Synaptosomal-associated protein

Overview
NameSynaptosomal-associated protein
Smed IDSMED30010258
Length (bp)798
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptosomal-associated protein (SMED30010258) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptosomal-associated protein (SMED30010258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptosomal-associated protein (SMED30010258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptosomal-associated protein (SMED30010258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010258

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010258SMESG000005619.1 SmedASXL_012047SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30010258SMESG000005619.1 dd_Smed_v4_13255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010258SMESG000005619.1 dd_Smed_v6_13255_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010258SMESG000005619.1 OX_Smed_1.0.12918ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 135.191 bits (339), Expect = 1.885e-38
Identity = 76/147 (51.70%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEGM+ IN+D+K+AEKNL+DL KCCGLF  P  K K    S D   +  GN      A  P RV  +       GG+I ++TNDARE EMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 197          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 127.102 bits (318), Expect = 2.622e-35
Identity = 74/147 (50.34%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL K CGL   P  K K    S D   +  GN      A  P RV  +       GG+I ++TNDARE EMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 197          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 114.39 bits (285), Expect = 2.216e-30
Identity = 64/156 (41.03%), Postives = 89/156 (57.05%), Query Frame = 1
Query:  217 REQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--------------------NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            +EQL+R+EEG+D+IN+D+++ EK L +LNKCCGL   P  +TK                     N+ SK      NG    P            GGYI +ITNDARE EM++NL +V  ++GNL++MA+++G EI  Q+ QI RI  +A  NR RI
Sbjct:   49 KEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTG------AASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRI 198          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 105.145 bits (261), Expect = 1.406e-27
Identity = 59/147 (40.14%), Postives = 83/147 (56.46%), Query Frame = 1
Query:  223 QLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--------------------NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEA 603
            QL+R+EEG+D+IN+D+++ EK L +LNKCCGL   P  +TK                     N+ SK      NG    P            GGYI +ITNDARE EM++NL +V  ++GNL++MA+++G EI  Q+ QI RI  +A
Sbjct:    2 QLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTG------AASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKA 142          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 104.375 bits (259), Expect = 2.869e-27
Identity = 58/143 (40.56%), Postives = 81/143 (56.64%), Query Frame = 1
Query:  223 QLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--------------------NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRI 591
            QL+R+EEG+D+IN+D+++ EK L +LNKCCGL   P  +TK                     N+ SK      NG    P            GGYI +ITNDARE EM++NL +V  ++GNL++MA+++G EI  Q+ QI RI
Sbjct:    2 QLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTG------AASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRI 138          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: ric-4 (Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:A5PEW5])

HSP 1 Score: 139.043 bits (349), Expect = 5.270e-41
Identity = 70/143 (48.95%), Postives = 101/143 (70.63%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKT---KRNLGSKDQNAEMNGN--ADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITA 633
            EQL+R E  +D IN+D+K+AE +L+ + KCCGL  LPW KT   ++   +K    + +G   +D PR+ +   + GPQGGYITKITNDARE EMD+N+ +V+ ++GNLRNMAIDM  E+S Q++Q+DRI+ +A  N  R+ +A
Sbjct:   55 EQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESA 197          

HSP 2 Score: 47.3654 bits (111), Expect = 5.270e-41
Identity = 21/35 (60.00%), Postives = 29/35 (82.86%), Query Frame = 2
Query:  116 NNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE 220
            +++ P  ++ I LK+N+TTD+SLESTRRML LCEE
Sbjct:    4 DDDIPEGLEAINLKMNATTDDSLESTRRMLALCEE 38          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: ric-4 (Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:A5PEW5])

HSP 1 Score: 138.658 bits (348), Expect = 5.519e-40
Identity = 70/143 (48.95%), Postives = 101/143 (70.63%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKT---KRNLGSKDQNAEMNGN--ADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITA 633
            EQL+R E  +D IN+D+K+AE +L+ + KCCGL  LPW KT   ++   +K    + +G   +D PR+ +   + GPQGGYITKITNDARE EMD+N+ +V+ ++GNLRNMAIDM  E+S Q++Q+DRI+ +A  N  R+ +A
Sbjct:   82 EQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESA 224          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: aex-4 (t-SNARE protein aex-4 [Source:UniProtKB/Swiss-Prot;Acc:G5EEN8])

HSP 1 Score: 48.1358 bits (113), Expect = 1.992e-6
Identity = 36/154 (23.38%), Postives = 81/154 (52.60%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDL-NKC-CGLFTL---PWK---KTKRNLGSKDQNAEMNGNADGPRV-------AMDCGNTGPQ----GGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQLD++E  +  + +DL     N+  + + C CG F +   P+K   K +R++  ++   +M      P++        M   N+  +    G ++ ++T DA E E+++NL++++  + +++N+A+DM  ++  Q  +++RI +    N + +
Sbjct:   73 EQLDKIEANLSNVIDDLNVVSHNITAMEHYCGCGFFRILRAPFKYFRKRERDIIKEEVLEKMTS----PKLRRKEESNMMMFTNSSKRRESTGDFMKRLTCDAIEDELERNLMQIDQGLESVKNLAVDMHVQLKLQEPKLNRIEELTETNDFVV 222          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap24 (gene:FBgn0266720 transcript:FBtr0082163)

