FKBP2

Overview
NameFKBP2 (AHD24726.1)
Smed IDSMED30010222
Length (bp)791
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FKBP2 (SMED30010222) t-SNE clustered cells

Violin plots show distribution of expression levels for FKBP2 (SMED30010222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FKBP2 (SMED30010222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FKBP2 (SMED30010222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30010222SMESG000026974.1 SmedASXL_018894SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30010222SMESG000026974.1 dd_Smed_v4_1536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010222SMESG000026974.1 dd_Smed_v4_1536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010222SMESG000026974.1 dd_Smed_v4_1536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010222SMESG000026974.1 dd_Smed_v6_1536_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FKBP2 vs. Ensembl Human
Match: FKBP2 (FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HGNC:3718])

HSP 1 Score: 160.999 bits (406), Expect = 2.369e-49
Identity = 79/142 (55.63%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            F   ++  I L  +  +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+R+EL
Sbjct:    6 FRVLTVLSICLSAVATATGAEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 142          
BLAST of FKBP2 vs. Ensembl Human
Match: FKBP2 (FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HGNC:3718])

HSP 1 Score: 160.999 bits (406), Expect = 2.369e-49
Identity = 79/142 (55.63%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            F   ++  I L  +  +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+R+EL
Sbjct:    6 FRVLTVLSICLSAVATATGAEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 142          
BLAST of FKBP2 vs. Ensembl Human
Match: FKBP2 (FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HGNC:3718])

HSP 1 Score: 160.999 bits (406), Expect = 2.369e-49
Identity = 79/142 (55.63%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            F   ++  I L  +  +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+R+EL
Sbjct:    6 FRVLTVLSICLSAVATATGAEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 142          
BLAST of FKBP2 vs. Ensembl Human
Match: AP001453.5 (Uncharacterized protein LOC114841035 [Source:NCBI gene;Acc:114841035])

HSP 1 Score: 160.999 bits (406), Expect = 2.369e-49
Identity = 79/142 (55.63%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            F   ++  I L  +  +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+R+EL
Sbjct:    6 FRVLTVLSICLSAVATATGAEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 142          
BLAST of FKBP2 vs. Ensembl Human
Match: FKBP2 (FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HGNC:3718])

HSP 1 Score: 161.77 bits (408), Expect = 2.765e-49
Identity = 79/142 (55.63%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            F   ++  I L  +  +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+R+EL
Sbjct:   35 FRVLTVLSICLSAVATATGAEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 171          
BLAST of FKBP2 vs. Ensembl Celegans
Match: fkb-1 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q20107])

HSP 1 Score: 150.599 bits (379), Expect = 8.529e-46
Identity = 71/139 (51.08%), Postives = 97/139 (69.78%), Query Frame = 1
Query:  202 AFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSE 618
            A  + ++ L  I Y+ + +     I++L+IG+KKR  +C +K++ GD +HMHYTGTL D G++FDSS  R +   FTLG G VIKGWD G+  MCVGE+R L IP HLGYG+ G+PPKIP  + L F+VELMKI++  E
Sbjct:    4 AVIVGLLCLLAIAYAADEQK----IDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLD-GTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELMKIDRDGE 137          
BLAST of FKBP2 vs. Ensembl Celegans
Match: fkb-1 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q20107])

HSP 1 Score: 150.599 bits (379), Expect = 8.529e-46
Identity = 71/139 (51.08%), Postives = 97/139 (69.78%), Query Frame = 1
Query:  202 AFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSE 618
            A  + ++ L  I Y+ + +     I++L+IG+KKR  +C +K++ GD +HMHYTGTL D G++FDSS  R +   FTLG G VIKGWD G+  MCVGE+R L IP HLGYG+ G+PPKIP  + L F+VELMKI++  E
Sbjct:    4 AVIVGLLCLLAIAYAADEQK----IDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLD-GTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELMKIDRDGE 137          
BLAST of FKBP2 vs. Ensembl Celegans
Match: fkb-1 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q20107])

HSP 1 Score: 150.599 bits (379), Expect = 8.529e-46
Identity = 71/139 (51.08%), Postives = 97/139 (69.78%), Query Frame = 1
Query:  202 AFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSE 618
            A  + ++ L  I Y+ + +     I++L+IG+KKR  +C +K++ GD +HMHYTGTL D G++FDSS  R +   FTLG G VIKGWD G+  MCVGE+R L IP HLGYG+ G+PPKIP  + L F+VELMKI++  E
Sbjct:    4 AVIVGLLCLLAIAYAADEQK----IDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTLLD-GTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELMKIDRDGE 137          
BLAST of FKBP2 vs. Ensembl Celegans
Match: fkb-1 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q20107])

HSP 1 Score: 113.62 bits (283), Expect = 5.172e-32
Identity = 55/89 (61.80%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  352 MHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSE 618
            MHYTGTL D G++FDSS  R +   FTLG G VIKGWD G+  MCVGE+R L IP HLGYG+ G+PPKIP  + L F+VELMKI++  E
Sbjct:    1 MHYTGTLLD-GTEFDSSRTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELMKIDRDGE 88          
BLAST of FKBP2 vs. Ensembl Celegans
Match: fkb-2 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U2Q8])

HSP 1 Score: 107.842 bits (268), Expect = 1.168e-29
Identity = 56/108 (51.85%), Postives = 71/108 (65.74%), Query Frame = 1
Query:  289 IGIKKRI---NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +G+ ++I    D   K K+G  +  HY  TL ++G K DSS DRG P KF +G G+VIKGWD G+  M VGEK KL I + LGYG  G PP+IP  ATLVFEVEL+ +
Sbjct:    1 MGVDRQILVEGDNVTKPKNGQTVTCHYVLTL-ENGKKIDSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSVGEKSKLTISADLGYGPRGVPPQIPANATLVFEVELLGV 107          
BLAST of FKBP2 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0342897)

HSP 1 Score: 136.732 bits (343), Expect = 2.383e-39
Identity = 64/108 (59.26%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  280 ELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +L++ +      C +K+K+GD + MHYTGTL  DG KFDSS DR  P  F LG GQVIKGWD G+  MCVGEKRKL IP  LGYGD G+   IPPKATL+F+VEL+ I
Sbjct:   25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132          
BLAST of FKBP2 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0071703)

HSP 1 Score: 136.732 bits (343), Expect = 2.383e-39
Identity = 64/108 (59.26%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  280 ELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +L++ +      C +K+K+GD + MHYTGTL  DG KFDSS DR  P  F LG GQVIKGWD G+  MCVGEKRKL IP  LGYGD G+   IPPKATL+F+VEL+ I
Sbjct:   25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132          
BLAST of FKBP2 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0342896)

HSP 1 Score: 136.732 bits (343), Expect = 2.383e-39
Identity = 64/108 (59.26%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  280 ELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +L++ +      C +K+K+GD + MHYTGTL  DG KFDSS DR  P  F LG GQVIKGWD G+  MCVGEKRKL IP  LGYGD G+   IPPKATL+F+VEL+ I
Sbjct:   25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132          
BLAST of FKBP2 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0300397)

HSP 1 Score: 136.732 bits (343), Expect = 2.383e-39
Identity = 64/108 (59.26%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  280 ELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +L++ +      C +K+K+GD + MHYTGTL  DG KFDSS DR  P  F LG GQVIKGWD G+  MCVGEKRKL IP  LGYGD G+   IPPKATL+F+VEL+ I
Sbjct:   25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132          
BLAST of FKBP2 vs. Ensembl Fly
Match: Fkbp14 (gene:FBgn0010470 transcript:FBtr0306013)

