Transmembrane protein 86A

Overview
NameTransmembrane protein 86A
Smed IDSMED30010242
Length (bp)1719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 86A (SMED30010242) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 86A (SMED30010242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 86A (SMED30010242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 86A (SMED30010242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010242h1SMcG0006286 dd_Smed_v6_11970_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30010242h1SMcG0006286 dd_Smed_v4_11970_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 86A vs. Ensembl Human
Match: TMEM86A (transmembrane protein 86A [Source:HGNC Symbol;Acc:HGNC:26890])

HSP 1 Score: 98.5969 bits (244), Expect = 1.351e-22
Identity = 63/217 (29.03%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKC---MKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            K+  FFK   +YF++           +  K  PI  L   L +      +       I +GL+FSA+GD FL+W+ +GY  HG L F++ H+ Y  AFG  P  +   +    ++ + Y+  Y    G    ++ VY+ L+  MGWR ++ L    +   ++  +L A  G + F++SD+ +    F     P+S   +M TYY AQ  +A+SA+++
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGAD--WRWTELAAGSGALFFIISDLTIALNKF-CFPVPYSRALIMSTYYVAQMLVALSAVES 227          
BLAST of Transmembrane protein 86A vs. Ensembl Human
Match: TMEM86B (transmembrane protein 86B [Source:HGNC Symbol;Acc:HGNC:28448])

HSP 1 Score: 73.1738 bits (178), Expect = 4.747e-14
Identity = 66/221 (29.86%), Postives = 102/221 (46.15%), Query Frame = 1
Query:  154 VQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTY------HLFYGINAIVLPV--YMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            +  F     +YF +    ++   F +  K  P++ L   L         Y  L+   L+ SA+GD  L+W        G   F+ AHL Y+ AFGF+P +     P L++ I+     Y      HL      +VLPV  Y +++ +M WRGL+Q  S             A +G + F LSD +L  + F     PH+ + +M TYYAAQ  + +SAL++
Sbjct:   25 LSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCLAGFLWVMS-PSGGYTQLLQGALVCSAVGDACLIWPAA--FVPGMAAFATAHLLYVWAFGFSPLQ-----PGLLLLIILAPGPYLSLVLQHLE---PDMVLPVAAYGLILMAMLWRGLAQGGS-------------AGWGALLFTLSDGVLAWDTFAQ-PLPHAHLVIMTTYYAAQLLITLSALRS 220          
BLAST of Transmembrane protein 86A vs. Ensembl Fly
Match: CG7582 (gene:FBgn0039681 transcript:FBtr0085464)

HSP 1 Score: 72.7886 bits (177), Expect = 6.017e-14
Identity = 62/234 (26.50%), Postives = 111/234 (47.44%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIF-ILQSQKCMKTKYVY--LISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILL------------------SIPFLIIAIVSYSCTYHLFYGINAIVL---PVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAIS 780
            K+  F   + +YF +     + +++ +  K  PI +L+F ++     +K +Y     I LGL+FS+ GD  L          G + F +AH+ Y+ AFG+ P K  +                   IP+L    +     Y +   ++ I++   P+Y  L+ +M WR L++   + + L      +  A G I FV+SD ++   +F  +  P + + +M+TYYAAQF +A+S
Sbjct:   14 KLVPFLVTIVLYFSLVRKDPQGELWTTVLKCLPIFALVFYVVAKGISLKKEYRRSLWILLGLVFSSGGDALL---NINLFPFGMISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLCKFTGHYIRIPYL--EYLKPPVVYFVHTKLDEILIIGVPIYCFLITTMLWRSLARAVDSRNFLA-----VFCAIGAILFVISDALIAVTMFVGVPLPCARLQIMITYYAAQFAIALS 237          
BLAST of Transmembrane protein 86A vs. Ensembl Fly
Match: CG7582 (gene:FBgn0039681 transcript:FBtr0308238)

HSP 1 Score: 60.4622 bits (145), Expect = 1.068e-10
Identity = 40/130 (30.77%), Postives = 73/130 (56.15%), Query Frame = 1
Query:  400 FSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVL---PVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAIS 780
            F +AH+ Y+ AFG+ P K  + +  L +A+  +   Y +   ++ I++   P+Y  L+ +M WR L++   + + L      +  A G I FV+SD ++   +F  +  P + + +M+TYYAAQF +A+S
Sbjct:    4 FGVAHVFYISAFGWKPIKWFIGL-LLYVAVSLF--VYFVHTKLDEILIIGVPIYCFLITTMLWRSLARAVDSRNFL-----AVFCAIGAILFVISDALIAVTMFVGVPLPCARLQIMITYYAAQFAIALS 125          
BLAST of Transmembrane protein 86A vs. Ensembl Zebrafish
Match: CT573392.2 (pep chromosome:GRCz11:CHR_ALT_CTG25_1_21:24252904:24261865:1 gene:ENSDARG00000112825.1 transcript:ENSDART00000180373.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT573392.2)