HSP 1 Score: 136.732 bits (343), Expect = 2.302e-39
Identity = 72/143 (50.35%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTK-RNLGSKDQNAEMNGN--ADGPRVAMDCGNTG-----PQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQLDR+EEGMD+IN D+++AEKNL  + KCCG+  LPWKK   ++ G     A  +G   A  P+  +D    G     PQ GY+ +ITNDARE EMD+NL +VN ++GNLRNMA+DMG+E+  Q+KQ+DRIN +   N  R+
Sbjct:   57 EQLDRIEEGMDRINADMREAEKNLSGMEKCCGICVLPWKKVNIKDDGESAWKANDDGKIVASQPQRVIDERERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRM 199          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap25 (gene:FBgn0011288 transcript:FBtr0304625)

HSP 1 Score: 134.42 bits (337), Expect = 2.072e-38
Identity = 73/147 (49.66%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADG------PRVAMDCGN-TGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEGMD+IN D+++AEKNL  + KCCG+  LP  K++     K+ +    GN DG      P+  MD  N    Q GYI +ITNDARE EM++N+ +VN +IGNLRNMA+DMG+E+  Q++QIDRIN++   N  RI  A++
Sbjct:   62 EQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQ---SFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQ 205          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap25 (gene:FBgn0011288 transcript:FBtr0111143)

HSP 1 Score: 134.035 bits (336), Expect = 2.460e-38
Identity = 73/147 (49.66%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADG------PRVAMDCGN-TGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEGMD+IN D+++AEKNL  + KCCG+  LP  K++     K+ +    GN DG      P+  MD  N    Q GYI +ITNDARE EM++N+ +VN +IGNLRNMA+DMG+E+  Q++QIDRIN++   N  RI  A++
Sbjct:   62 EQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQ---SFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQ 205          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25a (synaptosome associated protein 25a [Source:NCBI gene;Acc:30712])

HSP 1 Score: 131.724 bits (330), Expect = 2.186e-37
Identity = 71/141 (50.35%), Postives = 96/141 (68.09%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+E+GM+ IN+D+K+AEKNL+DL KCCGLF  P  K K        N +    A  P RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLDRVEDGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25a (synaptosome associated protein 25a [Source:NCBI gene;Acc:30712])

HSP 1 Score: 127.487 bits (319), Expect = 1.098e-35
Identity = 71/141 (50.35%), Postives = 95/141 (67.38%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K        N +    A  P RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25b (synaptosome associated protein 25b [Source:NCBI gene;Acc:30711])

HSP 1 Score: 120.939 bits (302), Expect = 3.034e-33
Identity = 68/140 (48.57%), Postives = 91/140 (65.00%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL   CGL   P  K K    S   N +   ++   RV  +       GG+I ++TNDARE EMD+NL +V  +IGNLR+MA+DMG EI  Q++QIDRI   A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQ 194          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25b (synaptosome associated protein 25b [Source:NCBI gene;Acc:30711])

HSP 1 Score: 120.939 bits (302), Expect = 3.034e-33
Identity = 68/140 (48.57%), Postives = 91/140 (65.00%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL   CGL   P  K K    S   N +   ++   RV  +       GG+I ++TNDARE EMD+NL +V  +IGNLR+MA+DMG EI  Q++QIDRI   A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQ 194          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: zgc:101731 (zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57])

HSP 1 Score: 119.783 bits (299), Expect = 9.669e-33
Identity = 67/142 (47.18%), Postives = 87/142 (61.27%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADG-------PRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQLDR+EEG+D+IN+D+K+AEKNL D+  CCGL   P  K K    S         N DG        RV  +       GGYI ++TNDARE EM++NL +V  ++GNLR+MA+DMG EI  Q+ QI+RI  +A  N  RI
Sbjct:   55 EQLDRIEEGLDQINKDMKEAEKNLTDMAMCCGLCIWPCTKLKDFEASGAYKKVWGNNQDGVVSSQPSSRVVDEREKMTMSGGYIRRVTNDAREDEMEENLAQVGSILGNLRSMALDMGNEIDTQNVQIERIQSKAVVNESRI 196          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: znf462 (zinc finger protein 462 [Source:Xenbase;Acc:XB-GENE-976911])

HSP 1 Score: 127.872 bits (320), Expect = 1.479e-35
Identity = 68/144 (47.22%), Postives = 94/144 (65.28%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTK---------RNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+R+EEGMD+IN+D+++AEKNL +LNKCCGL   P K+ K         +  GSKD ++E   +    +     G     G YI +IT D RE EMD+NL +V  ++GNL+NMAIDMG E+   ++QIDRIN++A  N+ RI
Sbjct:   58 EQLNRIEEGMDQINKDMREAEKNLTELNKCCGLCVCPGKRPKDFESGENYKKTWGSKDNDSENVISKQPHQTNGQQGGVAQSGPYIKRITGDDREDEMDENLTQVGSILGNLKNMAIDMGNELESHNQQIDRINEKAETNKTRI 201          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: snap25 (synaptosome associated protein 25kDa [Source:NCBI gene;Acc:549255])