HSP 1 Score: 136.732 bits (343), Expect = 2.575e-39
Identity = 64/108 (59.26%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  280 ELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +L++ +      C +K+K+GD + MHYTGTL  DG KFDSS DR  P  F LG GQVIKGWD G+  MCVGEKRKL IP  LGYGD G+   IPPKATL+F+VEL+ I
Sbjct:   25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132          
BLAST of FKBP2 vs. Ensembl Zebrafish
Match: fkbp2 (FKBP prolyl isomerase 2 [Source:ZFIN;Acc:ZDB-GENE-040912-126])

HSP 1 Score: 160.614 bits (405), Expect = 1.652e-49
Identity = 80/144 (55.56%), Postives = 104/144 (72.22%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            +N L     + +   +V   E K       +L+IGIKKR+++C  K++ GD+++MHYTG L +DG++FDSS+ R  P  FTLGTGQVIKGWD G+ GMC GEKRKL IPS LGYGD G+PPKIP  ATL+FEVEL+ IE+RS+L
Sbjct:    3 LNLLLAVTLVSIPMALVQGAEKK-------KLQIGIKKRVDNCPIKSRKGDVLNMHYTGKL-EDGTEFDSSIPRNQPFTFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGDRGAPPKIPGGATLIFEVELLNIERRSDL 138          
BLAST of FKBP2 vs. Ensembl Zebrafish
Match: fkbp7 (FKBP prolyl isomerase 7 [Source:ZFIN;Acc:ZDB-GENE-030616-182])

HSP 1 Score: 109.383 bits (272), Expect = 1.086e-28
Identity = 61/143 (42.66%), Postives = 87/143 (60.84%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINE-LRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSS--LDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            + FL F   +IL  Q +Y   +       NE ++I +     +C++KAK GDM++ HY G L  DGS+F  S   ++G P  F LG G +IKG D+ +Q MC GEKRK+ IP  L YG+ G+ P +PP AT++FEVEL+ I +
Sbjct:    6 LRFL-FYFCLILSLQALYPFITIIRANETNEDVKIEVTFLPENCSQKAKRGDMLNAHYDGFLAKDGSQFYCSRTTEKGHPHWFVLGVGNIIKGLDVALQDMCPGEKRKVTIPPSLAYGEKGNGP-VPPNATVIFEVELLHISR 146          
BLAST of FKBP2 vs. Ensembl Zebrafish
Match: fkbp14 (FKBP prolyl isomerase 14 [Source:ZFIN;Acc:ZDB-GENE-040801-210])

HSP 1 Score: 103.99 bits (258), Expect = 1.003e-26
Identity = 55/116 (47.41%), Postives = 77/116 (66.38%), Query Frame = 1
Query:  262 TKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGD--PLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
             K P  E++I +  +   C  K+K GD++ +HY G L  +G+ F SS  +GD  P+ FTLG  +VIKGWD G+Q MC GEKRKL IP  L YG  G   KIPP++TL+F++E+++I
Sbjct:   20 AKLPEPEVKIEVLYKPFLCHRKSKYGDILLVHYDGFLESNGTMFHSSRHQGDKNPVWFTLGIREVIKGWDKGLQNMCAGEKRKLTIPPALAYGKEGK-GKIPPESTLIFDIEIIEI 134          
BLAST of FKBP2 vs. Ensembl Zebrafish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-514])

HSP 1 Score: 103.605 bits (257), Expect = 7.036e-25
Identity = 49/87 (56.32%), Postives = 59/87 (67.82%), Query Frame = 1
Query:  337 GDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELM 597
            GD + +HY GTL D GS+FDSS DRG+   F LG GQVIK WD+G+  M +GE  +L       YG  GSPPKIPP ATL+F+VEL 
Sbjct:   45 GDKVFVHYVGTLLD-GSQFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGEICQLTCKPEYAYGAAGSPPKIPPNATLLFQVELF 130          
BLAST of FKBP2 vs. Ensembl Zebrafish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-514])

HSP 1 Score: 103.219 bits (256), Expect = 7.338e-25
Identity = 49/87 (56.32%), Postives = 59/87 (67.82%), Query Frame = 1
Query:  337 GDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELM 597
            GD + +HY GTL D GS+FDSS DRG+   F LG GQVIK WD+G+  M +GE  +L       YG  GSPPKIPP ATL+F+VEL 
Sbjct:   45 GDKVFVHYVGTLLD-GSQFDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGEICQLTCKPEYAYGAAGSPPKIPPNATLLFQVELF 130          
BLAST of FKBP2 vs. Ensembl Xenopus
Match: fkbp2 (FKBP prolyl isomerase 2 [Source:NCBI gene;Acc:100135178])

HSP 1 Score: 168.318 bits (425), Expect = 2.926e-52
Identity = 82/144 (56.94%), Postives = 108/144 (75.00%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            MNF++F+   +  F +++   S S  +   +L+IG+KKR+ +C  K++ GD +HMHYTG L +DG++FDSS+ R     FTLGTGQVIKGWD G+ GMC GEKRKL IPS LGYGD G+PPKIP  ATL+FEVEL+KIE+RS+L
Sbjct:    1 MNFMSFTP--LWCFLVLFLLPSVSASEGRKKLQIGVKKRVENCLVKSRKGDTLHMHYTGKL-EDGTEFDSSIPRNQAFTFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGDRGAPPKIPGGATLIFEVELVKIERRSDL 141          
BLAST of FKBP2 vs. Ensembl Xenopus
Match: FKBP11 (FKBP prolyl isomerase 11 [Source:NCBI gene;Acc:100491273])

HSP 1 Score: 109.768 bits (273), Expect = 1.479e-28
Identity = 58/122 (47.54%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  244 SEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            +E  +   + + EL +   ++ + CTE A  GD IH+HYTG L +DG   DSSL R DPL   LG  QVI G +  + GMCVGEKRK+ IP H+ YG  G PP IP  A L FE E+M + K
Sbjct:   46 AETPEEESENVTELVVETVEKPDSCTETADMGDTIHLHYTGRL-EDGRIIDSSLSR-DPLVVELGKKQVIPGLEKSLVGMCVGEKRKMVIPPHMAYGKRGYPPSIPGDAVLQFETEVMALFK 165          
BLAST of FKBP2 vs. Ensembl Xenopus
Match: setd7 (SET domain containing (lysine methyltransferase) 7 [Source:Xenbase;Acc:XB-GENE-949196])

HSP 1 Score: 105.531 bits (262), Expect = 4.058e-27
Identity = 53/113 (46.90%), Postives = 77/113 (68.14%), Query Frame = 1
Query:  271 PINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSL--DRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            P  E++I + ++   C  K+K+GD++ +H  G L  +GS+F S+   + G P+ FTLG  +VIKGWD G+Q MCVGEKRKL +P  L YG  G   KIPP++TL+F ++LM+I
Sbjct:   18 PEPEVQIQVLEKPFICRRKSKNGDLLLVHAEGFLEKNGSRFHSTYKENNGQPVWFTLGIREVIKGWDKGLQDMCVGEKRKLIVPPALAYGKEGK-GKIPPESTLIFNIDLMEI 129          
BLAST of FKBP2 vs. Ensembl Xenopus
Match: tub (TUB bipartite transcription factor [Source:Xenbase;Acc:XB-GENE-962281])

HSP 1 Score: 100.523 bits (249), Expect = 4.195e-25
Identity = 58/142 (40.85%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGD--PLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            + FL F  + ILL   V+S E K+  +   +++I +    ++C +K+K GD+++ HY   L  + +K   S    D  P  F LG GQVIKG D+ +  MC GEKRK  IP  L YG  G   KIPP ATL+FE+EL  I +
Sbjct:    5 LTFLCFLQAFILL--TVFSAEQKTDNEE-EQVKIEVLHLPSECKQKSKKGDLVNAHYDAFLAHNMTKLYCSRSSADGHPKWFVLGVGQVIKGLDMALMDMCSGEKRKAIIPPSLAYGQRGH-DKIPPNATLIFEIELYGITR 142          
BLAST of FKBP2 vs. Ensembl Xenopus
Match: fkbp1b (FKBP prolyl isomerase 1B [Source:NCBI gene;Acc:100125114])