HSP 1 Score: 105.916 bits (263), Expect = 2.396e-25
Identity = 70/224 (31.25%), Postives = 110/224 (49.11%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCM---KTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF*TNNFW 813
            K+  FFK   +YF++         F +  K  PI  L   L +              I  GL+FSA+GD FL+W+ +GY +HG L F+I H+ Y  AFG  P      +   +I+  SY+  Y    G    ++ VY+ L+  MGWR ++ +    ++ ++   KL A  G + F++SD+ +    F     PHS   +M TYYAAQ  +A+SA++    +  W
Sbjct:   15 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLPIFCLWVFLLAHGINFLGAHSSARKILAGLIFSALGDAFLIWQEQGYFSHGLLMFAITHILYSSAFGMKPLNSRAGLIIAVISGFSYTLLYPYLSGPFTYLVAVYIALIGFMGWRAIAGVQF--ANDLWTWTKLSACLGAVLFMVSDLTIAVNKF-CFPVPHSRAIIMATYYAAQMLIALSAVECQDADTSW 235          
BLAST of Transmembrane protein 86A vs. Ensembl Zebrafish
Match: tmem86a (transmembrane protein 86A [Source:ZFIN;Acc:ZDB-GENE-050320-81])

HSP 1 Score: 105.531 bits (262), Expect = 2.657e-25
Identity = 70/224 (31.25%), Postives = 110/224 (49.11%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCM---KTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF*TNNFW 813
            K+  FFK   +YF++         F +  K  PI  L   L +              I  GL+FSA+GD FL+W+ +GY +HG L F+I H+ Y  AFG  P      +   +I+  SY+  Y    G    ++ VY+ L+  MGWR ++ +    ++ ++   KL A  G + F++SD+ +    F     PHS   +M TYYAAQ  +A+SA++    +  W
Sbjct:   14 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLPIFCLWVFLLAHGINFLGAHSSARKILAGLIFSALGDAFLIWQEQGYFSHGLLMFAITHILYSSAFGMKPLNSRAGLIIAVISGFSYTLLYPYLSGPFTYLVAVYIALIGFMGWRAIAGVQ--FANDLWTWTKLSACLGAVLFMVSDLTIAVNKF-CFPVPHSRAIIMATYYAAQMLIALSAVECQDADTSW 234          
BLAST of Transmembrane protein 86A vs. Ensembl Xenopus
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:100145092])

HSP 1 Score: 85.8853 bits (211), Expect = 2.870e-18
Identity = 61/204 (29.90%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  184 YFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTK---YVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFP--HSGVFVMLTYYAAQFGLAIS 780
            YF +   L E  +F++  K  P++ L F +      + +   Y   I +GL+FSA GD+ L+W  + +  HG + F +AH+ Y+++FGF P ++ L I   +     +       +G    ++P Y +L+ +M WR L+++   +    + H+   AA G + FV+SD  L  + F    FP  +S   VM TYY  Q  +A+S
Sbjct:   30 YFALWLPLSEPNLFHALIKSLPVLCLGFFIVVHSLSQGRFSSYSKKIFVGLMFSAAGDICLLW--EDFFLHGMVMFGLAHIMYIISFGFRPLRLRLFILLALFCAAFFFFALPYLHGPFLYMVPGYSVLIGTMAWRALARVSLASYKFSWAHVF--AALGSLIFVVSDCFLAVDKF---CFPIENSRAIVMATYYGGQMFIALS 226          
BLAST of Transmembrane protein 86A vs. Ensembl Xenopus
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:100145092])

HSP 1 Score: 85.8853 bits (211), Expect = 3.067e-18
Identity = 61/204 (29.90%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  184 YFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTK---YVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFP--HSGVFVMLTYYAAQFGLAIS 780
            YF +   L E  +F++  K  P++ L F +      + +   Y   I +GL+FSA GD+ L+W  + +  HG + F +AH+ Y+++FGF P ++ L I   +     +       +G    ++P Y +L+ +M WR L+++   +    + H  + AA G + FV+SD  L  + F    FP  +S   VM TYY  Q  +A+S
Sbjct:   35 YFALWLPLSEPNLFHALIKSLPVLCLGFFIVVHSLSQGRFSSYSKKIFVGLMFSAAGDICLLW--EDFFLHGMVMFGLAHIMYIISFGFRPLRLRLFILLALFCAAFFFFALPYLHGPFLYMVPGYSVLIGTMAWRALARVSLASYKFSWAH--VFAALGSLIFVVSDCFLAVDKF---CFPIENSRAIVMATYYGGQMFIALS 231          
BLAST of Transmembrane protein 86A vs. Ensembl Xenopus
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:100145092])

