Visual system homeobox 2

Overview
NameVisual system homeobox 2
Smed IDSMED30010230
Length (bp)1083
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Visual system homeobox 2 (SMED30010230) t-SNE clustered cells

Violin plots show distribution of expression levels for Visual system homeobox 2 (SMED30010230) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Visual system homeobox 2 (SMED30010230) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Visual system homeobox 2 (SMED30010230) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010230

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010230SMESG000048803.1 SmedASXL_000725SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30010230SMESG000048803.1 dd_Smed_v6_19286_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010230SMESG000048803.1 OX_Smed_1.0.01189ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Visual system homeobox 2 vs. Ensembl Human
Match: VSX2 (visual system homeobox 2 [Source:HGNC Symbol;Acc:HGNC:1975])

HSP 1 Score: 205.682 bits (522), Expect = 1.288e-62
Identity = 88/108 (81.48%), Postives = 100/108 (92.59%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWLLGMHKKS+
Sbjct:  153 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSL 260          
BLAST of Visual system homeobox 2 vs. Ensembl Human
Match: VSX1 (visual system homeobox 1 [Source:HGNC Symbol;Acc:HGNC:12723])

HSP 1 Score: 204.527 bits (519), Expect = 3.881e-62
Identity = 91/150 (60.67%), Postives = 116/150 (77.33%), Query Frame = 2
Query:  401 PSLASVRQDDKSETSDISTANNTESGKK------RNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            P+L   ++ D   TSD  + +   +  K      + KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG SS+MAEYGLYGAMVRH +PLP++++ SA+ G+  SCAPWLLGMHKKS+
Sbjct:  127 PALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSAEGGLLGSCAPWLLGMHKKSM 276          
BLAST of Visual system homeobox 2 vs. Ensembl Human
Match: VSX1 (visual system homeobox 1 [Source:HGNC Symbol;Acc:HGNC:12723])

HSP 1 Score: 190.66 bits (483), Expect = 8.349e-58
Identity = 85/143 (59.44%), Postives = 109/143 (76.22%), Query Frame = 2
Query:  401 PSLASVRQDDKSETSDISTANNTESGKK------RNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL 811
            P+L   ++ D   TSD  + +   +  K      + KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG SS+MAEYGLYGAMVRH +PLP++++ SA+ G+  SCAPWLL
Sbjct:  127 PALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSAEGGLLGSCAPWLL 269          
BLAST of Visual system homeobox 2 vs. Ensembl Human
Match: VSX1 (visual system homeobox 1 [Source:HGNC Symbol;Acc:HGNC:12723])

HSP 1 Score: 189.889 bits (481), Expect = 2.442e-57
Identity = 85/143 (59.44%), Postives = 109/143 (76.22%), Query Frame = 2
Query:  401 PSLASVRQDDKSETSDISTANNTESGKK------RNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL 811
            P+L   ++ D   TSD  + +   +  K      + KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG SS+MAEYGLYGAMVRH +PLP++++ SA+ G+  SCAPWLL
Sbjct:  127 PALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSAEGGLLGSCAPWLL 269          
BLAST of Visual system homeobox 2 vs. Ensembl Human
Match: ALX3 (ALX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:449])

HSP 1 Score: 105.145 bits (261), Expect = 3.158e-26
Identity = 49/73 (67.12%), Postives = 59/73 (80.82%), Query Frame = 2
Query:  470 ESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGK 688
            E  K ++KKRR+RT FS++QLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E  +GK
Sbjct:    2 ELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRER-YGK 73          
BLAST of Visual system homeobox 2 vs. Ensembl Celegans
Match: ceh-10 (Homeobox protein ceh-10 [Source:UniProtKB/Swiss-Prot;Acc:P41935])

HSP 1 Score: 201.06 bits (510), Expect = 1.641e-61
Identity = 91/117 (77.78%), Postives = 103/117 (88.03%), Query Frame = 2
Query:  485 RNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDG-IDQSCAPWLLGMHKKSI 832
            + KKRRHRTIF+ YQ++ELEK FQD+HYPD+Y RE+L+ KT+L EDRIQVWFQNRRAKWRKTE TWGKS+IMAEYGLYGAMVRHSLPLPETI KSA+     QS APWLLGMHKKS+
Sbjct:  133 KRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVWFQNRRAKWRKTEKTWGKSTIMAEYGLYGAMVRHSLPLPETITKSAEAADPQQSAAPWLLGMHKKSM 249          
BLAST of Visual system homeobox 2 vs. Ensembl Celegans
Match: unc-4 (Homeobox protein unc-4 [Source:UniProtKB/Swiss-Prot;Acc:P29506])

HSP 1 Score: 98.9821 bits (245), Expect = 6.909e-24
Identity = 47/93 (50.54%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  437 ETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTW-GKSSIMAEYG 712
            E   I+  ++ ++G+   K+RR RT FS +QLEELE  F+ +HYPDV+ RE L+++ DL E R+QVWFQNRRAKWRK E    G S I  + G
Sbjct:   69 EDDGIALEDDNDTGESAAKRRRTRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQNRNGSSEIKKDDG 161          
BLAST of Visual system homeobox 2 vs. Ensembl Celegans
Match: alr-1 (AristaLess (Drosophila homeodomain) Related [Source:UniProtKB/TrEMBL;Acc:Q21836])

HSP 1 Score: 93.5893 bits (231), Expect = 3.520e-21
Identity = 46/98 (46.94%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  386 NILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHT 679
            NIL + S+      D  E    S   N+     + K+RR+RT FS++QL+ELEK F   HYPDV+ RE L+ +  L E R+QVWFQNRRAK+RK E +
Sbjct:   86 NILEAASVL-----DNRENGSPSDGTNSPDDNGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERS 178          
BLAST of Visual system homeobox 2 vs. Ensembl Celegans
Match: ceh-17 (C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrEMBL;Acc:G5EC89])

HSP 1 Score: 88.9669 bits (219), Expect = 2.889e-20
Identity = 38/64 (59.38%), Postives = 52/64 (81.25%), Query Frame = 2
Query:  482 KRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            +R K+RR RT F+S QL+ELE++F + HYPD+Y RE ++++ DL E R+QVWFQNRRAK+RK E
Sbjct:  145 ERRKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQE 208          
BLAST of Visual system homeobox 2 vs. Ensembl Celegans
Match: ceh-8 (Homeobox protein ceh-8 [Source:UniProtKB/Swiss-Prot;Acc:Q94398])