HSP 1 Score: 126.716 bits (317), Expect = 1.804e-35
Identity = 72/142 (50.70%), Postives = 96/142 (67.61%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+R+EEGM++IN+D+K+AEKNL DL K CGL   P  K K    S D   +  GN      A  P RV  +       GG++ ++TNDARETEMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI
Sbjct:   41 EQLERIEEGMEQINKDMKEAEKNLTDLGKFCGLCVCPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARI 178          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: snap25 (synaptosome associated protein 25kDa [Source:NCBI gene;Acc:549255])

HSP 1 Score: 127.102 bits (318), Expect = 2.003e-35
Identity = 72/142 (50.70%), Postives = 96/142 (67.61%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+R+EEGM++IN+D+K+AEKNL DL K CGL   P  K K    S D   +  GN      A  P RV  +       GG++ ++TNDARETEMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI
Sbjct:   55 EQLERIEEGMEQINKDMKEAEKNLTDLGKFCGLCVCPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARI 192          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: ENSXETT00000012397.1 (synaptosomal-associated protein 25-like [Source:NCBI gene;Acc:100491227])

HSP 1 Score: 108.997 bits (271), Expect = 1.051e-28
Identity = 61/138 (44.20%), Postives = 91/138 (65.94%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFT---LPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRI-NKEASENRYR 621
            EQLDR++EG+D IN+D+++AEKNL D+ KCCGL +   L    T R +     +  ++  A   RVA +       GGYI ++TNDARE EM+ NL +V  ++GNLR+MA+D+G EI  Q+KQ+++I  K  +E+R +
Sbjct:   37 EQLDRIDEGLDHINQDMREAEKNLTDMGKCCGLCSCHRLKCSATYRAVWGNSHDGIIS--AQPSRVADEREQMMMSGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEKVTNEDRIK 172          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: ENSXETT00000028688.1 (synaptosomal-associated protein 25-like [Source:NCBI gene;Acc:100491227])

HSP 1 Score: 109.383 bits (272), Expect = 2.411e-28
Identity = 60/137 (43.80%), Postives = 89/137 (64.96%), Query Frame = 1
Query:  223 QLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFT---LPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            QLDR++EG+D IN+D+++AEKNL D+ KCCGL +   L    T R +     +  ++  A   RVA +       GGYI ++TNDARE EM+ NL +V  ++GNLR+MA+D+G EI  Q+KQ+++I ++   N  RI
Sbjct:   78 QLDRIDEGLDHINQDMREAEKNLTDMGKCCGLCSCHRLKCSATYRAVWGNSHDGIIS--AQPSRVADEREQMMMSGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEKVKANEDRI 212          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap25 (synaptosomal-associated protein 25 [Source:MGI Symbol;Acc:MGI:98331])

HSP 1 Score: 135.191 bits (339), Expect = 1.294e-38
Identity = 76/147 (51.70%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEGM+ IN+D+K+AEKNL+DL KCCGLF  P  K K    S D   +  GN      A  P RV  +       GG+I ++TNDARE EMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 197          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap25 (synaptosomal-associated protein 25 [Source:MGI Symbol;Acc:MGI:98331])

