/196 (57.65%), Query Frame = 1
Query:   67 SGDLNEETDHSADQIEREPA------ESNINEAGEE-EITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDK-VNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHK-KINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            S D++E  D    ++E+         E+ IN+ GE  +   E FNL  ++K+D+ D+SVDP ES    + IN+I   E+ I  K VN+++V K DE++  ++PN+SE     I ++E E   + +INL+EV  VDE + SVD NEI + E  ++ V   +    +  N  E+S +DE D SVD N+SEL+E  I E
Sbjct: 1271 SADISESNDKIHVRVEKHEKRADNLNETQINKLGENVDQVNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKI--DEETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISE 1464          

HSP 24 Score: 63.5438 bits (153), Expect = 1.549e-11
Identity = 62/165 (37.58%), Postives = 82/165 (49.70%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQ-EKFNLKEVSKVDET------------------------------------DHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKS---EPGKSYINEIEGEITHKKINLDEVPKVDENNDS 459
            ETDHS D  E +P ESNI E  + E TQ E+ N +EVS VD+T                                    DHSVDPN+ + +  NINE+  GE    ++VN D+VSK D  D SVD N+S   EP    I+E+E  I+ K  N+ E+  V+E + S
Sbjct: 1935 ETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKS-NVKELLNVNETDHS 2098          

HSP 25 Score: 63.1586 bits (152), Expect = 1.593e-11
Identity = 64/160 (40.00%), Postives = 87/160 (54.37%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKF-NLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYI---NEIEGEITHKKINLDEVPKVDENNDSVDP 468
             E N++D V VDE S            +E DHSAD  E E A SNINE  ++E  Q++  N KE+S+V E D+S +PN+ E    NI  + + EKNI ++  +  +S  D + HSVD N+ E  +  I   NE E  + +   NL EV KVDE   S DP
Sbjct: 2440 SEKNISDQVNVDELSKV----------DEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNA-NLIEVSKVDEIYYSEDP 2588          

HSP 26 Score: 56.9954 bits (136), Expect = 2.420e-9
Identity = 78/226 (34.51%), Postives = 113/226 (50.00%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQ-------------EKFN-----------------------------LKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNK---SEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            ETDHS    + EPAESNIN+  EEE  Q             EK+N                             +K +S VDE +HS D  +SE +  NI  + + E+NI+   N+ + SK D+ DHSV+ N+   +EP    I++ E   T   I+ +E  K+DE   S DPNE E  ESNI  V++ +    ++ ++ E S +D+ D S D N+S+L+E  IIE
Sbjct: 1609 ETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVIS-EEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIE 1833          

HSP 27 Score: 53.5286 bits (127), Expect = 3.292e-8
Identity = 57/160 (35.62%), Postives = 83/160 (51.88%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAES--NINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSE---PGKSYINEIEGEITHKKINLDEVPKVDENNDSVD 465
            GE    + V  +E SN Y  ++S  LNE T   + + E +  E+  N++   EEE           SKVDETDHS+ PN+SEP+ SNIN++ + E    D+VN ++V +  E  +S DPN  E   P    ++E E  I  +  N+  +  VDE   S D
Sbjct: 1550 GETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEE-----------SKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEES-NVKSLSNVDEKEHSTD 1697          

HSP 28 Score: 53.1434 bits (126), Expect = 4.871e-8
Identity = 80/234 (34.19%), Postives = 119/234 (50.85%), Query Frame = 1
Query:    1 GENNVADPVYVDEGSNFYGKDDSGDLNE---------------------ETDHSADQIEREPAESNINEAGEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKI----NLDEVPKVDENNDSVDPXXXXXXXXXXXXXXXGKTXXXXXXXXXXXXTIDEPDLSVDPNKSELSEHYIIE 627
            GE N+++   V E +  +GK  S D  E                     ETDH+ D  E EPAESN NE     + +E+ N +E SKVDE D+S DP ++E     I     GEKNIS +  +  + K D+++HSV            N+++ +I  + I    NL ++ +VDE + SV+ NE  +   N+  V++G+ N  E +N+ E S +DE   S +PN+SEL E  I E
Sbjct: 3549 GEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNE-----VDEEEGNSEEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSV------------NQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYE 3765          

HSP 29 Score: 46.595 bits (109), Expect = 7.316e-6
Identity = 46/133 (34.59%), Postives = 65/133 (48.87%), Query Frame = 1
Query:   85 ETDHSADQIEREPAESNINEAGEEEITQ-EKFNLKEVSKVDETDHSVDPNESE--------------------------PSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGE 399
            E DHS +  ER     N+ E  + +  Q E  NL+E+SKVDE  HS +PNESE                          P   N NE+  GEK  ++ VN+++ S  D+ D+ VDP +S   K  +N++ EGE
Sbjct: 3705 EIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGE 3837          
The following BLAST results are available for this feature:
BLAST of SMED30010266 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010266 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064314.12.016e-8496.13SMESG000064314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010266 ID=SMED30010266|Name=SMED30010266|organism=Schmidtea mediterranea sexual|type=transcript|length=629bp
GGTGAAAATAATGTAGCAGATCCAGTTTATGTGGATGAGGGGTCAAACTT
TTATGGAAAAGATGACTCTGGTGATCTAAATGAAGAAACAGATCATTCTG
CTGATCAAATTGAACGTGAACCTGCTGAGTCTAATATCAATGAAGCCGGC
GAGGAAGAAATAACGCAAGAGAAATTTAATTTAAAAGAAGTATCAAAGGT
TGATGAAACAGATCATTCTGTTGATCCAAATGAAAGTGAACCTTCTGGGT
CTAATATCAATGAAATCGGTCAAGGTGAAAAGAATATATCAGATAAAGTT
AATGTGGATCAGGTGTCAAAGGATGATGAATCAGATCATTCTGTTGATCC
AAATAAAAGTGAACCTGGTAAATCTTATATCAATGAAATTGAAGGAGAAA
TTACACACAAAAAGATTAATTTGGACGAGGTACCAAAAGTTGATGAAAAT
AATGATTCTGTTGATCCTAATGAAATTGAAATTGTTGAATCTAATATCGA
AAATGTTGAGGAAGGAAAAACGAATTTATCCGAGGAATCAAATATAAACG
AATCGTCAACAATTGATGAACCAGATCTTTCTGTCGATCCAAATAAAAGT
GAACTTTCTGAGCATTATATCATCGAAAT
back to top

protein sequence of SMED30010266-orf-1

>SMED30010266-orf-1 ID=SMED30010266-orf-1|Name=SMED30010266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
GENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAG
EEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKV
NVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDEN
NDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKS
ELSEHYIIE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 144..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 179..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 156..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 156..178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 40..61
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 62..84
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..104