HSP 1 Score: 86.6557 bits (213), Expect = 3.028e-19
Identity = 37/61 (60.66%), Postives = 46/61 (75.41%), Query Frame = 2
Query:  491 KKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            K+RR+RT F+++QL  LE  F   HYPDVY RE L+ K  LPE R+QVWFQNRRAK+R+ E
Sbjct:   59 KQRRNRTTFTTFQLHALEAAFDKTHYPDVYARETLAAKVQLPEVRVQVWFQNRRAKFRRQE 119          
BLAST of Visual system homeobox 2 vs. Ensembl Fly
Match: Vsx2 (gene:FBgn0263512 transcript:FBtr0100024)

HSP 1 Score: 198.749 bits (504), Expect = 8.692e-58
Identity = 89/113 (78.76%), Postives = 103/113 (91.15%), Query Frame = 2
Query:  497 RRH-RTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            RRH RTIF+SYQLE+LE+ F++AHYPDVY RE+LS+KT+LPEDRIQVWFQNRRAKWRKTE  WG S+IMAEYGLYGAMVRHSLPLP+TI+KSAKD  + + APWLLGMH+KSI
Sbjct:  230 RRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLPLPDTILKSAKD--NDAVAPWLLGMHRKSI 340          
BLAST of Visual system homeobox 2 vs. Ensembl Fly
Match: Vsx2 (gene:FBgn0263512 transcript:FBtr0343015)

HSP 1 Score: 192.586 bits (488), Expect = 2.048e-55
Identity = 89/118 (75.42%), Postives = 103/118 (87.29%), Query Frame = 2
Query:  497 RRH-RTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLG-----MHKKSI 832
            RRH RTIF+SYQLE+LE+ F++AHYPDVY RE+LS+KT+LPEDRIQVWFQNRRAKWRKTE  WG S+IMAEYGLYGAMVRHSLPLP+TI+KSAKD  + + APWLLG     MH+KSI
Sbjct:  230 RRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLPLPDTILKSAKD--NDAVAPWLLGMEQKCMHRKSI 345          
BLAST of Visual system homeobox 2 vs. Ensembl Fly
Match: Vsx1 (gene:FBgn0263511 transcript:FBtr0070781)

HSP 1 Score: 189.119 bits (479), Expect = 2.645e-53
Identity = 88/113 (77.88%), Postives = 99/113 (87.61%), Query Frame = 2
Query:  497 RRH-RTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            RRH RTIF+S QLEELEK F++AHYPDV  RE+LS+KT L EDRIQVW+QNRRAKWRKTE  WG S+ MAEYGLYGAMVRHSLPLPETI+KSAK+  D+S APWLLGMHKKS+
Sbjct:  395 RRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKE--DESVAPWLLGMHKKSL 505          
BLAST of Visual system homeobox 2 vs. Ensembl Fly
Match: Vsx1 (gene:FBgn0263511 transcript:FBtr0340495)

HSP 1 Score: 189.119 bits (479), Expect = 2.645e-53
Identity = 88/113 (77.88%), Postives = 99/113 (87.61%), Query Frame = 2
Query:  497 RRH-RTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            RRH RTIF+S QLEELEK F++AHYPDV  RE+LS+KT L EDRIQVW+QNRRAKWRKTE  WG S+ MAEYGLYGAMVRHSLPLPETI+KSAK+  D+S APWLLGMHKKS+
Sbjct:  395 RRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKE--DESVAPWLLGMHKKSL 505          
BLAST of Visual system homeobox 2 vs. Ensembl Fly
Match: Rx (gene:FBgn0020617 transcript:FBtr0342783)

HSP 1 Score: 102.449 bits (254), Expect = 2.133e-23
Identity = 46/90 (51.11%), Postives = 64/90 (71.11%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANNTESGKKRN----KKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            + Q + SE  +  T+ + + G+  N    K RR+RT F++YQL ELE+ F+ +HYPDVY RE L++K +LPE R+QVWFQNRRAKWR+ E
Sbjct:  529 LNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQE 618          
BLAST of Visual system homeobox 2 vs. Ensembl Zebrafish
Match: vsx1 (visual system homeobox 1 homolog, chx10-like [Source:NCBI gene;Acc:30598])

HSP 1 Score: 214.157 bits (544), Expect = 2.116e-66
Identity = 96/139 (69.06%), Postives = 116/139 (83.45%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            V  DD   + D +   N+ + +KR KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLLGMHKKS+
Sbjct:  126 VYSDDDCLSGDRNDGKNSGNSQKR-KKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKSGMMGSCAPWLLGMHKKSM 263          
BLAST of Visual system homeobox 2 vs. Ensembl Zebrafish
Match: vsx1 (visual system homeobox 1 homolog, chx10-like [Source:NCBI gene;Acc:30598])

HSP 1 Score: 208.764 bits (530), Expect = 2.723e-64
Identity = 96/143 (67.13%), Postives = 116/143 (81.12%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL----GMHKKSI 832
            V  DD   + D +   N+ + +KR KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLL    GMHKKS+
Sbjct:  126 VYSDDDCLSGDRNDGKNSGNSQKR-KKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKSGMMGSCAPWLLGEPAGMHKKSM 267          
BLAST of Visual system homeobox 2 vs. Ensembl Zebrafish
Match: vsx1 (visual system homeobox 1 homolog, chx10-like [Source:NCBI gene;Acc:30598])

HSP 1 Score: 208.764 bits (530), Expect = 2.723e-64
Identity = 96/143 (67.13%), Postives = 116/143 (81.12%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL----GMHKKSI 832
            V  DD   + D +   N+ + +KR KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLL    GMHKKS+
Sbjct:  126 VYSDDDCLSGDRNDGKNSGNSQKR-KKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKSGMMGSCAPWLLGEPAGMHKKSM 267          
BLAST of Visual system homeobox 2 vs. Ensembl Zebrafish
Match: vsx2 (visual system homeobox 2 [Source:NCBI gene;Acc:796163])

HSP 1 Score: 204.912 bits (520), Expect = 1.782e-62
Identity = 88/108 (81.48%), Postives = 100/108 (92.59%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWLLGMHKKS+
Sbjct:  170 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSL 277          
BLAST of Visual system homeobox 2 vs. Ensembl Zebrafish
Match: alx4a (ALX homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-070712-3])