HSP 1 Score: 127.102 bits (318), Expect = 1.800e-35
Identity = 74/147 (50.34%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL K CGL   P  K K    S D   +  GN      A  P RV  +       GG+I ++TNDARE EMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 197          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 120.939 bits (302), Expect = 4.769e-33
Identity = 68/148 (45.95%), Postives = 95/148 (64.19%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEM-NGNADGPRVAMD-----CGNTGPQ-------GGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+R+EEGMD+IN+D+++AEK L +LNKCCGL   P  +TK     K+  A   +G  + P   +        N  PQ       GGYI +ITNDARE EM++NL +V  ++GNL+NMA+DMG EI  Q++QI +I ++A  N+ RI
Sbjct:   50 EQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWGDGGDNSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRI 197          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 120.939 bits (302), Expect = 4.769e-33
Identity = 68/148 (45.95%), Postives = 95/148 (64.19%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEM-NGNADGPRVAMD-----CGNTGPQ-------GGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+R+EEGMD+IN+D+++AEK L +LNKCCGL   P  +TK     K+  A   +G  + P   +        N  PQ       GGYI +ITNDARE EM++NL +V  ++GNL+NMA+DMG EI  Q++QI +I ++A  N+ RI
Sbjct:   50 EQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWGDGGDNSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRI 197          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 112.849 bits (281), Expect = 6.528e-30
Identity = 69/163 (42.33%), Postives = 94/163 (57.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPW--------------------KKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQ-------GGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+R+EEGMD+IN+D+++AEK L +LNKCCGL   P                     K  K   G    N+  N  +  P R+     N  PQ       GGYI +ITNDARE EM++NL +V  ++GNL+NMA+DMG EI  Q++QI +I ++A  N+ RI
Sbjct:   50 EQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRFSVGDCFFETRTKNFESGKNYKATWGDGGDNSPSNVVSKQPSRIT----NGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRI 208          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P36975|SNP25_DROME (Synaptosomal-associated protein 25 OS=Drosophila melanogaster OX=7227 GN=Snap25 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.465e-37
Identity = 73/147 (49.66%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADG------PRVAMDCGN-TGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEGMD+IN D+++AEKNL  + KCCG+  LP  K++     K+ +    GN DG      P+  MD  N    Q GYI +ITNDARE EM++N+ +VN +IGNLRNMA+DMG+E+  Q++QIDRIN++   N  RI  A++
Sbjct:   62 EQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQ---SFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQ 205          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P36977|SN25A_CARAU (Synaptosomal-associated protein 25-A OS=Carassius auratus OX=7957 GN=snap25a PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.147e-35
Identity = 74/142 (52.11%), Postives = 98/142 (69.01%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN-ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K   GSK      +G  A  P RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSG-GSKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|Q5TZ66|SN25A_DANRE (Synaptosomal-associated protein 25-A OS=Danio rerio OX=7955 GN=snap25a PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 8.292e-35
Identity = 71/141 (50.35%), Postives = 95/141 (67.38%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K        N +    A  P RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P60881|SNP25_RAT (Synaptosomal-associated protein 25 OS=Rattus norvegicus OX=10116 GN=Snap25 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.259e-34
Identity = 74/147 (50.34%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL K CGL   P  K K    S D   +  GN      A  P RV  +       GG+I ++TNDARE EMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 197          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|Q5R1X1|SNP25_PANTR (Synaptosomal-associated protein 25 OS=Pan troglodytes OX=9598 GN=SNAP25 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.259e-34
Identity = 74/147 (50.34%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL K CGL   P  K K    S D   +  GN      A  P RV  +       GG+I ++TNDARE EMD+NL +V+G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLK----SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 197          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A4PBU6 (Synaptosomal-associated protein OS=Dugesia japonica OX=6161 GN=DjSNAP-25 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 4.324e-55
Identity = 89/142 (62.68%), Postives = 111/142 (78.17%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNG--NADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR++EGMDKIN+D+KDAEKNL+DLNKCCGL  LPW K KR+   K    E  G  NADGPR+ +D    G QGGYITKITNDARE EMDQN+ EV+G++ NL+NMAIDMG+ I+QQ++QID+IN++A  N  RI  A++
Sbjct:   57 EQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAINNDERIRNANQ 198          

HSP 2 Score: 67.781 bits (164), Expect = 4.324e-55
Identity = 29/37 (78.38%), Postives = 35/37 (94.59%), Query Frame = 2
Query:  110 DINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE 220
            D+NNEPPTE+Q+IQ K+N+TTDESLESTRRML +CEE
Sbjct:    4 DLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEE 40          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A504Z4T2 (Synaptosomal-associated protein OS=Fasciola gigantica OX=46835 GN=FGIG_05049 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.013e-50
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+ EGMD+IN+D+KDAEKNL+DLNKCCGL  LPWKK K+  +   + ++ +M G  DGPR+ +D    GP GGYIT+ITNDARE EMD NL EV+G+IGNLRNMAIDMG+EI+QQ+ Q++RI  +A  N  RI  A+E
Sbjct:   55 EQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWKKVKKKDDYTKQLKDEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNAQVERIQIKARSNAERIKKANE 196          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A4E0QZ56 (Synaptosomal-associated protein OS=Fasciola hepatica OX=6192 GN=D915_006702 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.747e-50
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+ EGMD+IN+D+KDAEKNL+DLNKCCGL  LPWKK K+  +   + ++ +M G  DGPR+ +D    GP GGYIT+ITNDARE EMD NL EV+G+IGNLRNMAIDMG+EI+QQ+ Q++RI  +A  N  RI  A+E
Sbjct:   74 EQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWKKVKKKDDYTKQLKDEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNAQVERIQIKARSNAERIKKANE 215          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A4V3SEF9 (Synaptosomal-associated protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006402 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.673e-50
Identity = 87/142 (61.27%), Postives = 109/142 (76.76%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+ EGMD+IN+D+KDAEKNL+DLNKCCGL  LPW K K+  +   + ++ +M G  DGPR+ +D    GP GGYIT+ITNDARE EMD NL EV+G+IGNLRNMAIDMG+EI+QQ+ QI+RI  +A  N  RI  A+E
Sbjct:   55 EQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVKKKDDYTKQLKDEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNVQIERIQIKAKSNAERIKKANE 196          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A4S2LL36 (Synaptosomal-associated protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006402 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.064e-49
Identity = 87/142 (61.27%), Postives = 109/142 (76.76%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+ EGMD+IN+D+KDAEKNL+DLNKCCGL  LPW K K+  +   + ++ +M G  DGPR+ +D    GP GGYIT+ITNDARE EMD NL EV+G+IGNLRNMAIDMG+EI+QQ+ QI+RI  +A  N  RI  A+E
Sbjct:   74 EQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVKKKDDYTKQLKDEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNVQIERIQIKAKSNAERIKKANE 215          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:103043918])