HSP 1 Score: 85.5001 bits (210), Expect = 4.639e-18
Identity = 61/204 (29.90%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  184 YFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTK---YVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFP--HSGVFVMLTYYAAQFGLAIS 780
            YF +   L E  +F++  K  P++ L F +      + +   Y   I +GL+FSA GD+ L+W  + +  HG + F +AH+ Y+++FGF P ++ L I   +     +       +G    ++P Y +L+ +M WR L+++   +    + H  + AA G + FV+SD  L  + F    FP  +S   VM TYY  Q  +A+S
Sbjct:   42 YFALWLPLSEPNLFHALIKSLPVLCLGFFIVVHSLSQGRFSSYSKKIFVGLMFSAAGDICLLW--EDFFLHGMVMFGLAHIMYIISFGFRPLRLRLFILLALFCAAFFFFALPYLHGPFLYMVPGYSVLIGTMAWRALARVSLASYKFSWAH--VFAALGSLIFVVSDCFLAVDKF---CFPIENSRAIVMATYYGGQMFIALS 238          
BLAST of Transmembrane protein 86A vs. Ensembl Mouse
Match: Tmem86a (transmembrane protein 86A [Source:MGI Symbol;Acc:MGI:1915143])

HSP 1 Score: 105.531 bits (262), Expect = 3.360e-25
Identity = 70/220 (31.82%), Postives = 113/220 (51.36%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKC---MKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAI---VLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            K+  FFK   +YF++           +  K  PI  L   L +      +      LI +GL+FSA+GD FL+W+  GY  HG L F++AH+ Y  AFG  P  +      L+I ++S  C   L+ G++     ++ VY+ L+  MGWR ++ L    +   ++  +L A  G + F+LSD+ +    F     P+S   +M TYYAAQ  +A+SA+++
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGVRFLLAHPSASLIFVGLVFSAVGDAFLIWQDHGYFEHGLLMFAVAHILYAAAFGMRPLALRTG---LVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISFMGWRAMAGLRLVGA--AWRWTELAAGGGALLFILSDLTIALNKF-CFPVPYSRALIMSTYYAAQMLIALSAVES 227          
BLAST of Transmembrane protein 86A vs. Ensembl Mouse
Match: Tmem86b (transmembrane protein 86B [Source:MGI Symbol;Acc:MGI:1915505])

HSP 1 Score: 73.9442 bits (180), Expect = 1.910e-14
Identity = 66/215 (30.70%), Postives = 105/215 (48.84%), Query Frame = 1
Query:  160 SFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGI---NAIVLPV--YMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 789
             F    ++YF++   +++     +  K  PI+ L+  L +     +   +L+   L+ SA+GD  L+W    +  +GT  FS+AHL YL AFG  P +     P L++     S TY+ F  +     +VLPV  Y +++ SM WR L    S             A++G + F  SD +L  + F + S P + +  M TYYAAQ  L +SAL+
Sbjct:   22 PFILACSLYFLLWIPVDQPSWVSALIKCQPILCLVVFLWAVAPGGSS-TWLLQGALVCSAVGDACLIWPEAFF--YGTAAFSVAHLFYLGAFGLTPLQ-----PGLLLCTTLASLTYYSFLLLHLEQGMVLPVMAYGLILNSMLWRSLVWGGS-------------ASWGAVLFTFSDGVLAWDTF-VYSLPFARLVTMSTYYAAQLLLILSALR 214          
BLAST of Transmembrane protein 86A vs. Ensembl Mouse
Match: Tmem86b (transmembrane protein 86B [Source:MGI Symbol;Acc:MGI:1915505])