HSP 1 Score: 110.153 bits (274), Expect = 8.613e-27
Identity = 50/88 (56.82%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  410 ASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            + V+   ++ +   S  + TE    + KKRR+RT F+SYQLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E
Sbjct:  147 SGVKSPQQATSELASPLDKTEGESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRE 234          
BLAST of Visual system homeobox 2 vs. Ensembl Xenopus
Match: sema3fl (semaphorin 3F like [Source:Xenbase;Acc:XB-GENE-940271])

HSP 1 Score: 211.846 bits (538), Expect = 2.653e-65
Identity = 95/136 (69.85%), Postives = 114/136 (83.82%), Query Frame = 2
Query:  425 DDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            DD S   D +    + S  KR KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK+G+  SCAPWLLGMHKKS+
Sbjct:  128 DDDSLLGDKNDLKASSSQAKR-KKRRHRTVFTAHQLEELEKAFNEAHYPDVYAREMLALKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKNGLVGSCAPWLLGMHKKSV 262          
BLAST of Visual system homeobox 2 vs. Ensembl Xenopus
Match: VSX2 (visual system homeobox 2 [Source:NCBI gene;Acc:100493176])

HSP 1 Score: 194.897 bits (494), Expect = 2.443e-58
Identity = 89/133 (66.92%), Postives = 103/133 (77.44%), Query Frame = 2
Query:  497 RRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL---------------------GMHKKSI 832
            R  RTIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI +SCAPWLL                     GMHKK++
Sbjct:  147 RSFRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMESCAPWLLVQDGLQMPRRFSKPEYQQFFAGMHKKTL 279          
BLAST of Visual system homeobox 2 vs. Ensembl Xenopus
Match: olfm3 (olfactomedin 3 [Source:Xenbase;Acc:XB-GENE-960616])

HSP 1 Score: 110.538 bits (275), Expect = 1.070e-26
Identity = 54/102 (52.94%), Postives = 68/102 (66.67%), Query Frame = 2
Query:  368 HNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            H  ++   + S   A     D+  + D+   + TES   + KKRR+RT F+SYQLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E
Sbjct:  141 HQGMDSGYITSKETAGKGSQDRG-SGDLPM-DKTESESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRE 240          
BLAST of Visual system homeobox 2 vs. Ensembl Xenopus
Match: ARX (aristaless related homeobox [Source:NCBI gene;Acc:100486727])

HSP 1 Score: 108.612 bits (270), Expect = 1.936e-25
Identity = 46/88 (52.27%), Postives = 64/88 (72.73%), Query Frame = 2
Query:  428 DKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKS 691
            D  ++  +S  +++E G  + K+RR+RT F+SYQLEELE+ FQ  HYPDV+ RE L+++ DL E R+QVWFQNRRAKWRK E    ++
Sbjct:  279 DGEDSVCLSAGSDSEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQT 366          
BLAST of Visual system homeobox 2 vs. Ensembl Xenopus
Match: ALX1 (ALX homeobox 1 [Source:NCBI gene;Acc:100489661])

HSP 1 Score: 105.531 bits (262), Expect = 3.065e-25
Identity = 53/96 (55.21%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  386 NILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            ++  SP  A   + D  E  D   +N + S     KKRRHRT F+S QLEELEK FQ  HYPDVY RE L+++T+L E R+QVWFQNRRAKWRK E
Sbjct:  101 SLAVSPGKAMADKVDLDELGDKCDSNVSSS-----KKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRE 191          
BLAST of Visual system homeobox 2 vs. Ensembl Mouse
Match: Vsx2 (visual system homeobox 2 [Source:MGI Symbol;Acc:MGI:88401])

HSP 1 Score: 206.068 bits (523), Expect = 5.013e-63
Identity = 88/108 (81.48%), Postives = 100/108 (92.59%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWLLGMHKKS+
Sbjct:  153 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSL 260          
BLAST of Visual system homeobox 2 vs. Ensembl Mouse
Match: Vsx1 (visual system homeobox 1 [Source:MGI Symbol;Acc:MGI:1890816])

HSP 1 Score: 198.364 bits (503), Expect = 4.961e-60
Identity = 91/149 (61.07%), Postives = 115/149 (77.18%), Query Frame = 2
Query:  401 PSLASVRQDDKSETSDISTANNTESGKK------RNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKS 829
            P+L S ++ +   TSD  + +  ++  K      + KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L+ KT+LPEDRIQVWFQNRRAKWRK E  WG SS+MAEYGLYGAMVRH +PLP++++ SA D +  SCAPWLLGMHKKS
Sbjct:  134 PALGSQQRSESVSTSDGDSPSEEKNDPKMSLILGKRKKRRHRTVFTAHQLEELEKAFGEAHYPDVYAREMLAAKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSA-DSLQGSCAPWLLGMHKKS 281          
BLAST of Visual system homeobox 2 vs. Ensembl Mouse
Match: Vsx2 (visual system homeobox 2 [Source:MGI Symbol;Acc:MGI:88401])

HSP 1 Score: 194.126 bits (492), Expect = 3.991e-58
Identity = 88/127 (69.29%), Postives = 100/127 (78.74%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWL-------------------LGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWL                   LGMHKKS+
Sbjct:  153 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLVQDGFPRRFSKPEYQQFFLGMHKKSL 279          
BLAST of Visual system homeobox 2 vs. Ensembl Mouse
Match: Alx3 (aristaless-like homeobox 3 [Source:MGI Symbol;Acc:MGI:1277097])

HSP 1 Score: 104.375 bits (259), Expect = 7.879e-27
Identity = 49/73 (67.12%), Postives = 59/73 (80.82%), Query Frame = 2
Query:  470 ESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGK 688
            E  K ++KKRR+RT FS++QLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E  +GK
Sbjct:    2 ELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRER-YGK 73          
BLAST of Visual system homeobox 2 vs. Ensembl Mouse
Match: Alx4 (aristaless-like homeobox 4 [Source:MGI Symbol;Acc:MGI:108359])