HSP 1 Score: 129.798 bits (325), Expect = 1.050e-36
Identity = 73/142 (51.41%), Postives = 97/142 (68.31%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNG--NADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K   GSK      +G  N+   RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI  +A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSG-GSKAWGNNQDGVVNSQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMDKAESNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:103043918])

HSP 1 Score: 129.798 bits (325), Expect = 1.109e-36
Identity = 73/142 (51.41%), Postives = 97/142 (68.31%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNG--NADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K   GSK      +G  N+   RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI  +A  N+ RI  A++
Sbjct:   50 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSG-GSKAWGNNQDGVVNSQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMDKAESNKTRIDEANQ 190          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap23.1 (synaptosomal-associated protein 23-like [Source:NCBI gene;Acc:103046345])

HSP 1 Score: 122.479 bits (306), Expect = 1.506e-33
Identity = 71/153 (46.41%), Postives = 94/153 (61.44%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKT---------KRNLGSKDQNAEMNGNADG-----PRVAMDCGNTGPQ----GGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL R+E+GMD+IN+D+K AEKNL DL+KCCGL   P  +          KR  G+   NA + G   G     P  A +    GP     G YI +ITNDARE EM++NL +V  +IGNL++MA+DMG EI +Q+K +DRI  +A  N+ RI
Sbjct:   73 EQLKRVEQGMDQINKDMKAAEKNLTDLSKCCGLCVCPCDRVRSIENDGRYKRTWGTGSDNASIEGGEGGVVSSQPTAARNGQAAGPVSSSGGPYIKRITNDAREDEMEENLDQVGSIIGNLKSMALDMGNEIDKQNKTVDRIIDKADMNKARI 225          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 120.939 bits (302), Expect = 1.806e-33
Identity = 68/140 (48.57%), Postives = 91/140 (65.00%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL   CGL   P  K K    S   N +   ++   RV  +       GG+I ++TNDARE EMD+NL +V  +IGNLR+MA+DMG EI  Q++QIDRI   A  N+ RI  A++
Sbjct:   45 EQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQ 184          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 120.939 bits (302), Expect = 2.655e-33
Identity = 68/140 (48.57%), Postives = 91/140 (65.00%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+K+AEKNL DL   CGL   P  K K    S   N +   ++   RV  +       GG+I ++TNDARE EMD+NL +V  +IGNLR+MA+DMG EI  Q++QIDRI   A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQ 194          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009891.1 (pep scaffold:Pmarinus_7.0:GL477783:18017:27879:1 gene:ENSPMAG00000008937.1 transcript:ENSPMAT00000009891.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 1.289e-37
Identity = 71/147 (48.30%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKD-------QNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEG+D+IN+D+++AEKNL DL+KCCGL   P KK  RN    D          ++  ++   RV  +       GG+I ++TNDARE EM+ NLV+V+G++ NLR+MA+DMG EI  Q+KQID+IN++A  NR RI  A++
Sbjct:   57 EQLDRVEEGLDQINQDMREAEKNLTDLSKCCGLCVCPCKKI-RNFEMGDAYKKTWNSGQDIVVSSQPARVMDEREQMQVSGGFIKRVTNDAREDEMEDNLVQVSGLVSNLRHMAVDMGNEIDMQNKQIDKINQKAELNRSRIDDANQ 202          

HSP 2 Score: 43.1282 bits (100), Expect = 1.289e-37
Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  101 NGPDINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE 220
            N  D+ NE    +Q IQ+K N  TDESLESTRRM+ L EE
Sbjct:    3 NDDDMRNE----LQSIQMKANEVTDESLESTRRMIRLAEE 38          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 126.331 bits (316), Expect = 1.836e-36
Identity = 68/131 (51.91%), Postives = 92/131 (70.23%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNG-------NADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRI 591
            EQL+R+EEG+D+IN+D+K+AEKNL DL KCCGL + P +K K N  S D   ++ G       ++   RV  +       GGYI K+TNDARETEMD NL +V+G+IGNLR+MA+DMG EI  Q++Q++RI
Sbjct:   32 EQLERIEEGLDQINKDMKEAEKNLSDLGKCCGLCSCPCEKLK-NFESGDAYKKVWGKKEDGVVSSQPARVCDEREQMAMSGGYIRKVTNDARETEMDDNLEQVSGIIGNLRHMALDMGNEIDTQNRQLERI 161          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 124.405 bits (311), Expect = 2.441e-35
Identity = 70/147 (47.62%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGN------ADGPRVAMD-CGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLD++EEGMD+IN+D+K+AEKNL DL KCCGL   P +K    + S D   +  GN      ++ P   MD        GG+I ++TNDARE +M++NL +V+G+IGNLR+MA+DMG EI  Q++Q+DRI ++A  N+ RI  A++
Sbjct:   55 EQLDKIEEGMDQINKDMKEAEKNLTDLGKCCGLCACPCEK---KISSCDAYKKAWGNNQDGVVSNQPAHVMDDREQMACSGGFIRRVTNDARENDMEENLEQVSGMIGNLRHMAMDMGNEIDMQNRQLDRIMEKADSNKARIDDANQ 198          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: snap23.1 (synaptosome associated protein 23.1 [Source:ZFIN;Acc:ZDB-GENE-040426-883])