HSP 1 Score: 91.2781 bits (225), Expect = 8.037e-23
Identity = 45/92 (48.91%), Postives = 59/92 (64.13%), Query Frame = 1
Query:  331 KDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            K G    +HYTG L  +G KFDSS DR  P KF +G  +VIKGW+ G+  M +G++ KL     + YG  G P  IPP ATL+F+VEL++IE
Sbjct:   18 KKGQTCVVHYTGML-QNGRKFDSSRDRNKPFKFKIGRQEVIKGWEEGVAQMSLGQRAKLTCSPDVAYGATGHPGVIPPNATLIFDVELIRIE 108          
BLAST of FKBP2 vs. Ensembl Mouse
Match: Fkbp2 (FK506 binding protein 2 [Source:MGI Symbol;Acc:MGI:95542])

HSP 1 Score: 161.77 bits (408), Expect = 6.698e-50
Identity = 80/136 (58.82%), Postives = 104/136 (76.47%), Query Frame = 1
Query:  217 IILLFQIVYSEESKST-KKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            I+ +  I  S  + +T  +   +L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+RSEL
Sbjct:    6 ILTILSICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL 140          
BLAST of FKBP2 vs. Ensembl Mouse
Match: Fkbp2 (FK506 binding protein 2 [Source:MGI Symbol;Acc:MGI:95542])

HSP 1 Score: 161.77 bits (408), Expect = 6.698e-50
Identity = 80/136 (58.82%), Postives = 104/136 (76.47%), Query Frame = 1
Query:  217 IILLFQIVYSEESKST-KKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            I+ +  I  S  + +T  +   +L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+RSEL
Sbjct:    6 ILTILSICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL 140          
BLAST of FKBP2 vs. Ensembl Mouse
Match: Fkbp7 (FK506 binding protein 7 [Source:MGI Symbol;Acc:MGI:1336879])

HSP 1 Score: 107.842 bits (268), Expect = 5.297e-28
Identity = 57/143 (39.86%), Postives = 83/143 (58.04%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSL--DRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNG-SPPKIPPKATLVFEVELMKIEK 609
            MN L F +++ L        + ++ ++   E++I +  R  +C++ ++ GD+++ HY G L  DGSKF  S   D G P  F LG G VIKG D+ +  MC GEKRK+ IP    YG  G +  KIPP ATL+FE+EL  + K
Sbjct:    1 MNLL-FRLAVFLSLWCCSDAQGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSFAYGKEGYAEGKIPPNATLMFEIELYAVTK 142          
BLAST of FKBP2 vs. Ensembl Mouse
Match: Fkbp14 (FK506 binding protein 14 [Source:MGI Symbol;Acc:MGI:2387639])

HSP 1 Score: 105.145 bits (261), Expect = 4.758e-27
Identity = 60/140 (42.86%), Postives = 88/140 (62.86%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSL--DRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            M F  ++ +I+ L+  V S        P  E++I + ++   C  K K GD++ +HY G L  DGS F S+   + G P+ FTLG  +V+KGWD G++GMCVGEKRKL +P  LGYG  G   KIPP++TL+F ++L++I
Sbjct:    1 MRFFLWN-AILALWVTVLS----GALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLTVPPALGYGKEGK-GKIPPESTLIFNIDLLEI 134          
BLAST of FKBP2 vs. Ensembl Mouse
Match: Fkbp11 (FK506 binding protein 11 [Source:MGI Symbol;Acc:MGI:1913370])

HSP 1 Score: 104.375 bits (259), Expect = 6.601e-27
Identity = 54/124 (43.55%), Postives = 74/124 (59.68%), Query Frame = 1
Query:  235 IVYSEESKSTKKPINELRI-GIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +  +E    T+ P+  L++  + +    CTE A  GD +H+HYTG+L D G   D+SL R DPL   LG  QVI G +  +  MCVGEKR+  IPSHL YG  G PP IP  A + ++VEL+ +
Sbjct:   22 VCRAEAGPETESPVRTLQVETLVQPPESCTESAAIGDTLHIHYTGSLVD-GRIIDTSLTR-DPLVIELGQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIAL 143          
BLAST of FKBP2 vs. UniProt/SwissProt
Match: sp|P45878|FKBP2_MOUSE (Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Mus musculus OX=10090 GN=Fkbp2 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.685e-49
Identity = 80/136 (58.82%), Postives = 104/136 (76.47%), Query Frame = 1
Query:  217 IILLFQIVYSEESKST-KKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            I+ +  I  S  + +T  +   +L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+RSEL
Sbjct:    6 ILTILSICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL 140          
BLAST of FKBP2 vs. UniProt/SwissProt
Match: sp|Q32PA9|FKBP2_BOVIN (Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Bos taurus OX=9913 GN=FKBP2 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 8.417e-49
Identity = 80/140 (57.14%), Postives = 105/140 (75.00%), Query Frame = 1
Query:  202 AFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
              ++  I L  +V +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+RSEL
Sbjct:    6 VLTVLSICLSALVTATGTEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL 140          
BLAST of FKBP2 vs. UniProt/SwissProt
Match: sp|P26885|FKBP2_HUMAN (Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 1.138e-48
Identity = 79/142 (55.63%), Postives = 105/142 (73.94%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            F   ++  I L  +  +  ++  +K    L+IG+KKR++ C  K++ GD++HMHYTG L +DG++FDSSL +  P  F+LGTGQVIKGWD G+ GMC GEKRKL IPS LGYG+ G+PPKIP  ATLVFEVEL+KIE+R+EL
Sbjct:    6 FRVLTVLSICLSAVATATGAEGKRK----LQIGVKKRVDHCPIKSRKGDVLHMHYTGKL-EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 142          
BLAST of FKBP2 vs. UniProt/SwissProt
Match: sp|P0C1J5|FKB2B_RHIO9 (FK506-binding protein 2B OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=FKBP3 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 6.328e-47
Identity = 74/134 (55.22%), Postives = 98/134 (73.13%), Query Frame = 1
Query:  211 ISIILLFQIVYSEESKSTKKPINELRIGIKKRI--NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
             S++ L   + +    + K+P  +L++G+KKRI  ++CT K+  GD + MHYTGTL+D G KFDSSLDR +P  FTLG GQVI+GWD G+ GMCVGEKR+L IP HLGYG+ G+   IP  ATLVFEVEL++I+
Sbjct:    3 FSLLALLGTIVATSVSALKEPPTQLQVGVKKRIPASECTRKSHSGDELSMHYTGTLFDTGEKFDSSLDRNEPFVFTLGAGQVIQGWDQGLLGMCVGEKRRLVIPPHLGYGERGAGGVIPGGATLVFEVELLEIK 136          
BLAST of FKBP2 vs. UniProt/SwissProt
Match: sp|P0CP96|FKBP2_CRYNJ (FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=FPR2 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.246e-46
Identity = 77/138 (55.80%), Postives = 94/138 (68.12%), Query Frame = 1
Query:  199 LAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKR 612
            L FS+S+IL              K   +L+IG+K    +C  K++ GD + MHYTGTL  DGSKFDSSLDR  P +FTLG GQVIKGWD G+  MC+ EKRKL IPSHL YG+ G PP IPP++TLVFEVEL+ I+ R
Sbjct:   11 LLFSLSLIL------------AAKSAEQLQIGVKYVPEECPVKSRKGDRLSMHYTGTLAKDGSKFDSSLDRNRPFEFTLGAGQVIKGWDQGLLDMCISEKRKLTIPSHLAYGERGHPPVIPPQSTLVFEVELLGIKNR 136          
BLAST of FKBP2 vs. TrEMBL
Match: V9XTD9 (Peptidylprolyl isomerase (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 7.411e-86
Identity = 127/127 (100.00%), Postives = 127/127 (100.00%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKA 570
            MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKA
Sbjct:    1 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKA 127          
BLAST of FKBP2 vs. TrEMBL
Match: A0A224XZI3 (Peptidylprolyl isomerase OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.738e-52
Identity = 91/144 (63.19%), Postives = 111/144 (77.08%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            MN++  SI ++LL   V S  S+ TK  + +L+IGIKKRI++CT K+  GD++HMHYTG L +DG+ FDSSLDR  PL FTLG+GQVIKGWD G+ GMC GEKRKL IPS L YG  GSPPKIP  ATL+FEVEL+KIEK+ EL
Sbjct:    1 MNYIVLSIPLLLLNLNVDSVHSE-TKAQVKKLQIGIKKRIDNCTVKSTKGDLLHMHYTGKL-EDGTVFDSSLDRNQPLTFTLGSGQVIKGWDQGLMGMCEGEKRKLVIPSDLAYGSRGSPPKIPADATLIFEVELVKIEKKDEL 142          
BLAST of FKBP2 vs. TrEMBL
Match: A0A267FUD8 (Peptidylprolyl isomerase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012825g1 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.864e-52
Identity = 87/149 (58.39%), Postives = 107/149 (71.81%), Query Frame = 1
Query:  181 FPEMNFLAFSI---SIILLFQIVYSEESKSTKKPINELRIGIKKRI--NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKR 612
             P    LA ++   S  LL  I +++     KK + ELRIG+KKR+   +CT +A  GD + MHYTGTLY DGSKFDSSLDR  P KFTLG GQVIKGWD G+ GMC GEKR+L IP+HLGYG++GSPPKIP  + LVFEVEL+ IE++
Sbjct:    6 MPRQFALALAVGLASCCLLADIAFAD---GQKKEVKELRIGVKKRVPAEECTARAAKGDTVSMHYTGTLYSDGSKFDSSLDRNQPFKFTLGVGQVIKGWDQGLIGMCKGEKRRLVIPAHLGYGESGSPPKIPGNSALVFEVELLDIERK 151          
BLAST of FKBP2 vs. TrEMBL
Match: A0A1I8I794 (Peptidylprolyl isomerase OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.837e-52
Identity = 87/149 (58.39%), Postives = 107/149 (71.81%), Query Frame = 1
Query:  181 FPEMNFLAFSI---SIILLFQIVYSEESKSTKKPINELRIGIKKRI--NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKR 612
             P    LA ++   S  LL  I +++     KK + ELRIG+KKR+   +CT +A  GD + MHYTGTLY DGSKFDSSLDR  P KFTLG GQVIKGWD G+ GMC GEKR+L IP+HLGYG++GSPPKIP  + LVFEVEL+ IE++
Sbjct:   10 MPRQFALALAVGLASCCLLADIAFAD---GQKKEVKELRIGVKKRVPAEECTARAAKGDTVSMHYTGTLYSDGSKFDSSLDRNQPFKFTLGVGQVIKGWDQGLIGMCKGEKRRLVIPAHLGYGESGSPPKIPGNSALVFEVELLDIERK 155          
BLAST of FKBP2 vs. TrEMBL
Match: A0A161MBF5 (Peptidylprolyl isomerase OS=Triatoma infestans OX=30076 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 4.726e-52
Identity = 90/144 (62.50%), Postives = 111/144 (77.08%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            MN++ FSI ++LL   + S   + TK  + +L+IGIKKRI++CT K+  GD++HMHYTG L +DG+ FDSSLDR  PL FTLG+GQVIKGWD G+ GMC GEKRKL IPS L YG  GSPPKIP  ATL+FEVEL+KIEK+ EL
Sbjct:    1 MNYIVFSIPLLLLNLNIDSVHCE-TKSQVKKLQIGIKKRIDNCTVKSTKGDLLHMHYTGKL-EDGTVFDSSLDRSQPLTFTLGSGQVIKGWDQGLMGMCEGEKRKLVIPSDLAYGSRGSPPKIPAGATLIFEVELVKIEKKDEL 142          
BLAST of FKBP2 vs. Ensembl Cavefish
Match: fkbp2 (FKBP prolyl isomerase 2 [Source:NCBI gene;Acc:103047465])