HSP 1 Score: 108.612 bits (270), Expect = 1.588e-26
Identity = 50/82 (60.98%), Postives = 60/82 (73.17%), Query Frame = 2
Query:  428 DKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            D++     S    T+S   + KKRR+RT F+SYQLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E
Sbjct:  180 DRASAEIPSPLEKTDSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRE 261          
BLAST of Visual system homeobox 2 vs. UniProt/SwissProt
Match: sp|Q9IAL2|VSX1_CHICK (Visual system homeobox 1 OS=Gallus gallus OX=9031 GN=VSX1 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 6.026e-64
Identity = 95/136 (69.85%), Postives = 113/136 (83.09%), Query Frame = 2
Query:  425 DDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            D+ S + D S      S  KR KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLLGMHKKS+
Sbjct:  135 DEDSLSGDASELKMPASQIKR-KKRRHRTVFTAHQLEELEKAFNEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKSGLVGSCAPWLLGMHKKSM 269          
BLAST of Visual system homeobox 2 vs. UniProt/SwissProt
Match: sp|Q0P031|VSX1_XENLA (Visual system homeobox 1 OS=Xenopus laevis OX=8355 GN=vsx1 PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.353e-63
Identity = 88/120 (73.33%), Postives = 109/120 (90.83%), Query Frame = 2
Query:  473 SGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            S + + KKRRHRT+F+++QL+ELEK+F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK+G+  SCAPWLLGMHKKS+
Sbjct:  143 SAQSKRKKRRHRTVFTAHQLDELEKSFNEAHYPDVYAREMLALKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKNGLVGSCAPWLLGMHKKSV 262          
BLAST of Visual system homeobox 2 vs. UniProt/SwissProt
Match: sp|O42250|VSX1_DANRE (Visual system homeobox 1 OS=Danio rerio OX=7955 GN=vsx1 PE=1 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 2.415e-63
Identity = 96/143 (67.13%), Postives = 116/143 (81.12%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL----GMHKKSI 832
            V  DD   + D +   N+ + +KR KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLL    GMHKKS+
Sbjct:  126 VYSDDDCLSGDRNDGKNSGNSQKR-KKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKSGMMGSCAPWLLGEPAGMHKKSM 267          
BLAST of Visual system homeobox 2 vs. UniProt/SwissProt
Match: sp|Q90277|VSX1_CARAU (Visual system homeobox 1 OS=Carassius auratus OX=7957 GN=vsx1 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.790e-62
Identity = 93/142 (65.49%), Postives = 115/142 (80.99%), Query Frame = 2
Query:  419 RQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL----GMHKKSI 832
            ++D  S+   +S   N     ++ KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK+G+  SCAPWLL    GMHKKS+
Sbjct:  123 QRDAYSDDDCLSGDRNDGKNSQKRKKRRHRTVFTSHQLEELEKAFHEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKNGMMGSCAPWLLGEPAGMHKKSL 264          
BLAST of Visual system homeobox 2 vs. UniProt/SwissProt
Match: sp|Q61412|VSX2_MOUSE (Visual system homeobox 2 OS=Mus musculus OX=10090 GN=Vsx2 PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.507e-62
Identity = 88/108 (81.48%), Postives = 100/108 (92.59%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWLLGMHKKS+
Sbjct:  153 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSL 260          
BLAST of Visual system homeobox 2 vs. TrEMBL
Match: K1P5F1 (Visual system homeobox 2 OS=Crassostrea gigas OX=29159 GN=CGI_10010563 PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.671e-66
Identity = 105/139 (75.54%), Postives = 116/139 (83.45%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            V +   SE     T      GKK+ KKRRHRTIF+SYQLEELEK F+DAHYPDVY RE+L++KT LPEDRIQVWFQNRRAKWRKTE TWG+SSIMAEYGLYGAMVRHSLPLP+TI+KSAKDG+  SCAPWLL MHKKSI
Sbjct:  128 VHEQSSSEKVGYETTEQQTVGKKKKKKRRHRTIFTSYQLEELEKAFKDAHYPDVYAREVLALKTSLPEDRIQVWFQNRRAKWRKTEKTWGRSSIMAEYGLYGAMVRHSLPLPDTILKSAKDGVTNSCAPWLLSMHKKSI 266          
BLAST of Visual system homeobox 2 vs. TrEMBL
Match: A0A444U044 (Visual system homeobox 1 OS=Acipenser ruthenus OX=7906 GN=EOD39_9669 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 5.594e-66
Identity = 97/159 (61.01%), Postives = 123/159 (77.36%), Query Frame = 2
Query:  356 ILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            +L     + P+    P + S  +DD S + D +   N+ + + + KKRRHRT+F++ QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLLGMHKKS+
Sbjct:   43 LLGLETELQPSA--GPGVGSNGEDDDSFSGDTNDLKNSANSQNKRKKRRHRTVFTALQLEELEKAFHEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKTGMMGSCAPWLLGMHKKSL 199          
BLAST of Visual system homeobox 2 vs. TrEMBL
Match: A0A210QXF5 (Visual system homeobox 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10504 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.299e-65
Identity = 113/177 (63.84%), Postives = 135/177 (76.27%), Query Frame = 2
Query:  314 TWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTE----SGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TW  +  N + +++    +   +PN L S     V+   +S  SD  +  N +    S KK+ KKRRHRTIF+SYQLEELEK F++AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRKTE TWG+SSIMAEYGLYGAMVRHSLPLPETI+KSAKDG+  SCAPWLL MHKKSI
Sbjct:  106 TWRSTFINALSSSAQSVFNLGPSPNNLLSKGSDHVKTGLESSYSDKGSLENIDNAGMSSKKKKKKRRHRTIFTSYQLEELEKAFKEAHYPDVYAREVLALKTNLPEDRIQVWFQNRRAKWRKTEKTWGRSSIMAEYGLYGAMVRHSLPLPETILKSAKDGVLDSCAPWLLSMHKKSI 282          
BLAST of Visual system homeobox 2 vs. TrEMBL
Match: W5NJE3 (Visual system homeobox 1 homolog, chx10-like OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 7.687e-65
Identity = 95/136 (69.85%), Postives = 116/136 (85.29%), Query Frame = 2
Query:  425 DDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            DD S + D S A N+ + + + KKRRHRT+F+++QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK G+  SCAPWLLGMHKKS+
Sbjct:  130 DDDSLSGDRSDAKNSANSQNKRKKRRHRTVFTAHQLEELEKAFHEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKSGMMGSCAPWLLGMHKKSL 265          
BLAST of Visual system homeobox 2 vs. TrEMBL
Match: A0A1S3JL42 (visual system homeobox 2 OS=Lingula unguis OX=7574 GN=LOC106174199 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.895e-64
Identity = 110/166 (66.27%), Postives = 128/166 (77.11%), Query Frame = 2
Query:  347 NNSILASHNNINPNILWSPSLASVRQDDKSETSDIS----TANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
               +LA H+  +     S S  S    D  E  D+S    TA    SGKK+ KKRRHRTIF+S Q+EELEK F+DAHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRKTE TWG+SSIMAEYGLYGAMVRHSLPLP++I+KSAK+G+  SCAPWLL MHKKSI
Sbjct:   44 GQGLLAMHHATHAATASSHSGESTSAADCDE--DLSDRHGTAERGTSGKKKKKKRRHRTIFTSQQIEELEKAFKDAHYPDVYAREVLALKTNLPEDRIQVWFQNRRAKWRKTEKTWGRSSIMAEYGLYGAMVRHSLPLPDSILKSAKEGVIDSCAPWLLSMHKKSI 207          
BLAST of Visual system homeobox 2 vs. Ensembl Cavefish
Match: ENSAMXT00000052098.1 (visual system homeobox 1 [Source:NCBI gene;Acc:103029061])