HSP 1 Score: 73.9442 bits (180), Expect = 2.211e-14
Identity = 66/215 (30.70%), Postives = 105/215 (48.84%), Query Frame = 1
Query:  160 SFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYH---LFYGINAIVLPV--YMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 789
             F    ++YF++   +++     +  K  PI+ L+  L +     +   +L+   L+ SA+GD  L+W    +  +GT  FS+AHL YL AFG  P +     P L++     S TY+   L +    +VLPV  Y +++ SM WR L    S             A++G + F  SD +L  + F + S P + +  M TYYAAQ  L +SAL+
Sbjct:   27 PFILACSLYFLLWIPVDQPSWVSALIKCQPILCLVVFLWAVAPGGSS-TWLLQGALVCSAVGDACLIWPEAFF--YGTAAFSVAHLFYLGAFGLTPLQ-----PGLLLCTTLASLTYYSFLLLHLEQGMVLPVMAYGLILNSMLWRSLVWGGS-------------ASWGAVLFTFSDGVLAWDTF-VYSLPFARLVTMSTYYAAQLLLILSALR 219          
BLAST of Transmembrane protein 86A vs. UniProt/SwissProt
Match: sp|Q9D8N3|TM86A_MOUSE (Lysoplasmalogenase-like protein TMEM86A OS=Mus musculus OX=10090 GN=Tmem86a PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.350e-24
Identity = 70/220 (31.82%), Postives = 113/220 (51.36%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKC---MKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAI---VLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            K+  FFK   +YF++           +  K  PI  L   L +      +      LI +GL+FSA+GD FL+W+  GY  HG L F++AH+ Y  AFG  P  +      L+I ++S  C   L+ G++     ++ VY+ L+  MGWR ++ L    +   ++  +L A  G + F+LSD+ +    F     P+S   +M TYYAAQ  +A+SA+++
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGVRFLLAHPSASLIFVGLVFSAVGDAFLIWQDHGYFEHGLLMFAVAHILYAAAFGMRPLALRTG---LVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISFMGWRAMAGLRLVGA--AWRWTELAAGGGALLFILSDLTIALNKF-CFPVPYSRALIMSTYYAAQMLIALSAVES 227          
BLAST of Transmembrane protein 86A vs. UniProt/SwissProt
Match: sp|Q3MHQ7|TM86A_BOVIN (Lysoplasmalogenase-like protein TMEM86A OS=Bos taurus OX=9913 GN=TMEM86A PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 7.928e-24
Identity = 66/217 (30.41%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKC---MKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            K+  FFK   +YF++           +  K  PI  L   L +      +       I +GL+FSAIGD FL+W+ +GY  HG L F++ H+ Y  AFG  P  +   +  +I++ + Y+  Y    G    V+ VY+ ++  MGWR ++ L    +   ++  +L A  G + F++SD+ +  + F     P+S   +M TYYAAQ  +A+SA+++
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGLGFLLTHPSATRIFVGLVFSAIGDAFLIWQDQGYFVHGMLMFAVTHMLYASAFGMRPLGLRTGLLMVILSGLCYAFLYPNLTGAFTYVVGVYVAIIGFMGWRAMAGLQLVGA--AWRWTELAAGTGALLFIVSDLTIALDKF-CFPVPYSRALIMSTYYAAQMLIALSAVES 227          
BLAST of Transmembrane protein 86A vs. UniProt/SwissProt
Match: sp|Q8N2M4|TM86A_HUMAN (Lysoplasmalogenase-like protein TMEM86A OS=Homo sapiens OX=9606 GN=TMEM86A PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.488e-22
Identity = 63/217 (29.03%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKC---MKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            K+  FFK   +YF++           +  K  PI  L   L +      +       I +GL+FSA+GD FL+W+ +GY  HG L F++ H+ Y  AFG  P  +   +    ++ + Y+  Y    G    ++ VY+ L+  MGWR ++ L    +   ++  +L A  G + F++SD+ +    F     P+S   +M TYY AQ  +A+SA+++
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGAD--WRWTELAAGSGALFFIISDLTIALNKF-CFPVPYSRALIMSTYYVAQMLVALSAVES 227          
BLAST of Transmembrane protein 86A vs. UniProt/SwissProt
Match: sp|B0BNF0|TM86B_RAT (Lysoplasmalogenase OS=Rattus norvegicus OX=10116 GN=Tmem86b PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.296e-14
Identity = 65/216 (30.09%), Postives = 106/216 (49.07%), Query Frame = 1
Query:  160 SFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGIN---AIVLPV--YMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
             F    ++YF++    ++     +  K  PI+ L+  L +       Y +L+   L  SA+GD  L+W    +  +G   FS+AHL YL AFG +P +     P L++     S TY+ F  ++    +VLPV  Y +++ +M WRGL    S             A +G + F+ SD +L  + F + + P + +  M TYYAAQ  L +SAL++
Sbjct:   34 PFIVACSLYFLLWIPEDQPSWVSALVKCQPILCLVLFLWAVA-PGGSYTWLLQGALTCSAVGDACLIWPEAFF--YGMAVFSVAHLLYLWAFGLSPLQ-----PGLLLCTTLASLTYYSFLLLHLEPNMVLPVAAYGLILNTMLWRGLVLGRS-------------AGWGAVLFIFSDGVLAWDTF-VYTLPFARLVTMSTYYAAQLLLTLSALRS 227          
BLAST of Transmembrane protein 86A vs. UniProt/SwissProt
Match: sp|Q497J1|TM86B_MOUSE (Lysoplasmalogenase OS=Mus musculus OX=10090 GN=Tmem86b PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.546e-13
Identity = 66/215 (30.70%), Postives = 105/215 (48.84%), Query Frame = 1
Query:  160 SFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYH---LFYGINAIVLPV--YMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 789
             F    ++YF++   +++     +  K  PI+ L+  L +     +   +L+   L+ SA+GD  L+W    +  +GT  FS+AHL YL AFG  P +     P L++     S TY+   L +    +VLPV  Y +++ SM WR L    S             A++G + F  SD +L  + F + S P + +  M TYYAAQ  L +SAL+