HSP 1 Score: 164.466 bits (415), Expect = 3.813e-51
Identity = 80/143 (55.94%), Postives = 110/143 (76.92%), Query Frame = 1
Query:  196 FLAFSISII-LLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            ++  ++++I LL ++V+  E K       +L+IGIKKR+++C  K++ GD+++MHYTG L +DG++FDSS+ R  P  FTLGTGQVIKGWD G+ GMC GEKRKL IPS LGYGD G+PPKIP  ATL+FEVEL+ IE+R++L
Sbjct:    4 YILLAVTLISLLTEVVHGAEKK-------KLQIGIKKRVDNCPIKSRKGDVLNMHYTGKL-EDGTEFDSSIPRNQPFTFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGDRGAPPKIPGGATLIFEVELLSIERRADL 138          
BLAST of FKBP2 vs. Ensembl Cavefish
Match: fkbp7 (FKBP prolyl isomerase 7 [Source:ZFIN;Acc:ZDB-GENE-030616-182])

HSP 1 Score: 104.76 bits (260), Expect = 5.136e-27
Identity = 50/113 (44.25%), Postives = 76/113 (67.26%), Query Frame = 1
Query:  277 NELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKF--DSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            + ++I +  +  +C++K+K GD+++ HY G L  DGS+F    S  RG+P  F LG G+VIKG DLG++ MC GEKRK+ +P  L +G  G  P +PP +T++FEVEL+ I +
Sbjct:   33 DSVQIQVVFKPENCSQKSKRGDLLNAHYDGFLQQDGSQFYCSRSAKRGEPHWFVLGVGEVIKGLDLGLKDMCPGEKRKITVPPSLAFGAQGKHP-VPPNSTVIFEVELLHIRR 144          
BLAST of FKBP2 vs. Ensembl Cavefish
Match: fkbp7 (FKBP prolyl isomerase 7 [Source:ZFIN;Acc:ZDB-GENE-030616-182])

HSP 1 Score: 104.76 bits (260), Expect = 5.951e-27
Identity = 50/113 (44.25%), Postives = 76/113 (67.26%), Query Frame = 1
Query:  277 NELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKF--DSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            + ++I +  +  +C++K+K GD+++ HY G L  DGS+F    S  RG+P  F LG G+VIKG DLG++ MC GEKRK+ +P  L +G  G  P +PP +T++FEVEL+ I +
Sbjct:   36 DSVQIQVVFKPENCSQKSKRGDLLNAHYDGFLQQDGSQFYCSRSAKRGEPHWFVLGVGEVIKGLDLGLKDMCPGEKRKITVPPSLAFGAQGKHP-VPPNSTVIFEVELLHIRR 147          
BLAST of FKBP2 vs. Ensembl Cavefish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:103045630])

HSP 1 Score: 105.531 bits (262), Expect = 9.229e-26
Identity = 50/95 (52.63%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  319 TEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            TE    GD + +HY GTL D G++FDSS DRG+   F LG GQVIK WD+G+  M +GE  +LF      YG  GSPPKIPP +TL+F+VEL + 
Sbjct:   39 TELPMTGDKVFVHYVGTLLD-GTQFDSSRDRGEKFSFELGKGQVIKAWDIGVATMRIGEICQLFCKPEYAYGAAGSPPKIPPNSTLIFQVELFEF 132          
BLAST of FKBP2 vs. Ensembl Cavefish
Match: fkbp1aa (peptidyl-prolyl cis-trans isomerase FKBP1A [Source:NCBI gene;Acc:103030299])