HSP 1 Score: 212.616 bits (540), Expect = 5.727e-66
Identity = 95/135 (70.37%), Postives = 115/135 (85.19%), Query Frame = 2
Query:  428 DKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            D   + D +   N+ + +KR KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK+G+  SCAPWLLGMHKKSI
Sbjct:  121 DDCLSGDRADGKNSANSQKR-KKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKNGMMSSCAPWLLGMHKKSI 254          
BLAST of Visual system homeobox 2 vs. Ensembl Cavefish
Match: ENSAMXT00000011754.2 (visual system homeobox 1 [Source:NCBI gene;Acc:103029061])

HSP 1 Score: 209.534 bits (532), Expect = 6.425e-65
Identity = 96/140 (68.57%), Postives = 116/140 (82.86%), Query Frame = 2
Query:  425 DDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL----GMHKKSI 832
            DD   + D +   N+ + +KR KKRRHRT+F+S+QLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK+G+  SCAPWLL    GMHKKSI
Sbjct:  113 DDDCLSGDRADGKNSANSQKR-KKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIINSAKNGMMSSCAPWLLGEPTGMHKKSI 251          
BLAST of Visual system homeobox 2 vs. Ensembl Cavefish
Match: vsx2 (visual system homeobox 2 [Source:NCBI gene;Acc:796163])

HSP 1 Score: 205.682 bits (522), Expect = 6.179e-63
Identity = 88/108 (81.48%), Postives = 100/108 (92.59%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWLLGMHKKS+
Sbjct:  162 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSL 269          
BLAST of Visual system homeobox 2 vs. Ensembl Cavefish
Match: vsx2 (visual system homeobox 2 [Source:NCBI gene;Acc:796163])

HSP 1 Score: 198.749 bits (504), Expect = 2.189e-60
Identity = 89/122 (72.95%), Postives = 101/122 (82.79%), Query Frame = 2
Query:  506 RTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL-------------GMHKKSI 832
            RTIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAKDGI  SCAPWLL             GMHKKS+
Sbjct:  140 RTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGASLNANPPTLFAGMHKKSL 261          
BLAST of Visual system homeobox 2 vs. Ensembl Cavefish
Match: alx4a (ALX homeobox 4 [Source:NCBI gene;Acc:103046081])

HSP 1 Score: 107.457 bits (267), Expect = 6.064e-26
Identity = 48/74 (64.86%), Postives = 56/74 (75.68%), Query Frame = 2
Query:  452 STANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            S  +  E    + KKRR+RT F+SYQLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E
Sbjct:  159 SPLDKGEGESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRE 232          
BLAST of Visual system homeobox 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007492.1 (pep scaffold:Pmarinus_7.0:GL485433:5888:8937:1 gene:ENSPMAG00000006770.1 transcript:ENSPMAT00000007492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 4.835e-36
Identity = 53/68 (77.94%), Postives = 61/68 (89.71%), Query Frame = 2
Query:  629 QVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            QVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAKDG+  SCAPWLL MH+KS+
Sbjct:    1 QVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILHSAKDGVMDSCAPWLLAMHRKSM 68          
BLAST of Visual system homeobox 2 vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 90.8929 bits (224), Expect = 9.603e-21
Identity = 40/74 (54.05%), Postives = 54/74 (72.97%), Query Frame = 2
Query:  476 GKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSI 697
            G +   +RR RT F++ QLE LEKTFQ  HYPDV  RE L++ T+LPE R+QVWF+NRRAK+RK + +  K ++
Sbjct:   37 GTQHPHQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKETV 110          
BLAST of Visual system homeobox 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 5.032e-15
Identity = 31/58 (53.45%), Postives = 42/58 (72.41%), Query Frame = 2
Query:  491 KKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWR 664
            K+RR RT F+  QL+ LE  F    YPD++ RE +++K +LPE R+QVWF+NRRAK R
Sbjct:    5 KQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of Visual system homeobox 2 vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 60.077 bits (144), Expect = 1.072e-11
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  488 NKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVR 733
             K R+ RT FS +QL +LE++F+   Y  V  R  L+    L + +++ W+QNRR KW++   T      +AE G YGA+ R
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKR--QTAVGLEFLAEAGTYGALQR 82          
BLAST of Visual system homeobox 2 vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 60.077 bits (144), Expect = 1.582e-11
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  488 NKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVR 733
             K R+ RT FS +QL +LE++F+   Y  V  R  L+    L + +++ W+QNRR KW++   T      +AE G YGA+ R
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKR--QTAVGLEFLAEAGTYGALQR 82          
BLAST of Visual system homeobox 2 vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 56.6102 bits (135), Expect = 2.522e-9
Identity = 31/95 (32.63%), Postives = 55/95 (57.89%), Query Frame = 2
Query:  416 VRQDDKSETSDISTANN-TESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSI 697
            +  D    T+D+S ++N ++SG +R K+ R +       L+ L++ F+    P + +R+ +S    +PE  +++WFQNRRAK RK +H   K +I
Sbjct:   54 LEHDHDQHTNDMSASSNASDSGPQRPKRTRAK----GEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSNKDTI 144          
BLAST of Visual system homeobox 2 vs. Ensembl Nematostella
Match: EDO39160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY2])

HSP 1 Score: 177.178 bits (448), Expect = 1.262e-55
Identity = 84/114 (73.68%), Postives = 93/114 (81.58%), Query Frame = 2
Query:  482 KRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHK 823
            K+ KKRRHRTIF++YQLEELEK F+++HYPDVY RE LS+K DLPEDRIQVWFQNRRAKWRK E  WG SSIMAEYGLYGAMVRHSLPLP  +  S+        APWLLGMHK
Sbjct:    1 KKAKKRRHRTIFTNYQLEELEKAFKESHYPDVYARENLSLKIDLPEDRIQVWFQNRRAKWRKKEKCWGHSSIMAEYGLYGAMVRHSLPLPPHLTPSS--------APWLLGMHK 106          
BLAST of Visual system homeobox 2 vs. Ensembl Nematostella
Match: EDO31796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWY2])