Sbjct:   27 PFILACSLYFLLWIPVDQPSWVSALIKCQPILCLVVFLWAVAPGGSS-TWLLQGALVCSAVGDACLIWPEAFF--YGTAAFSVAHLFYLGAFGLTPLQ-----PGLLLCTTLASLTYYSFLLLHLEQGMVLPVMAYGLILNSMLWRSLVWGGS-------------ASWGAVLFTFSDGVLAWDTF-VYSLPFARLVTMSTYYAAQLLLILSALR 219          
BLAST of Transmembrane protein 86A vs. TrEMBL
Match: A0A2T7PJF6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04828 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.330e-26
Identity = 79/219 (36.07%), Postives = 124/219 (56.62%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLI-FILQSQKCMKTKYVY--LISLGLLFSAIGDVFLVWRTKGYLTH--GTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKA 792
            K+  FFK V+IYF++  + E + VF+  AK  PI+SLI F+L     +   Y Y  LI +GL+ S IGD FLVW+   Y+    G L F+IA  +Y  AFGF PF       F+++  + YS       G+   + P Y+IL+C MGWR ++++       ++   KL    G + F++SD+ +  ++F   S P +   +M+TYYAAQFG+++S + +
Sbjct:   67 KLVPFFKTVSIYFVLFGDAERSSVFFCIAKCLPIVSLILFVLLHGMSLNEYYRYSRLILIGLISSCIGDAFLVWK-HAYMNFECGLLMFAIAQFSYAKAFGFRPFSPYAGAVFVLLGFLVYSYLKPGMTGMMEYLAPFYLILICVMGWRAVARVQFFDD--LWTWTKLCGCAGALCFMISDLTIAVDLFRF-SVPFAHQIIMVTYYAAQFGISLSVVDS 281          
BLAST of Transmembrane protein 86A vs. TrEMBL
Match: A0A3L8DID6 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_006811 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.955e-26
Identity = 85/228 (37.28%), Postives = 127/228 (55.70%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLI-FILQSQKCMKTKYVY--LISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCT---YHLFYGIN---AIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF*TNN 807
            K+  FFK V++YF++    E+  +  +C K  PIISLI FI+     +  +Y +   I  GL+FS IGD  LVW      T G   F+IA + Y++AFGF P  + L       AI+  SC+   Y L  G+N   AI +P+Y +L+ +M WR +S++       ++   KL +  G I FV+SD +L    F     P+S V +MLTYYAAQ G+A+SA+ +  ++N
Sbjct:   14 KLVPFFKSVSVYFVLLA--EQPSLLAACLKCLPIISLIVFIILHGISLSKEYAFSRRILTGLVFSCIGDALLVW--PNCFTAGMCMFAIAQIMYIIAFGFEPLNLTLG------AILYMSCSVVIYALMPGLNGVLAIGVPIYTVLLTTMAWRAISRVQLFGE--LWTWTKLCSCIGSICFVISDTLLGFHYFH-SPLPYSQVSIMLTYYAAQLGIALSAVDSKPSSN 228          
BLAST of Transmembrane protein 86A vs. TrEMBL
Match: A0A433U7W0 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_002330 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.226e-26
Identity = 79/220 (35.91%), Postives = 121/220 (55.00%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLI-FILQSQKCMKTKYVY--LISLGLLFSAIGDVFLVWRTK-GYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGV--FVMLTYYAAQFGLAISALKA 792
            K+  FFK VAI+F++    E   VF+  AK  P++SL+ F+L     +   Y Y   I  GL+FS +GDVFLVW+        G L F+IA   Y  AFG+ P K    + FL I ++ YS       G+   + P+YM L+C+M WR ++++       ++   KL    G + F++SD+++   +F   +FP  G    VMLTYYAAQFG+++S + +
Sbjct:   58 KLVPFFKTVAIFFVLFGQEERTSVFFCVAKCLPVLSLMAFVLLHGMSLDECYRYSRRILTGLVFSLLGDVFLVWKHSFCNFELGLLCFAIAQTMYARAFGWRPLKPRPGLVFLAIGVLVYSYLQLYLTGVMVFLAPLYMTLICTMAWRAVARVEIYDD--LWTWTKLCGCVGAVCFMVSDLLIAVNMF---AFPVPGAHQLVMLTYYAAQFGISLSVVDS 272          
BLAST of Transmembrane protein 86A vs. TrEMBL
Match: E2B880 (Transmembrane protein 86A OS=Harpegnathos saltator OX=610380 GN=EAI_03592 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.176e-25
Identity = 82/229 (35.81%), Postives = 124/229 (54.15%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIF-ILQSQKCMKTKYVY--LISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCT----YHLFYGIN---AIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF*TNN 807
            K+  FFK V++YF++    E+  V  +C K  PIISLIF +L     +  +Y +   I  GL+FS +GD FLVW        G   F++A + Y++AFGF P         L +  V Y+C     Y L  G+N   AI +P+Y +L+ +M WR +S++       ++   KL +  G I FV+SD +L    F     P+S + +MLTYYAAQ G+A+SA+ +   +N
Sbjct:   10 KLVPFFKSVSVYFVLLA--EQPSVLTACLKCLPIISLIFFVLLHGISLSKEYTFSRRILTGLVFSCMGDAFLVW--PNCFNAGMCMFAVAQIMYIIAFGFKPLN-------LTLGAVLYTCCSIVIYALMPGLNGVLAIGVPIYTVLLTTMSWRAISRVQFVGE--LWTWTKLCSCIGSICFVISDTLLGFHHFH-TPLPYSQISIMLTYYAAQLGIALSAVDSKNNSN 224          
BLAST of Transmembrane protein 86A vs. TrEMBL
Match: E2A5R4 (Transmembrane protein 86A OS=Camponotus floridanus OX=104421 GN=EAG_13368 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.187e-25
Identity = 84/223 (37.67%), Postives = 128/223 (57.40%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLI-FILQSQKCMKTKYVY--LISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILL-SIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF*TNN 807
            K+  FFK V++YF++    E+  +  +C K  PIISLI FIL     +  +Y +   I  GL+FS IGD  LVW      T G   F++A + Y++AFGF P  + L +I ++I +IV Y+    L  G+ AI +P+Y +L+ +M WR +S++       ++   KL +  G I FV+SD +L    F     P+S V +MLTYYAAQ G+A+SA+ +   +N
Sbjct:   14 KLVPFFKSVSVYFVLLA--EQPSLLTACFKCLPIISLIVFILLHGINLSKEYAFSRRILTGLVFSCIGDALLVW--PNCFTAGMCMFAMAQIMYIIAFGFKPLNLTLGAILYMICSIVIYALMPGL-KGVLAIGVPIYTVLLTTMAWRAISRVQFFGE--LWTWTKLCSCIGSICFVISDTLLGFHYFH-SPLPYSQVSIMLTYYAAQLGIALSAVDSKNNSN 228          
BLAST of Transmembrane protein 86A vs. Ensembl Cavefish
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:103022453])