HSP 1 Score: 92.4337 bits (228), Expect = 1.445e-23
Identity = 47/99 (47.47%), Postives = 60/99 (60.61%), Query Frame = 1
Query:  310 NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
             D +   K G    +HY G+L  DG KFDSS DRG P KF +G  +VI+GWD G+  M VG++ KL       YG  G P  IPP ATL+F+VEL+ +E
Sbjct:   11 GDGSTFPKKGQTCVVHYVGSL-TDGRKFDSSRDRGKPFKFKIGKQEVIRGWDEGVAQMSVGQRAKLTCTPDFAYGSKGHPGIIPPNATLIFDVELLGLE 108          
BLAST of FKBP2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004854.1 (pep scaffold:Pmarinus_7.0:GL501075:9618:21951:-1 gene:ENSPMAG00000004388.1 transcript:ENSPMAT00000004854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 1.978e-51
Identity = 81/142 (57.04%), Postives = 104/142 (73.24%), Query Frame = 1
Query:  196 FLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
             L   ++ +LL  +  S  +   KK   +L+IG+KKR + C  K++ GD +HMHYTGTL +DG++FDSS+ R  P  FTLGTGQVIKGWD G+ GMC GEKRKL IP  LGYGD G+PPKIP  ATLVFEVEL+++E+R+EL
Sbjct:    6 LLGAGLACVLLCLLQGSAWATEGKK---KLQIGVKKRADSCPIKSRKGDTLHMHYTGTL-EDGTEFDSSIPRNQPFIFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPPELGYGDRGAPPKIPGGATLVFEVELLQVERRAEL 143          
BLAST of FKBP2 vs. Ensembl Sea Lamprey
Match: fkbp11 (FKBP prolyl isomerase 11 [Source:ZFIN;Acc:ZDB-GENE-030616-357])

HSP 1 Score: 120.168 bits (300), Expect = 6.763e-34
Identity = 60/126 (47.62%), Postives = 76/126 (60.32%), Query Frame = 1
Query:  280 ELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL*FKFLFAICFFY 657
            EL + +  +  +C E +  GD +H+HYTG L  DGS FD+S  R DPL+  LG  QVI GW+ G+ GMCVGEKRKL IP HL YG  G+PP IP  A L FE EL+ +  +         A+ F Y
Sbjct:   30 ELLVEVVHKPAECVELSAQGDTLHVHYTGRL-KDGSVFDTSAMR-DPLQVELGKKQVIPGWEQGLLGMCVGEKRKLVIPPHLAYGKRGAPPSIPADAVLTFETELVSLRHKETWERALETALPFVY 153          
BLAST of FKBP2 vs. Ensembl Sea Lamprey
Match: fkbp1aa (FKBP prolyl isomerase 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-7275])

HSP 1 Score: 93.5893 bits (231), Expect = 2.044e-24
Identity = 45/92 (48.91%), Postives = 61/92 (66.30%), Query Frame = 1
Query:  331 KDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            K G  + +HYTGTL +DG KFDSS DR  P KF +G  +VI+GW+ G+  M VG++ +L       YG  G P  IPP ATL+F+VEL+++E
Sbjct:   43 KKGQTVVVHYTGTL-EDGKKFDSSRDRDKPFKFKIGKQEVIRGWEEGVAQMSVGQRARLTCSPDFAYGAIGHPGVIPPNATLLFDVELLRLE 133          
BLAST of FKBP2 vs. Ensembl Sea Lamprey
Match: fkbp9 (FKBP prolyl isomerase 9 [Source:ZFIN;Acc:ZDB-GENE-040801-23])

HSP 1 Score: 96.6709 bits (239), Expect = 3.342e-23
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 1
Query:  214 SIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            S +L+F I   +       P +E++     R  +C  K++ GD++ +HY GT Y DGS  DSS   G      LG+G+V+ G D  + GMCVGEKR   IP HLGYG+ G    +P  A LVF++EL+ +++
Sbjct:  279 SAVLVFDINLID----FHNPKDEVQTDSYFRPEECFRKSRKGDLVQVHYNGT-YMDGSPLDSSHKYGKTYDLILGSGRVVLGLDQALTGMCVGEKRLAIIPPHLGYGEQGIDGDVPGSAVLVFDLELVALQE 405          

HSP 2 Score: 83.1889 bits (204), Expect = 1.844e-18
Identity = 46/110 (41.82%), Postives = 61/110 (55.45%), Query Frame = 1
Query:  286 RIGIKKRI--NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            R+ IK  +   +CT K K  D +  HY GTL D G+ FDSS  R       LG G +I G + G+  MCV E+R + IP HLGYG+ G+   IP  A LVF++ L+    
Sbjct:  186 RVDIKTYLLPENCTRKTKSSDYVRYHYNGTLLD-GTPFDSSHSRNRTYNTYLGLGNIIAGMEEGLLDMCVNERRIVTIPPHLGYGEGGT-GSIPGSAVLVFDINLIDFHN 293          

HSP 3 Score: 75.8702 bits (185), Expect = 5.385e-16
Identity = 38/86 (44.19%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  316 CTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKAT 573
            C  K +  D +  HY GTL D G+ FDSS  R       +G G +I G D G+ GMCV E+R + IP  LGYG++G  P IP +A+
Sbjct:   86 CERKVQSTDYVRYHYNGTLLD-GTPFDSSYTRKSTYNTYVGMGWLIAGMDQGLLGMCVNERRFVTIPPQLGYGESGYDPVIPAQAS 170          

HSP 4 Score: 52.373 bits (124), Expect = 3.229e-8
Identity = 26/68 (38.24%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  400 SLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            S D+G      +G   ++ G D G+ GMCV E R + +P+ LGYG  G    IP  A L F V L+ +
Sbjct:    1 SYDKGSTYNMFVGKKLMVAGMDQGLLGMCVNELRTIRVPAALGYGKEGLGDSIPANAELFFSVLLVDV 68          
BLAST of FKBP2 vs. Ensembl Sea Lamprey
Match: fkbp1b (FKBP prolyl isomerase 1B [Source:ZFIN;Acc:ZDB-GENE-040426-1785])

HSP 1 Score: 81.2629 bits (199), Expect = 2.448e-20
Identity = 36/78 (46.15%), Postives = 52/78 (66.67%), Query Frame = 1
Query:  373 YDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            + +G KFDSS DR  P +FTLG  QVIKGW+ G+  M +G + ++     + YG+ G P  IPP  TL+F+VEL+++E
Sbjct:    4 FRNGKKFDSSRDRKKPFRFTLGKQQVIKGWEEGVGQMSLGMRARITCTPDMAYGETGHPGVIPPNTTLIFDVELLQLE 81          
BLAST of FKBP2 vs. Ensembl Yeast
Match: FPR2 (Membrane-bound peptidyl-prolyl cis-trans isomerase (PPIase); binds to the drugs FK506 and rapamycin; expression pattern suggests possible involvement in ER protein trafficking; relocalizes from nucleus to vacuole upon DNA replication stress; mutation is functionally complemented by human FKBP2 [Source:SGD;Acc:S000002927])

HSP 1 Score: 134.806 bits (338), Expect = 1.792e-40
Identity = 65/116 (56.03%), Postives = 82/116 (70.69%), Query Frame = 1
Query:  274 INELRIGIKKRI--NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRS 615
            +++L IGI KRI   DC  KA  GD + +HYTG+L + G+ FDSS  RG P+ F LG G+VIKGWD G+ GMCVGEKRKL IPS L YG+ G P  IPP A LVF+VEL+ ++  +
Sbjct:   20 LSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDVKSAA 135          
BLAST of FKBP2 vs. Ensembl Yeast
Match: FPR1 (Peptidyl-prolyl cis-trans isomerase (PPIase); binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function; N-terminally propionylated in vivo; mutation is functionally complemented by human FKBP1A [Source:SGD;Acc:S000005079])