HSP 1 Score: 100.908 bits (250), Expect = 1.508e-26
Identity = 48/86 (55.81%), Postives = 60/86 (69.77%), Query Frame = 2
Query:  425 DDKSETSDISTANNTESGK---KRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            DD+    +   +NN   GK    + K+RR+RT F+SYQLEELE+ F   HYPDV+ RE L++K DL E R+QVWFQNRRAKWRK E
Sbjct:    5 DDEKSDEEAVDSNNELEGKDSTAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQNRRAKWRKRE 90          
BLAST of Visual system homeobox 2 vs. Ensembl Nematostella
Match: EDO38926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH9])

HSP 1 Score: 97.8265 bits (242), Expect = 2.401e-24
Identity = 44/72 (61.11%), Postives = 57/72 (79.17%), Query Frame = 2
Query:  458 ANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            +++ +S  KR KKRR+RT F++YQLEE+E+ FQ  HYPDVY RE L+++  L E R+QVWFQNRRAKWRK E
Sbjct:    3 SDSGDSAPKR-KKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQNRRAKWRKRE 73          
BLAST of Visual system homeobox 2 vs. Ensembl Nematostella
Match: EDO42103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G7])

HSP 1 Score: 94.3597 bits (233), Expect = 8.047e-23
Identity = 46/88 (52.27%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  470 ESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVR 733
            E GK R K RR RT F++YQL +LE+ F+   YPDV+ RE L+++ DL E R+QVWFQNRRAKWRK E   G+ S    Y  +G   R
Sbjct:   13 EDGKPR-KVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQVWFQNRRAKWRKREKALGRESPNFMYPGHGGEYR 99          
BLAST of Visual system homeobox 2 vs. Ensembl Nematostella
Match: EDO42147 (Predicted protein; Retinal homeobox [Source:UniProtKB/TrEMBL;Acc:A7S2G8])

HSP 1 Score: 94.7449 bits (234), Expect = 1.951e-22
Identity = 42/90 (46.67%), Postives = 64/90 (71.11%), Query Frame = 2
Query:  416 VRQDDKSETSDIST----ANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            + +DD +  +D+S+    ++  +    + K RR+RT F+++QL ELE+ F+ +HYPDVY RE L++K  LPE R+QVWFQN+RAKWR+ E
Sbjct:   55 LEEDDINSDNDLSSNDGKSDEADGDSSKKKLRRNRTTFTTFQLHELERAFEKSHYPDVYTREELALKISLPEVRVQVWFQNKRAKWRREE 144          
BLAST of Visual system homeobox 2 vs. Ensembl Medaka
Match: vsx1 (visual system homeobox 1 [Source:NCBI gene;Acc:101168145])

HSP 1 Score: 206.838 bits (525), Expect = 2.447e-63
Identity = 95/140 (67.86%), Postives = 118/140 (84.29%), Query Frame = 2
Query:  428 DKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLG-----MHKKSI 832
            D+   SD + + ++ + +KR KKRRHRT+F+S+QLEELEK FQ+AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+ SAK+G+  SCAPWLLG     MHKKS+
Sbjct:  140 DEECLSDRNESKSSGNSQKR-KKRRHRTVFTSHQLEELEKAFQEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILNSAKNGMMGSCAPWLLGEPHARMHKKSL 278          
BLAST of Visual system homeobox 2 vs. Ensembl Medaka
Match: ENSORLT00000041769.1 (visual system homeobox 2 [Source:NCBI gene;Acc:101175530])

HSP 1 Score: 199.519 bits (506), Expect = 1.661e-60
Identity = 87/108 (80.56%), Postives = 99/108 (91.67%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+LSIKT+LPEDRIQVWFQNRRAKWRK E  WG+SS+MAEYGLYGAMVRHS+PLPE+I+KSAK+G+  S APWLLGMHKKS+
Sbjct:  172 TIFTSYQLEELEKAFNEAHYPDVYAREMLSIKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKEGVTDSYAPWLLGMHKKSV 279          
BLAST of Visual system homeobox 2 vs. Ensembl Medaka
Match: vsx2 (visual system homeobox 2 [Source:NCBI gene;Acc:100049516])

HSP 1 Score: 192.971 bits (489), Expect = 9.002e-58
Identity = 87/129 (67.44%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  509 TIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL---------------------GMHKKSI 832
            TIF+SYQLEELEK F +AHYPDVY RE+L++KT+LPEDRIQVWFQNRRAKWRK E  WG+S++MAEYGLYGAMVRHS+PLPE+I+KSAKDGI +SCAPWLL                     GMHKKS+
Sbjct:  167 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSTVMAEYGLYGAMVRHSIPLPESILKSAKDGIMESCAPWLLVQDGLPINRRYSKSEYPQLFAGMHKKSM 295          
BLAST of Visual system homeobox 2 vs. Ensembl Medaka
Match: alx4b (homeobox protein aristaless-like 4 [Source:NCBI gene;Acc:101168948])

HSP 1 Score: 109.768 bits (273), Expect = 8.225e-27
Identity = 54/94 (57.45%), Postives = 65/94 (69.15%), Query Frame = 2
Query:  392 LWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            L  P L    +   SE S  S  + +E+   + KKRR+RT F+SYQLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E
Sbjct:  141 LKEPGLKGSSERPGSELS--SPLDKSEAESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRE 232          
BLAST of Visual system homeobox 2 vs. Ensembl Medaka
Match: alx4a (homeobox protein aristaless-like 4 [Source:NCBI gene;Acc:101165626])