HSP 1 Score: 84.7297 bits (208), Expect = 3.455e-20
Identity = 56/142 (39.44%), Postives = 87/142 (61.27%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMD----CGNTG-PQ--GGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRI 624
            EQL+ +E  +D INED+K+A+K +  ++KCCGL   P  K K +         + G+    +V  +     G  G PQ  G +I +IT+D RE EM++NL E+  +IGNL+ MA++MG E+ QQ+ Q++R+N++A  N  RI
Sbjct:   51 EQLNTIEHNLDHINEDMKEADKYIRQMSKCCGLCICPCNKMKSSDNKGAYKPAVWGSISKEKVVSEQPGKAGQQGQPQASGPFIKRITDDDREDEMEENLQEIGDIIGNLKGMALNMGNELDQQNTQLERLNEKAELNTSRI 192          
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Match: EDO42967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S070])

HSP 1 Score: 120.553 bits (301), Expect = 9.610e-34
Identity = 67/140 (47.86%), Postives = 87/140 (62.14%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEM--NGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITA 633
            EQLDR+EEG+D+IN D+K+AE+NL  + KCCGL   PWKK+KR   S         N N DG R                 ITND RE EMD+NL +V+ +IGNL++MA+DMG E+  Q++Q+DRIN +A  N  RI  A
Sbjct:   55 EQLDRVEEGLDQINADMKEAERNLTGMEKCCGLCVCPWKKSKRYEKSDTYKKAFKNNHNEDGVR-----------------ITNDDREDEMDENLGQVSNIIGNLKSMAVDMGQELETQNRQLDRINAKAESNDTRIHVA 177          
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Match: EDO26910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAR1])

HSP 1 Score: 62.003 bits (149), Expect = 4.554e-13
Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKK 339
            EQLDR+EEG+D+IN D+K+AE+NL  + KCCGL   PWKK
Sbjct:   17 EQLDRVEEGLDQINADMKEAERNLTGMEKCCGLCVCPWKK 56          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 129.028 bits (323), Expect = 2.160e-36
Identity = 70/141 (49.65%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+E+GM+ IN+D+K+AEKNL+DL  CCGLF  P  K K        N +    A  P RV  +       GG+I ++T DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLDRVEDGMNHINQDMKEAEKNLKDLGNCCGLFICPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 126.716 bits (317), Expect = 1.238e-35
Identity = 71/141 (50.35%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K        N +    A  P RV  +       GG+I ++T DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   43 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 183          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 126.716 bits (317), Expect = 1.449e-35
Identity = 71/141 (50.35%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGP-RVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+KDAEKNL DL K CGL + P  K K        N +    A  P RV  +       GG+I ++T DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI ++A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: ENSORLT00000043933.1 (synaptosomal-associated protein 25-A [Source:NCBI gene;Acc:101170749])

HSP 1 Score: 123.635 bits (309), Expect = 2.380e-34
Identity = 69/142 (48.59%), Postives = 96/142 (67.61%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR+EEGM+K+N DLK+AEK+L+D+ +CCGL     KK K        +Q+  +N    G RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI  +A  N+ RI  A++
Sbjct:   55 EQLDRVEEGMNKVNADLKEAEKDLKDIGQCCGLICPCIKKIKGGGQAWGGNQDGVVNSQP-GARVMDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIMDKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: ENSORLT00000040742.1 (synaptosomal-associated protein 25-A [Source:NCBI gene;Acc:101170749])

HSP 1 Score: 120.939 bits (302), Expect = 2.797e-33
Identity = 68/142 (47.89%), Postives = 95/142 (66.90%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKR--NLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQL+R+EEGMD+IN+D+ DAEKNL +L + CGL + P  K K        +Q+  +N    G RV  +       GG+I ++T+DARE EMD+NL +V G+IGNLR+MA+DMG EI  Q++QIDRI  +A  N+ RI  A++
Sbjct:   55 EQLERIEEGMDQINKDMMDAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGGNQDGVVNSQP-GARVMDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIMDKADSNKTRIDEANQ 195          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000005619.1 (SMESG000005619.1)

HSP 1 Score: 288.115 bits (736), Expect = 1.907e-102
Identity = 140/140 (100.00%), Postives = 140/140 (100.00%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE
Sbjct:   66 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 205          

HSP 2 Score: 103.605 bits (257), Expect = 1.907e-102
Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 2
Query:   74 MLSGKHSSNNGPDINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE 220
            MLSGKHSSNNGPDINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE
Sbjct:    1 MLSGKHSSNNGPDINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE 49          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000034282.1 (SMESG000034282.1)