HSP 1 Score: 109.383 bits (272), Expect = 8.732e-31
Identity = 53/98 (54.08%), Postives = 68/98 (69.39%), Query Frame = 1
Query:  313 DCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            D     K GD++ +HYTGTL ++G KFDSS+DRG P +  +G GQVIKGWD+GI  + VGEK +L IP    YG  G P  IPP +TLVF+VEL+K+ 
Sbjct:   18 DGATFPKTGDLVTIHYTGTL-ENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN 114          
BLAST of FKBP2 vs. Ensembl Yeast
Match: FPR4 (Peptidyl-prolyl cis-trans isomerase (PPIase); nuclear proline isomerase; affects expression of multiple genes via its role in nucleosome assembly; catalyzes isomerization of proline residues in histones H3 and H4, which affects lysine methylation of those histones; PPIase domain acts as a transcriptional repressor when tethered to DNA by lexA, and repressor activity is dependent on PPIase activity; contains a nucleoplasmin-like fold and can form pentamers [Source:SGD;Acc:S000004441])

HSP 1 Score: 78.1814 bits (191), Expect = 3.870e-17
Identity = 50/124 (40.32%), Postives = 70/124 (56.45%), Query Frame = 1
Query:  244 SEESKSTKKPINELRIG---IKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            SEESK   KP  +L  G   I+ R+      AK G  + M Y G L  +G  FD +  +G P  F LG G+VIKGWD+G+ GM VG +R++ IP+   YG     P IP  + L F+V+L+ ++
Sbjct:  274 SEESKP--KPKTKLLEGGIIIEDRVTGKGPHAKKGTRVGMRYVGKL-KNGKVFDKNT-KGKPFVFKLGQGEVIKGWDIGVAGMAVGGERRIVIPAPYAYGKQAL-PGIPANSELTFDVKLVSMK 392          
BLAST of FKBP2 vs. Ensembl Yeast
Match: FPR3 (Nucleolar peptidyl-prolyl cis-trans isomerase (PPIase); FK506 binding protein; affects expression of multiple genes via its role in nucleosome assembly; phosphorylated by casein kinase II (Cka1p-Cka2p-Ckb1p-Ckb2p) and dephosphorylated by Ptp1p; PPIase domain acts as a transcriptional repressor when tethered to DNA by lexA, and repressor activity is dependent on PPIase activity; FPR3 has a paralog, FPR4, that arose from the whole genome duplication [Source:SGD;Acc:S000004539])

HSP 1 Score: 73.559 bits (179), Expect = 1.596e-15
Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  325 KAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            +AK G  + M Y G L  +G  FD +   G P  F LG G+VIKGWD+G+ GM VG +R++ IP+   YG     P IP  + L F+V+L+ ++
Sbjct:  320 QAKRGARVGMRYIGKL-KNGKVFDKNTS-GKPFAFKLGRGEVIKGWDIGVAGMSVGGERRIIIPAPYAYGKQAL-PGIPANSELTFDVKLVSMK 410          
BLAST of FKBP2 vs. Ensembl Nematostella
Match: EDO40282 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7S7R3])

HSP 1 Score: 161.77 bits (408), Expect = 1.562e-50
Identity = 75/128 (58.59%), Postives = 99/128 (77.34%), Query Frame = 1
Query:  238 VYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            + +  S + KK + +L+IG+KK++ DC  ++  GD +HMHYTG L +DG++FDSS+ RG+P  FTLGTGQVIKGWD G+  MC GEKRKL IPS +GYGD G+PPKIP  ATL+FEVEL+KI  +S+L
Sbjct:    5 LVTASSAAEKKKVTKLQIGVKKKVKDCKRRSVKGDSLHMHYTGKL-EDGTEFDSSIPRGEPFVFTLGTGQVIKGWDQGLLNMCAGEKRKLVIPSDMGYGDRGAPPKIPGGATLIFEVELLKIGDKSDL 131          
BLAST of FKBP2 vs. Ensembl Nematostella
Match: EDO47498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX5])

HSP 1 Score: 129.798 bits (325), Expect = 3.515e-37
Identity = 65/132 (49.24%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  223 LLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSE 618
            LL  + +S  +   ++P  EL+I +  +   CT K   GD + MHYTG L + G+KFDSSLDRG    FTLG G VI+GW+ G+  MC+GEKRKL IP HL YG+NG+   IPP ATL  +VEL++I+   E
Sbjct:    7 LLAIVAFSGLALGAEEPKGELKIEVVSKPEKCTRKTHVGDTLSMHYTGRLAN-GNKFDSSLDRGKTFDFTLGKGMVIQGWEQGLLDMCIGEKRKLTIPPHLAYGENGAGAAIPPHATLYMDVELVEIQGSKE 137          
BLAST of FKBP2 vs. Ensembl Nematostella
Match: EDO34576 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNX5])

HSP 1 Score: 99.7525 bits (247), Expect = 5.433e-27
Identity = 49/89 (55.06%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  304 RINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRG-DPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPK 567
            R  +C  +A+ GD++ +HYTG+L ++G  FDSS+ +G  P++F LG G+VIKGW+ GI+GMC+GEKRKL IP HLGYG NG    IP K
Sbjct:    2 RPGNCQGEAQTGDIVAVHYTGSL-ENGRMFDSSVHQGRKPIEFELGKGRVIKGWEEGIKGMCIGEKRKLIIPPHLGYGANGVDNVIPRK 89          
BLAST of FKBP2 vs. Ensembl Nematostella
Match: EDO44761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUV7])

HSP 1 Score: 94.7449 bits (234), Expect = 1.303e-23
Identity = 58/143 (40.56%), Postives = 81/143 (56.64%), Query Frame = 1
Query:  199 LAFSISIILLFQ------IVYSEESKSTKKPINE--LRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            +A   +I+LLF       +V SE+ K  ++   +  LRIGI K+   C  ++K GDM+ + Y  TL D      SS+       FTLG  QVI GW++G+  MCVGE R+L +P   GYG+     ++PPKA LVF VEL+ I
Sbjct:    1 MACPRNIMLLFLYCSLLVLVTSEDEKVPEEDEFQRGLRIGIMKKPKRCPRESKSGDMLSVKYNCTLVDQTPVLPSSM-----FSFTLGEDQVIAGWEMGLLDMCVGELRELIVPFKYGYGELTVGDQLPPKAPLVFYVELLDI 138          
BLAST of FKBP2 vs. Ensembl Nematostella
Match: EDO34418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPD7])

HSP 1 Score: 89.3521 bits (220), Expect = 9.346e-22
Identity = 47/103 (45.63%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  310 NDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRG---DPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            +DC  K K GD + +HYTG +  DGS FD++ D      P +FT+G G VIKG++ G+ GMCVG+KRK+ IP  L YG  GS   +P   TL + +EL  + K
Sbjct:   12 SDCENKTKVGDHVVVHYTGWM-QDGSLFDTTRDHRKGYQPFEFTIGGGTVIKGFEQGVTGMCVGQKRKIVIPPALAYGKKGS-GDVPANTTLTYNLELFDVRK 112          
BLAST of FKBP2 vs. Ensembl Medaka
Match: fkbp2 (FKBP prolyl isomerase 2 [Source:ZFIN;Acc:ZDB-GENE-040912-126])

HSP 1 Score: 160.614 bits (405), Expect = 3.595e-49
Identity = 79/146 (54.11%), Postives = 106/146 (72.60%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINE--LRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            +N+  F +  + L  +     S +     ++  L+IGIKKR+++C  K++ GD+++MHYTG L +DG++FDSS+ R  P  FTLGTGQVIKGWD G+ GMC GEKRKL IP+ LGYGD G+PPKIP  ATL+FEVEL+ IE+RSEL
Sbjct:   28 INYFLFFMRALWLVAVAALSLSPAAVNGADKKKLQIGIKKRVDNCPIKSRKGDVLNMHYTGKL-EDGTEFDSSIPRDRPFTFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPAELGYGDRGAPPKIPGGATLIFEVELLSIERRSEL 172          
BLAST of FKBP2 vs. Ensembl Medaka
Match: fkbp7 (peptidyl-prolyl cis-trans isomerase FKBP7 [Source:NCBI gene;Acc:101161017])