HSP 1 Score: 107.071 bits (266), Expect = 8.083e-26
Identity = 50/84 (59.52%), Postives = 62/84 (73.81%), Query Frame = 2
Query:  428 DKSETSDISTANNTESGKKRNK--KRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            D+    D+++  +   G + NK  KRR+RT F+SYQLEELEK FQ  HYPDVY RE L+++TDL E R+QVWFQNRRAKWRK E
Sbjct:  156 DRPPGHDLASTLDKPDGSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRE 239          
BLAST of Visual system homeobox 2 vs. Planmine SMEST
Match: SMESG000048803.1 (SMESG000048803.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 338/338 (100.00%), Postives = 338/338 (100.00%), Query Frame = 2
Query:   47 MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKESIHERKTTTDETIFHNENPSYYPIFADRQMXXXXXXXXXTWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSIXXXXXXXXXXXXXXXIDNSGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRKCNDINRRESKPLSVENPVDELCD 1060
            MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKESIHERKTTTDETIFHNENPSYYPIFADRQMLAAAANLAATWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSIEASEKLQAAELKEEEIDNSGTENEDEIDEDDENDEEEDGEEEEEDQEGKEFRKCNDINRRESKPLSVENPVDELCD
Sbjct:    1 MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKESIHERKTTTDETIFHNENPSYYPIFADRQMLAAAANLAATWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKKSIEASEKLQAAELKEEEIDNSGTENEDEIDEDDENDEEEDGEEEEEDQEGKEFRKCNDINRRESKPLSVENPVDELCD 338          
BLAST of Visual system homeobox 2 vs. Planmine SMEST
Match: SMESG000048803.1 (SMESG000048803.1)

HSP 1 Score: 486.493 bits (1251), Expect = 1.044e-174
Identity = 256/260 (98.46%), Postives = 257/260 (98.85%), Query Frame = 2
Query:   47 MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKESIHERKTTTDETIFHNENPSYYPIFADRQMXXXXXXXXXTWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLGMHKK 826
            MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKESIHERKTTTDETIFHNENPSYYPIFADRQMLAAAANLAATWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLL +  K
Sbjct:    1 MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKESIHERKTTTDETIFHNENPSYYPIFADRQMLAAAANLAATWTYSMNNNIPNNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSCAPWLLDVASK 260          
BLAST of Visual system homeobox 2 vs. Planmine SMEST
Match: SMESG000033843.1 (SMESG000033843.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.393e-24
Identity = 50/89 (56.18%), Postives = 64/89 (71.91%), Query Frame = 2
Query:  422 QDDKSETSDISTANNTESGKKR----NKK-RRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            +D   ++  IS A+ TES   R    NKK RR+RT F++YQL ELE+ F+ +HYPDVY RE L++K  LPE R+QVWFQNRRAKWR+ E
Sbjct:   61 KDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQE 149          
BLAST of Visual system homeobox 2 vs. Planmine SMEST
Match: SMESG000020038.1 (SMESG000020038.1)