HSP 1 Score: 177.178 bits (448), Expect = 1.798e-58
Identity = 89/142 (62.68%), Postives = 111/142 (78.17%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNG--NADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASE 639
            EQLDR++EGMDKIN+D+KDAEKNL+DLNKCCGL  LPW K KR+   K    E  G  NADGPR+ +D    G QGGYITKITNDARE EMDQN+ EV+G++ NL+NMAIDMG+ I+QQ++QID+IN++A  N  RI  A++
Sbjct:   57 EQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQ 198          

HSP 2 Score: 67.781 bits (164), Expect = 1.798e-58
Identity = 29/37 (78.38%), Postives = 35/37 (94.59%), Query Frame = 2
Query:  110 DINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEE 220
            D+NNEPPTE+Q+IQ K+N+TTDESLESTRRML +CEE
Sbjct:    4 DLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEE 40          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000034721.1 (SMESG000034721.1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.297e-24
Identity = 46/85 (54.12%), Postives = 56/85 (65.88%), Query Frame = 1
Query:  220 EQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADG------PRVAMDCGNTGPQGGYITK 456
            EQLDR+ EG+DKINED+KDAEKNL+DLNKCCGL  +PW K   N    D      G+ DG      PR+ +D   +GP GGYIT+
Sbjct:   72 EQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVT-NFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITR 155          