HSP 1 Score: 106.686 bits (265), Expect = 4.914e-28
Identity = 51/113 (45.13%), Postives = 73/113 (64.60%), Query Frame = 1
Query:  274 INELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDR-GDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
            + E++  +  +   CT+K+K GD+I+ HY G L D    + S  D+ G P  F LG GQVIKG D+G+  MC GEKRK+ +PS L +G NG  P +PP AT+VFEVE++ + +
Sbjct:   26 LKEVKTEVVSKPEQCTQKSKKGDLINAHYDGYLLDGSQFYCSRTDKAGHPQWFVLGVGQVIKGLDIGMMDMCAGEKRKITVPSDLAFGKNGKGP-VPPNATVVFEVEVLSVSR 137          
BLAST of FKBP2 vs. Ensembl Medaka
Match: fkbp7 (peptidyl-prolyl cis-trans isomerase FKBP7 [Source:NCBI gene;Acc:101161017])

HSP 1 Score: 107.457 bits (267), Expect = 1.144e-27
Identity = 54/137 (39.42%), Postives = 85/137 (62.04%), Query Frame = 1
Query:  202 AFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDR-GDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
             F++S + L+ ++ + +     + + E++  +  +   CT+K+K GD+I+ HY G L D    + S  D+ G P  F LG GQVIKG D+G+  MC GEKRK+ +PS L +G NG  P +PP AT+VFEVE++ + +
Sbjct:   72 VFALSKLDLWAVLATAD-----ELLKEVKTEVVSKPEQCTQKSKKGDLINAHYDGYLLDGSQFYCSRTDKAGHPQWFVLGVGQVIKGLDIGMMDMCAGEKRKITVPSDLAFGKNGKGP-VPPNATVVFEVEVLSVSR 202          
BLAST of FKBP2 vs. Ensembl Medaka
Match: fkbp14 (FKBP prolyl isomerase 14 [Source:NCBI gene;Acc:101156431])

HSP 1 Score: 106.301 bits (264), Expect = 1.505e-27
Identity = 60/137 (43.80%), Postives = 83/137 (60.58%), Query Frame = 1
Query:  199 LAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGD--PLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKI 603
            + FS  +I+   +V+       K P  E++I +  +   C  K+K GDM+ +HY G L  +G+ F SS   GD  P+ FTLG  + IKGWD G+Q MC GE+RKL IP  L YG  G   KIPP +TL+F++ELM+I
Sbjct:    7 IRFSFCLIVPTFLVFV---TGGKLPEPEVKIEVIHKPLMCLRKSKYGDMLLLHYDGYLESNGTMFHSSRKEGDGNPVWFTLGIREAIKGWDKGLQNMCTGERRKLTIPPSLAYGSEGK-GKIPPSSTLIFDIELMEI 139          
BLAST of FKBP2 vs. Ensembl Medaka
Match: fkbp7 (peptidyl-prolyl cis-trans isomerase FKBP7 [Source:NCBI gene;Acc:101161017])

HSP 1 Score: 105.916 bits (263), Expect = 1.653e-27
Identity = 54/137 (39.42%), Postives = 84/137 (61.31%), Query Frame = 1
Query:  202 AFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDR-GDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEK 609
             F++S + L+ ++      +  + + E++  +  +   CT+K+K GD+I+ HY G L D    + S  D+ G P  F LG GQVIKG D+G+  MC GEKRK+ +PS L +G NG  P +PP AT+VFEVE++ + +
Sbjct:    6 VFALSKLDLWAVL-----ATADELLKEVKTEVVSKPEQCTQKSKKGDLINAHYDGYLLDGSQFYCSRTDKAGHPQWFVLGVGQVIKGLDIGMMDMCAGEKRKITVPSDLAFGKNGKGP-VPPNATVVFEVEVLSVSR 136          
BLAST of FKBP2 vs. Planmine SMEST
Match: SMESG000026974.1 (SMESG000026974.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.364e-102
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
Query:  190 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
            MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL
Sbjct:    1 MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 144          
BLAST of FKBP2 vs. Planmine SMEST
Match: SMESG000011025.1 (SMESG000011025.1)

HSP 1 Score: 128.642 bits (322), Expect = 2.805e-37
Identity = 61/135 (45.19%), Postives = 91/135 (67.41%), Query Frame = 1
Query:  217 IILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL 621
             ++LF ++     +S +  I+EL+  I  +  DC+ KA   D +  HY GT Y++G KFDSS DRG P +FT+  G+VI+G + GI+GMCVGE+R + IPS + YG+ G  P IPP + LVF+VE+++I K+S+L
Sbjct:    5 FLVLFAVLALTNVESNQ--ISELQSIIVNKSPDCSAKAGSQDYVSYHYVGTFYENGDKFDSSYDRGQPYRFTIDRGEVIEGMNEGIKGMCVGERRVITIPSAMAYGERGYSPVIPPDSDLVFQVEMLEILKKSDL 137          
BLAST of FKBP2 vs. Planmine SMEST
Match: SMESG000062712.1 (SMESG000062712.1)