HSP 1 Score: 103.99 bits (258), Expect = 8.483e-25
Identity = 69/216 (31.94%), Postives = 111/216 (51.39%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISL-IFILQSQKCMKTKY--VYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 789
            K+  FFK   +YF++         F +  K  PI  L +F+L         +     I  GL+FSA+GD FL+W+ +GY +HG L F+I H+ Y  AFG  P  +   +    I+ + Y+  Y    G    ++ VY+ L+  MGWR ++ +    ++ ++   KL A  G + F++SD+ +    F     PHS   +M TYYAAQ  +A+SA++
Sbjct:   14 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLPIFCLWVFLLAHGFSFLGAHSNARKILAGLIFSALGDAFLIWQEQGYFSHGLLMFAITHILYSSAFGMKPLNLRAGLVIGTISGLCYTLLYPYLAGPFTYLVAVYIALIGFMGWRAIAGVQ--LANDLWTWTKLSACLGAVLFMVSDLTIAVNKF-CFPVPHSRAIIMATYYAAQMLIALSAVE 226          
BLAST of Transmembrane protein 86A vs. Ensembl Nematostella
Match: EDO48808 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIH1])

HSP 1 Score: 110.153 bits (274), Expect = 3.850e-27
Identity = 78/217 (35.94%), Postives = 116/217 (53.46%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENK--VFYSCAKIAPIISLIFILQSQKCMKTK---YVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHST--ASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAIS 780
            K+  FFK V +YF V++  E ++  +F +  KI PI  L   +  Q    TK   Y   I LGL+FS IGDV LVW+   Y  HG + F+IAHL Y+ +FGF P K L  I  L++ +  Y   +    G+    +PVY++++  M WR ++ L +   +   +++  KL A  G +SF +SD  +    F     PHS   +M TYY  Q G+A+S
Sbjct:   37 KLVPFFKTVCVYF-VAWLPESDRPTIFAALLKILPIACLCGFVTLQGVSLTKQHDYSRRILLGLIFSMIGDVCLVWK-HSYFIHGMVAFAIAHLLYMRSFGFRPLKPLTGIICLLLMLPFYVFYFPNLKGLLFYAVPVYIVVIGIMVWRAITGLQAQIYSDDGLWRWTKLCACLGALSFAISDAAIGLNKF-CFPIPHSRAIIMFTYYGGQLGIALS 250          
BLAST of Transmembrane protein 86A vs. Ensembl Medaka
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:101161706])