HSP 2 Score: 36.965 bits (84), Expect = 4.297e-24
Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  125 PPTEMQLIQLKINSTTDESLESTRRMLNLCEE 220
            P TE ++IQ +I   T ++L+STRRML LCEE
Sbjct:   24 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEE 55          
The following BLAST results are available for this feature:
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNAP251.885e-3851.70synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP252.622e-3550.34synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP232.216e-3041.03synaptosome associated protein 23 [Source:HGNC Sym... [more]
SNAP231.406e-2740.14synaptosome associated protein 23 [Source:HGNC Sym... [more]
SNAP232.869e-2740.56synaptosome associated protein 23 [Source:HGNC Sym... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ric-45.270e-4148.95Synaptosomal-associated protein [Source:UniProtKB... [more]
ric-45.519e-4048.95Synaptosomal-associated protein [Source:UniProtKB... [more]
aex-41.992e-623.38t-SNARE protein aex-4 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Snap242.302e-3950.35gene:FBgn0266720 transcript:FBtr0082163[more]
Snap252.072e-3849.66gene:FBgn0011288 transcript:FBtr0304625[more]
Snap252.460e-3849.66gene:FBgn0011288 transcript:FBtr0111143[more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a2.186e-3750.35synaptosome associated protein 25a [Source:NCBI ge... [more]
snap25a1.098e-3550.35synaptosome associated protein 25a [Source:NCBI ge... [more]
snap25b3.034e-3348.57synaptosome associated protein 25b [Source:NCBI ge... [more]
snap25b3.034e-3348.57synaptosome associated protein 25b [Source:NCBI ge... [more]
zgc:1017319.669e-3347.18zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57][more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf4621.479e-3547.22zinc finger protein 462 [Source:Xenbase;Acc:XB-GEN... [more]
snap251.804e-3550.70synaptosome associated protein 25kDa [Source:NCBI ... [more]
snap252.003e-3550.70synaptosome associated protein 25kDa [Source:NCBI ... [more]
ENSXETT00000012397.11.051e-2844.20synaptosomal-associated protein 25-like [Source:NC... [more]
ENSXETT00000028688.12.411e-2843.80synaptosomal-associated protein 25-like [Source:NC... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snap251.294e-3851.70synaptosomal-associated protein 25 [Source:MGI Sym... [more]
Snap251.800e-3550.34synaptosomal-associated protein 25 [Source:MGI Sym... [more]
Snap234.769e-3345.95synaptosomal-associated protein 23 [Source:MGI Sym... [more]
Snap234.769e-3345.95synaptosomal-associated protein 23 [Source:MGI Sym... [more]
Snap236.528e-3042.33synaptosomal-associated protein 23 [Source:MGI Sym... [more]
back to top
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36975|SNP25_DROME2.465e-3749.66Synaptosomal-associated protein 25 OS=Drosophila m... [more]
sp|P36977|SN25A_CARAU6.147e-3552.11Synaptosomal-associated protein 25-A OS=Carassius ... [more]
sp|Q5TZ66|SN25A_DANRE8.292e-3550.35Synaptosomal-associated protein 25-A OS=Danio reri... [more]
sp|P60881|SNP25_RAT1.259e-3450.34Synaptosomal-associated protein 25 OS=Rattus norve... [more]
sp|Q5R1X1|SNP25_PANTR1.259e-3450.34Synaptosomal-associated protein 25 OS=Pan troglody... [more]
back to top
BLAST of Synaptosomal-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4PBU64.324e-5562.68Synaptosomal-associated protein OS=Dugesia japonic... [more]
A0A504Z4T21.013e-5061.27Synaptosomal-associated protein OS=Fasciola gigant... [more]
A0A4E0QZ561.747e-5061.27Synaptosomal-associated protein OS=Fasciola hepati... [more]
A0A4V3SEF95.673e-5061.27Synaptosomal-associated protein OS=Opisthorchis fe... [more]
A0A4S2LL361.064e-4961.27Synaptosomal-associated protein OS=Opisthorchis fe... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a1.050e-3651.41synaptosome associated protein 25 [Source:NCBI gen... [more]
snap25a1.109e-3651.41synaptosome associated protein 25 [Source:NCBI gen... [more]
snap23.11.506e-3346.41synaptosomal-associated protein 23-like [Source:NC... [more]
snap25b1.806e-3348.57synaptosomal-associated protein 25-B [Source:NCBI ... [more]
snap25b2.655e-3348.57synaptosomal-associated protein 25-B [Source:NCBI ... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009891.11.289e-3748.30pep scaffold:Pmarinus_7.0:GL477783:18017:27879:1 g... [more]
SNAP251.836e-3651.91synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP252.441e-3547.62synaptosome associated protein 25 [Source:HGNC Sym... [more]
snap23.13.455e-2039.44synaptosome associated protein 23.1 [Source:ZFIN;A... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO429679.610e-3447.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269104.554e-1365.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a2.160e-3649.65synaptosome associated protein 25 [Source:NCBI gen... [more]
snap25a1.238e-3550.35synaptosome associated protein 25 [Source:NCBI gen... [more]
snap25a1.449e-3550.35synaptosome associated protein 25 [Source:NCBI gen... [more]
ENSORLT00000043933.12.380e-3448.59synaptosomal-associated protein 25-A [Source:NCBI ... [more]
ENSORLT00000040742.12.797e-3347.89synaptosomal-associated protein 25-A [Source:NCBI ... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000005619.11.907e-102100.00SMESG000005619.1[more]
SMESG000034282.11.798e-5862.68SMESG000034282.1[more]
SMESG000034721.14.297e-2454.12SMESG000034721.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010258 ID=SMED30010258|Name=Synaptosomal-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=798bp
GAGAGCCATTATTAATTTACTTTGCGAAACTTTTCAAACATATTTTTACA
TTATATATTTTATTGTTATTAAAATGCTGAGCGGCAAACACAGTTCAAAT
AATGGTCCAGACATTAATAATGAACCTCCAACAGAGATGCAATTAATTCA
ATTGAAAATCAATTCTACCACAGATGAGTCTCTCGAAAGTACCCGACGAA
TGCTGAATCTATGTGAAGAGAACAACTAGATCGTTTAGAAGAGGGCATGG
ATAAAATTAATGAAGATCTTAAAGACGCTGAAAAAAATTTGGAAGACCTT
AACAAATGTTGTGGATTATTTACATTACCTTGGAAAAAAACGAAAAGAAA
TCTCGGATCCAAAGATCAAAATGCAGAAATGAATGGTAACGCCGATGGAC
CAAGAGTAGCAATGGATTGTGGCAATACAGGCCCCCAAGGAGGCTACATA
ACTAAGATCACAAATGATGCCCGTGAAACGGAAATGGATCAAAATCTCGT
GGAGGTCAACGGCGTTATTGGTAATTTGCGCAACATGGCTATTGATATGG
GTGCAGAAATTTCACAACAATCTAAGCAAATTGATAGAATAAATAAAGAA
GCCTCAGAAAACAGATATCGAATTATTACAGCTAGTGAAAAAACGACCAA
GTTATTAAAAAATTAATTTTTTTATTTGAACTATTTAAAAGTTGACATTG
GATTTGAACCAGTATTTATTACGCATATGGGATCATTTTATAGTGATAAT
TTCTTTTATAATTGATGTTTTCTCAGTTTATAACAAAAATATACATAA
back to top

protein sequence of SMED30010258-orf-1

>SMED30010258-orf-1 ID=SMED30010258-orf-1|Name=SMED30010258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNAD
GPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAID
MGAEISQQSKQIDRINKEASENRYRIITASEKTTKLLKN*
back to top
Aliases
The feature 'Synaptosomal-associated protein' has the following synonyms
Synonym
Dj-SNAP-25
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000727T_SNARE_dom
IPR000928SNAP-25_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..21
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 55..139
e-value: 2.9E-27
score: 96.5
NoneNo IPR availablePANTHERPTHR19305:SF14SYNAPTOSOMAL-ASSOCIATED PROTEIN-RELATEDcoord: 1..138
NoneNo IPR availablePANTHERPTHR19305SYNAPTOSOMAL ASSOCIATED PROTEINcoord: 1..138
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 64..137
IPR000727Target SNARE coiled-coil homology domainSMARTSM00397tSNARE_6coord: 69..136
e-value: 2.5E-10
score: 50.3
IPR000727Target SNARE coiled-coil homology domainPROSITEPS50192T_SNAREcoord: 74..136
score: 16.963
IPR000928SNAP-25 domainPFAMPF00835SNAP-25coord: 29..75
e-value: 6.4E-6
score: 26.4