HSP 1 Score: 103.605 bits (257), Expect = 1.772e-24
Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 2
Query:  443 SDISTANNTESGKKRNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTEHTWGKSS 694
            SD  +AN+ E+ KK   KRR+RT FSSYQL+E+E+ FQ  HYPDVY RE L+ +T L E R+QVWFQNRRAKWRK E  W ++S
Sbjct:   51 SDNGSANSEEAKKK---KRRNRTTFSSYQLDEMERIFQKTHYPDVYAREQLAFRTGLSEARVQVWFQNRRAKWRKKE--WFRAS 129          
BLAST of Visual system homeobox 2 vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.115e-22
Identity = 42/63 (66.67%), Postives = 50/63 (79.37%), Query Frame = 2
Query:  485 RNKKRRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQNRRAKWRKTE 673
            R K+RR+RT F+  QLEELEK FQ  HYPDV+ RE L+++  L E R+QVWFQNRRAKWRKTE
Sbjct:   34 RRKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTE 96          
The following BLAST results are available for this feature:
BLAST of Visual system homeobox 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VSX21.288e-6281.48visual system homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
VSX13.881e-6260.67visual system homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
VSX18.349e-5859.44visual system homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
VSX12.442e-5759.44visual system homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
ALX33.158e-2667.12ALX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:449][more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-101.641e-6177.78Homeobox protein ceh-10 [Source:UniProtKB/Swiss-P... [more]
unc-46.909e-2450.54Homeobox protein unc-4 [Source:UniProtKB/Swiss-Pr... [more]
alr-13.520e-2146.94AristaLess (Drosophila homeodomain) Related [Sour... [more]
ceh-172.889e-2059.38C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrE... [more]
ceh-83.028e-1960.66Homeobox protein ceh-8 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vsx28.692e-5878.76gene:FBgn0263512 transcript:FBtr0100024[more]
Vsx22.048e-5575.42gene:FBgn0263512 transcript:FBtr0343015[more]
Vsx12.645e-5377.88gene:FBgn0263511 transcript:FBtr0070781[more]
Vsx12.645e-5377.88gene:FBgn0263511 transcript:FBtr0340495[more]
Rx2.133e-2351.11gene:FBgn0020617 transcript:FBtr0342783[more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vsx12.116e-6669.06visual system homeobox 1 homolog, chx10-like [Sour... [more]
vsx12.723e-6467.13visual system homeobox 1 homolog, chx10-like [Sour... [more]
vsx12.723e-6467.13visual system homeobox 1 homolog, chx10-like [Sour... [more]
vsx21.782e-6281.48visual system homeobox 2 [Source:NCBI gene;Acc:796... [more]
alx4a8.613e-2756.82ALX homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-070712-3... [more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema3fl2.653e-6569.85semaphorin 3F like [Source:Xenbase;Acc:XB-GENE-940... [more]
VSX22.443e-5866.92visual system homeobox 2 [Source:NCBI gene;Acc:100... [more]
olfm31.070e-2652.94olfactomedin 3 [Source:Xenbase;Acc:XB-GENE-960616][more]
ARX1.936e-2552.27aristaless related homeobox [Source:NCBI gene;Acc:... [more]
ALX13.065e-2555.21ALX homeobox 1 [Source:NCBI gene;Acc:100489661][more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vsx25.013e-6381.48visual system homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Vsx14.961e-6061.07visual system homeobox 1 [Source:MGI Symbol;Acc:MG... [more]
Vsx23.991e-5869.29visual system homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Alx37.879e-2767.12aristaless-like homeobox 3 [Source:MGI Symbol;Acc:... [more]
Alx41.588e-2660.98aristaless-like homeobox 4 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Visual system homeobox 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IAL2|VSX1_CHICK6.026e-6469.85Visual system homeobox 1 OS=Gallus gallus OX=9031 ... [more]
sp|Q0P031|VSX1_XENLA1.353e-6373.33Visual system homeobox 1 OS=Xenopus laevis OX=8355... [more]
sp|O42250|VSX1_DANRE2.415e-6367.13Visual system homeobox 1 OS=Danio rerio OX=7955 GN... [more]
sp|Q90277|VSX1_CARAU2.790e-6265.49Visual system homeobox 1 OS=Carassius auratus OX=7... [more]
sp|Q61412|VSX2_MOUSE3.507e-6281.48Visual system homeobox 2 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Visual system homeobox 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1P5F11.671e-6675.54Visual system homeobox 2 OS=Crassostrea gigas OX=2... [more]
A0A444U0445.594e-6661.01Visual system homeobox 1 OS=Acipenser ruthenus OX=... [more]
A0A210QXF52.299e-6563.84Visual system homeobox 2 OS=Mizuhopecten yessoensi... [more]
W5NJE37.687e-6569.85Visual system homeobox 1 homolog, chx10-like OS=Le... [more]
A0A1S3JL422.895e-6466.27visual system homeobox 2 OS=Lingula unguis OX=7574... [more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052098.15.727e-6670.37visual system homeobox 1 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000011754.26.425e-6568.57visual system homeobox 1 [Source:NCBI gene;Acc:103... [more]
vsx26.179e-6381.48visual system homeobox 2 [Source:NCBI gene;Acc:796... [more]
vsx22.189e-6072.95visual system homeobox 2 [Source:NCBI gene;Acc:796... [more]
alx4a6.064e-2664.86ALX homeobox 4 [Source:NCBI gene;Acc:103046081][more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007492.14.835e-3677.94pep scaffold:Pmarinus_7.0:GL485433:5888:8937:1 gen... [more]
dmbx1b9.603e-2154.05diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
ENSPMAT00000010761.15.032e-1553.45pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
barhl21.072e-1137.80BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
barhl21.582e-1137.80BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO22.522e-932.63Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391601.262e-5573.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317961.508e-2655.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389262.401e-2461.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421038.047e-2352.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421471.951e-2246.67Predicted protein; Retinal homeobox [Source:UniPr... [more]
back to top
BLAST of Visual system homeobox 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vsx12.447e-6367.86visual system homeobox 1 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000041769.11.661e-6080.56visual system homeobox 2 [Source:NCBI gene;Acc:101... [more]
vsx29.002e-5867.44visual system homeobox 2 [Source:NCBI gene;Acc:100... [more]
alx4b8.225e-2757.45homeobox protein aristaless-like 4 [Source:NCBI ge... [more]
alx4a8.083e-2659.52homeobox protein aristaless-like 4 [Source:NCBI ge... [more]
back to top
BLAST of Visual system homeobox 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048803.10.000e+0100.00SMESG000048803.1[more]
SMESG000048803.11.044e-17498.46SMESG000048803.1[more]
SMESG000033843.11.393e-2456.18SMESG000033843.1[more]
SMESG000020038.11.772e-2460.71SMESG000020038.1[more]
SMESG000080420.17.115e-2266.67SMESG000080420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010230 ID=SMED30010230|Name=Visual system homeobox 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1083bp
CTTTTATATATAATCGAAATCCTTCCCATCTGGTTTCAGTTGTAAGATGA
CATCGTTCTATAATGTTCATCCTCTAAGTTACACAAACACCTCTGTTTCT
CCTGCCCTGCCAAACAGAAACAGTTTTGCCATCAATCGTATCCTGGAAAT
AGCCTCTCAACCGAATCCTTCAACATTCCTCGATCAAATTAAAGAATCTA
TTCATGAAAGAAAAACCACGACAGATGAAACGATATTTCACAACGAAAAT
CCGTCATATTATCCAATTTTCGCAGATAGGCAAATGCTTGCGGCTGCGGC
AAACTTAGCAGCAACTTGGACCTATTCTATGAATAATAATATCCCAAACA
ACAGTATCCTTGCCTCTCACAATAATATTAATCCCAATATCCTTTGGTCT
CCATCGTTGGCATCTGTACGACAAGACGACAAAAGCGAGACGAGTGACAT
TAGTACTGCGAACAATACAGAATCCGGCAAGAAACGGAACAAAAAACGGA
GACATCGGACAATATTTTCCAGCTATCAGTTGGAAGAGTTGGAAAAAACC
TTCCAAGACGCACACTATCCTGATGTTTATCAACGAGAAATATTGTCAAT
TAAAACAGATCTGCCTGAAGACAGAATCCAGGTTTGGTTCCAAAATCGGA
GAGCTAAGTGGAGGAAAACAGAACACACTTGGGGAAAGTCGAGTATAATG
GCCGAATATGGACTATATGGTGCTATGGTCAGACACTCACTACCACTGCC
AGAAACAATTGTCAAATCTGCTAAAGATGGTATAGATCAATCATGTGCTC
CATGGCTATTGGGAATGCACAAGAAATCAATTGAAGCTTCCGAAAAGCTC
CAGGCAGCGGAGTTAAAAGAAGAAGAAATCGATAATTCTGGAACTGAAAA
TGAAGATGAAATCGACGAGGATGATGAAAATGATGAAGAAGAAGATGGGG
AGGAAGAAGAAGAGGATCAAGAAGGAAAAGAGTTTAGAAAATGTAACGAT
ATCAATAGACGCGAGTCGAAGCCGTTGTCAGTTGAAAATCCTGTAGACGA
ACTCTGTGATTGAATGTATATAGCGTGCAAGAT
back to top

protein sequence of SMED30010230-orf-1

>SMED30010230-orf-1 ID=SMED30010230-orf-1|Name=SMED30010230-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MTSFYNVHPLSYTNTSVSPALPNRNSFAINRILEIASQPNPSTFLDQIKE
SIHERKTTTDETIFHNENPSYYPIFADRQMLAAAANLAATWTYSMNNNIP
NNSILASHNNINPNILWSPSLASVRQDDKSETSDISTANNTESGKKRNKK
RRHRTIFSSYQLEELEKTFQDAHYPDVYQREILSIKTDLPEDRIQVWFQN
RRAKWRKTEHTWGKSSIMAEYGLYGAMVRHSLPLPETIVKSAKDGIDQSC
APWLLGMHKKSIEASEKLQAAELKEEEIDNSGTENEDEIDEDDENDEEED
GEEEEEDQEGKEFRKCNDINRRESKPLSVENPVDELCD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
IPR023339CVC
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 150..212
e-value: 2.1E-25
score: 100.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 151..207
e-value: 5.2E-22
score: 77.4
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 148..208
score: 19.694
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 155..209
e-value: 5.54686E-20
score: 80.3652
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 135..211
e-value: 1.0E-28
score: 100.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 127..152
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 271..338
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 279..307
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..329
NoneNo IPR availablePANTHERPTHR46892FAMILY NOT NAMEDcoord: 113..297
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 183..206
IPR023339CVC domainPROSITEPS51496CVCcoord: 210..263
score: 23.037
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 136..208