HSP 1 Score: 109.383 bits (272), Expect = 1.180e-26
Identity = 69/217 (31.80%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  151 KVQSFFKMVAIYFIVSYNLEENKVFYSCAKIAPIISL-IFILQSQK---CMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 789
            K+  FFK   +YF++         F +  K  PI  L +F+L       C       +++ GL+FSA+GD FL+W+ +GY  HG L F++ H+ Y  AFG  P  +   +    ++ ++Y   Y    G    ++ VYM L+  MGWR ++ L    ++ ++   KL A  G + F++SD+ +    F     PHS   +M TYYAAQ  +A+SA++
Sbjct:   14 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLPIFCLWVFLLAHGSGFLCAHADARKILA-GLIFSALGDAFLIWQEQGYFVHGLLMFAVTHILYSSAFGMKPLNVRAGLLMAAVSFLTYVLLYPYLSGPFTYLVAVYMALIGFMGWRAVAGLQ--LANDLWTWTKLSACLGAVLFMVSDLTIAVNKF-CFPVPHSRAIIMATYYAAQMLIALSAVE 226          
BLAST of Transmembrane protein 86A vs. Planmine SMEST
Match: SMESG000010122.1 (SMESG000010122.1)

HSP 1 Score: 413.69 bits (1062), Expect = 1.371e-143
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 1
Query:  172 MVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF 795
            MVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF
Sbjct:    1 MVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF 208          
BLAST of Transmembrane protein 86A vs. Planmine SMEST
Match: SMESG000001487.1 (SMESG000001487.1)

HSP 1 Score: 413.69 bits (1062), Expect = 1.371e-143
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 1
Query:  172 MVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF 795
            MVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF
Sbjct:    1 MVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQKCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALKAF 208          
BLAST of Transmembrane protein 86A vs. Planmine SMEST
Match: SMESG000038930.1 (SMESG000038930.1)

HSP 1 Score: 133.265 bits (334), Expect = 2.275e-35
Identity = 83/211 (39.34%), Postives = 120/211 (56.87%), Query Frame = 1
Query:  163 FFKMVAIYFIVSYNLEENKVFYSCAKIAPIISLIFILQSQ----KCMKTKYVYLISLGLLFSAIGDVFLVWRTKGYLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGINAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISA 783
            FFK  A+YFI+S +L E+K+ +S  K  PII+L+  + S+    +C  + Y  L+S GL+ S IGDVFLV++ +GYL HG + F IA + Y  AFGF  FK  ++    +  +  Y   Y    GI  I  P+YM ++  M WR  S+   +   L     KL  A G I F++SD+IL   +F +I+F   G  +M TYYAAQ  +A+S 
Sbjct:   23 FFKTSALYFILSNHLSESKILFSILKCTPIITLLIFVISRCYVSRCFSS-YRILVSAGLILSCIGDVFLVYKPEGYLIHGIVAFGIAQVIYTCAFGFRQFKGKIAGALFVCGVCIYRLIYPNLTGILVIACPIYMSMLGCMIWRATSRAEWSNRELCTS--KLLPAIGSILFMISDIILALSLFHVITFTGCGNAIMFTYYAAQMFIALSC 230          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 86A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TMEM86A1.351e-2229.03transmembrane protein 86A [Source:HGNC Symbol;Acc:... [more]
TMEM86B4.747e-1429.86transmembrane protein 86B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG75826.017e-1426.50gene:FBgn0039681 transcript:FBtr0085464[more]
CG75821.068e-1030.77gene:FBgn0039681 transcript:FBtr0308238[more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CT573392.22.396e-2531.25pep chromosome:GRCz11:CHR_ALT_CTG25_1_21:24252904:... [more]
tmem86a2.657e-2531.25transmembrane protein 86A [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem86a2.870e-1829.90transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
tmem86a3.067e-1829.90transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
tmem86a4.639e-1829.90transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tmem86a3.360e-2531.82transmembrane protein 86A [Source:MGI Symbol;Acc:M... [more]
Tmem86b1.910e-1430.70transmembrane protein 86B [Source:MGI Symbol;Acc:M... [more]
Tmem86b2.211e-1430.70transmembrane protein 86B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 86A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D8N3|TM86A_MOUSE2.350e-2431.82Lysoplasmalogenase-like protein TMEM86A OS=Mus mus... [more]
sp|Q3MHQ7|TM86A_BOVIN7.928e-2430.41Lysoplasmalogenase-like protein TMEM86A OS=Bos tau... [more]
sp|Q8N2M4|TM86A_HUMAN6.488e-2229.03Lysoplasmalogenase-like protein TMEM86A OS=Homo sa... [more]
sp|B0BNF0|TM86B_RAT1.296e-1430.09Lysoplasmalogenase OS=Rattus norvegicus OX=10116 G... [more]
sp|Q497J1|TM86B_MOUSE1.546e-1330.70Lysoplasmalogenase OS=Mus musculus OX=10090 GN=Tme... [more]
back to top
BLAST of Transmembrane protein 86A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PJF61.330e-2636.07Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3L8DID61.955e-2637.28Uncharacterized protein OS=Ooceraea biroi OX=20151... [more]
A0A433U7W02.226e-2635.91Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
E2B8801.176e-2535.81Transmembrane protein 86A OS=Harpegnathos saltator... [more]
E2A5R41.187e-2537.67Transmembrane protein 86A OS=Camponotus floridanus... [more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem86a8.483e-2531.94transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO488083.850e-2735.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 86A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem86a1.180e-2631.80transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 86A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000010122.11.371e-143100.00SMESG000010122.1[more]
SMESG000001487.11.371e-143100.00SMESG000001487.1[more]
SMESG000038930.12.275e-3539.34SMESG000038930.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010242 ID=SMED30010242|Name=Transmembrane protein 86A|organism=Schmidtea mediterranea sexual|type=transcript|length=1719bp
ATTGAATTTCATTGTTAATATCAGTTGTTTATACACGAAATTAAAGTTGT
TTATGTATGTTTATTTAATGTACAATTCATCGCTACTTTTACAAAAAAAT
ACTTAAGGACATAAATTATGTCTAAAATATCTGTTTCACTGATATATCTG
AAAGTGCAATCTTTTTTCAAAATGGTTGCAATTTATTTCATTGTTTCTTA
TAATCTGGAGGAAAATAAAGTTTTCTATAGTTGTGCGAAAATCGCACCAA
TAATTTCTTTAATATTTATTCTTCAGAGTCAGAAATGCATGAAGACAAAA
TATGTGTATTTAATATCATTAGGGTTACTTTTCTCTGCAATTGGAGATGT
ATTCCTCGTATGGCGAACTAAAGGATATCTTACTCATGGAACGTTATTCT
TTTCCATAGCTCATTTGGCATATCTTGTAGCTTTCGGATTTAATCCTTTT
AAAATCTTACTATCAATCCCATTTTTAATCATAGCTATTGTTTCATACTC
ATGTACATACCATTTGTTTTATGGTATTAATGCGATCGTTTTACCAGTAT
ATATGATTCTTGTTTGTTCAATGGGATGGAGAGGGCTTTCACAATTACAT
TCGACGGCTTCGCATTTGGTTTACAAGCATATGAAATTAGGAGCTGCGTT
TGGTGGGATTTCTTTTGTTTTATCTGATATGATCTTATGTACTGAAATTT
TTGGTTTGATCTCGTTTCCTCATAGTGGAGTTTTTGTGATGCTCACATAT
TATGCAGCACAATTTGGACTCGCTATTTCAGCACTTAAAGCATTTTAAAC
AAATAATTTTTGGTTAGGTAGATGAAATTTATTCATTTCCTTGGTAACTG
AAATACATTGCGATCTTTAAATAAATTTTATTTATCACTTTCAATAAAAT
ATGAATTTGCTTTCGCTTTTAGATCGTACGCAATGTAGACATGGTACGAG
ATTTTATCGTAATTTGATTGGTTGATTTTATGCTAATTTTTAAAAGGTGA
ATGATTGAATATTAGATTTAATTGTTCGATAATATTTTCCAATAAAATGA
AATAACCAAAACATATATATTCTCTTGAAGAATCTAAATTAAAACTACTC
CCGATTATTGTTCTCTTTTAGATTTAGACTGCAGATAAACTTCCTTTTTT
AATGACGATTTAATTATTTGAACATTATTATTGGTTTCTCTTATCCAAAA
ACCAAATTTGATTTAATTTCCTTAATTATCACTTCTGGCCAACTTGTATT
ATGAAACTAAAAGAAAATCTAAATTTGTATGACTTCACGAAAACGACATT
CTATTCATAATACATTTTTACATCGTTATCAAGATTTATGGTTAAAATAA
AATTTTCATCTAAAACACTGGAAATTTTCTATTGATCCTTTTGATTTTAA
CAGAGTTTGTGGCAAGAGGTATCAGAAAGTCAACTTAACAACTTCGACCA
CCATTGATTGAACAGAAGCATTTTTTATAAGGTAAATAAAGTGTGGACAT
CAGAAAAATCACAATTAAGTGTTAAGACTTTGAAAATCATTTTATGTAGG
AAATATAATTTAACAAATTCATGTGAAAAATTTCACCTTTTAAACTACAG
CAATCTACTAAAAAATTCATTCAAATAAGAAATATCTCAAAGAAAAAAAT
AGTGATTAACATATTTTTTAATGTATTATGTTTTGTAAATTGGACTTGTA
TTGAAATAAATATTAAAAT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012506YhhN
IPR002108ADF-H
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0005575cellular_component
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012506YhhN-likePFAMPF07947YhhNcoord: 39..221
e-value: 6.4E-31
score: 107.4
IPR012506YhhN-likePANTHERPTHR31885FAMILY NOT NAMEDcoord: 11..224
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 204..223
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 133..155