HSP 1 Score: 95.9005 bits (237), Expect = 5.931e-25
Identity = 50/95 (52.63%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  313 DCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELM 597
            DC    K G  + +HY GTL  +G KFDSS DR +P KF +GTG VIKGWD G+  M  GEK KL       YG  G P  IPP +TLVFEV L+
Sbjct:   12 DCVNYPKVGQNVTVHYVGTL-TNGKKFDSSRDRNEPFKFKIGTGSVIKGWDEGVLKMSKGEKAKLTCSPDYAYGSKGYPGLIPPNSTLVFEVLLI 105          
BLAST of FKBP2 vs. Planmine SMEST
Match: SMESG000028286.1 (SMESG000028286.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.501e-23
Identity = 46/98 (46.94%), Postives = 61/98 (62.24%), Query Frame = 1
Query:  313 DCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            D +   K G  + +HYTGTL  +G KFDSS DR  PLKF +G G+VIKGWD G+  + +GE+ KL       YG  G    IPP + L+F+VEL+ I+
Sbjct:   12 DESTYPKKGQTVEVHYTGTL-TNGKKFDSSRDRNRPLKFKIGMGEVIKGWDEGVAQLSLGERAKLTCSPDYAYGSEGIQDVIPPNSVLIFDVELISIK 108          
BLAST of FKBP2 vs. Planmine SMEST
Match: SMESG000004790.1 (SMESG000004790.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.501e-23
Identity = 46/98 (46.94%), Postives = 61/98 (62.24%), Query Frame = 1
Query:  313 DCTEKAKDGDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIE 606
            D +   K G  + +HYTGTL  +G KFDSS DR  PLKF +G G+VIKGWD G+  + +GE+ KL       YG  G    IPP + L+F+VEL+ I+
Sbjct:   12 DESTYPKKGQTVEVHYTGTL-TNGKKFDSSRDRNRPLKFKIGMGEVIKGWDEGVAQLSLGERAKLTCSPDYAYGSEGIQDVIPPNSVLIFDVELISIK 108          
The following BLAST results are available for this feature:
BLAST of FKBP2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FKBP22.369e-4955.63FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HG... [more]
FKBP22.369e-4955.63FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HG... [more]
FKBP22.369e-4955.63FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HG... [more]
AP001453.52.369e-4955.63Uncharacterized protein LOC114841035 [Source:NCBI ... [more]
FKBP22.765e-4955.63FKBP prolyl isomerase 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of FKBP2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkb-18.529e-4651.08Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-18.529e-4651.08Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-18.529e-4651.08Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-15.172e-3261.80Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-21.168e-2951.85Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of FKBP2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fkbp142.383e-3959.26gene:FBgn0010470 transcript:FBtr0342897[more]
Fkbp142.383e-3959.26gene:FBgn0010470 transcript:FBtr0071703[more]
Fkbp142.383e-3959.26gene:FBgn0010470 transcript:FBtr0342896[more]
Fkbp142.383e-3959.26gene:FBgn0010470 transcript:FBtr0300397[more]
Fkbp142.575e-3959.26gene:FBgn0010470 transcript:FBtr0306013[more]
back to top
BLAST of FKBP2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp21.652e-4955.56FKBP prolyl isomerase 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp71.086e-2842.66FKBP prolyl isomerase 7 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp141.003e-2647.41FKBP prolyl isomerase 14 [Source:ZFIN;Acc:ZDB-GENE... [more]
fkbp47.036e-2556.32FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp47.338e-2556.32FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of FKBP2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp22.926e-5256.94FKBP prolyl isomerase 2 [Source:NCBI gene;Acc:1001... [more]
FKBP111.479e-2847.54FKBP prolyl isomerase 11 [Source:NCBI gene;Acc:100... [more]
setd74.058e-2746.90SET domain containing (lysine methyltransferase) 7... [more]
tub4.195e-2540.85TUB bipartite transcription factor [Source:Xenbase... [more]
fkbp1b8.037e-2348.91FKBP prolyl isomerase 1B [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of FKBP2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fkbp26.698e-5058.82FK506 binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp26.698e-5058.82FK506 binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp75.297e-2839.86FK506 binding protein 7 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp144.758e-2742.86FK506 binding protein 14 [Source:MGI Symbol;Acc:MG... [more]
Fkbp116.601e-2743.55FK506 binding protein 11 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of FKBP2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P45878|FKBP2_MOUSE4.685e-4958.82Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Mus m... [more]
sp|Q32PA9|FKBP2_BOVIN8.417e-4957.14Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Bos t... [more]
sp|P26885|FKBP2_HUMAN1.138e-4855.63Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo ... [more]
sp|P0C1J5|FKB2B_RHIO96.328e-4755.22FK506-binding protein 2B OS=Rhizopus delemar (stra... [more]
sp|P0CP96|FKBP2_CRYNJ1.246e-4655.80FK506-binding protein 2 OS=Cryptococcus neoformans... [more]
back to top
BLAST of FKBP2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9XTD97.411e-86100.00Peptidylprolyl isomerase (Fragment) OS=Schmidtea m... [more]
A0A224XZI31.738e-5263.19Peptidylprolyl isomerase OS=Panstrongylus lignariu... [more]
A0A267FUD81.864e-5258.39Peptidylprolyl isomerase (Fragment) OS=Macrostomum... [more]
A0A1I8I7942.837e-5258.39Peptidylprolyl isomerase OS=Macrostomum lignano OX... [more]
A0A161MBF54.726e-5262.50Peptidylprolyl isomerase OS=Triatoma infestans OX=... [more]
back to top
BLAST of FKBP2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp23.813e-5155.94FKBP prolyl isomerase 2 [Source:NCBI gene;Acc:1030... [more]
fkbp75.136e-2744.25FKBP prolyl isomerase 7 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp75.951e-2744.25FKBP prolyl isomerase 7 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp49.229e-2652.63FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:1030... [more]
fkbp1aa1.445e-2347.47peptidyl-prolyl cis-trans isomerase FKBP1A [Source... [more]
back to top
BLAST of FKBP2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004854.11.978e-5157.04pep scaffold:Pmarinus_7.0:GL501075:9618:21951:-1 g... [more]
fkbp116.763e-3447.62FKBP prolyl isomerase 11 [Source:ZFIN;Acc:ZDB-GENE... [more]
fkbp1aa2.044e-2448.91FKBP prolyl isomerase 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
fkbp93.342e-2339.39FKBP prolyl isomerase 9 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp1b2.448e-2046.15FKBP prolyl isomerase 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of FKBP2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FPR21.792e-4056.03Membrane-bound peptidyl-prolyl cis-trans isomerase... [more]
FPR18.732e-3154.08Peptidyl-prolyl cis-trans isomerase (PPIase); bind... [more]
FPR43.870e-1740.32Peptidyl-prolyl cis-trans isomerase (PPIase); nucl... [more]
FPR31.596e-1541.49Nucleolar peptidyl-prolyl cis-trans isomerase (PPI... [more]
back to top
BLAST of FKBP2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO402821.562e-5058.59Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO474983.515e-3749.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345765.433e-2755.06Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO447611.303e-2340.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344189.346e-2245.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FKBP2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp23.595e-4954.11FKBP prolyl isomerase 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp74.914e-2845.13peptidyl-prolyl cis-trans isomerase FKBP7 [Source:... [more]
fkbp71.144e-2739.42peptidyl-prolyl cis-trans isomerase FKBP7 [Source:... [more]
fkbp141.505e-2743.80FKBP prolyl isomerase 14 [Source:NCBI gene;Acc:101... [more]
fkbp71.653e-2739.42peptidyl-prolyl cis-trans isomerase FKBP7 [Source:... [more]
back to top
BLAST of FKBP2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026974.11.364e-102100.00SMESG000026974.1[more]
SMESG000011025.12.805e-3745.19SMESG000011025.1[more]
SMESG000062712.15.931e-2552.63SMESG000062712.1[more]
SMESG000028286.12.501e-2346.94SMESG000028286.1[more]
SMESG000004790.12.501e-2346.94SMESG000004790.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010222
GenBankAHD24726.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010222 ID=SMED30010222|Name=FKBP2|organism=Schmidtea mediterranea sexual|type=transcript|length=791bp
ATTTTTAATTATTCCGAATTCACAATTTAAATAATTTGGATTTGTAAATA
AATATTTAATTTTTTTAAATAATAAATTGTAAATTTGGTTTTATACGTTT
ACAATTTGTTTATCTAAAGTCGTGTCATCGTGTATTTGAATAGTTGAGAA
TTAAATTAATTTTAAGTTATTCAATAAATTTTCCCGGAAATGAATTTTTT
AGCTTTTTCAATTAGTATTATTTTATTATTTCAAATTGTTTACTCCGAAG
AATCGAAATCCACCAAAAAGCCTATAAATGAATTACGAATCGGCATTAAA
AAGAGAATTAATGATTGTACTGAAAAAGCCAAAGATGGCGACATGATTCA
TATGCATTATACTGGAACATTGTATGATGATGGTTCTAAATTCGACAGTA
GCTTAGACCGAGGTGATCCTCTAAAATTTACACTTGGCACAGGTCAAGTA
ATAAAAGGATGGGATCTAGGCATTCAGGGTATGTGTGTTGGTGAAAAGAG
GAAATTATTTATTCCATCACATTTGGGTTATGGAGATAACGGTAGCCCTC
CTAAAATTCCACCGAAAGCAACACTGGTTTTTGAAGTAGAATTAATGAAA
ATAGAGAAACGATCTGAGTTGTGATTTAAATTTTTATTTGCAATCTGTTT
TTTCTATCAAATATTTAGTATGTTAATAAATGATTTAGTTGTATTTTCTA
TGCCAGTTGATTGTTTTAATCAATTTTTCATCACGGTTTTATTAAGCAAA
AGCGAATAATAAATTCATTTGTAAAATAATGGTTATCTAAG
back to top

protein sequence of SMED30010222-orf-1

>SMED30010222-orf-1 ID=SMED30010222-orf-1|Name=SMED30010222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MNFLAFSISIILLFQIVYSEESKSTKKPINELRIGIKKRINDCTEKAKDG
DMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCV
GEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRSEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001179PPIase_FKBP_dom
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.50.40coord: 18..139
e-value: 4.9E-45
score: 154.4
NoneNo IPR availablePANTHERPTHR45779FAMILY NOT NAMEDcoord: 9..144
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.844
NoneNo IPR availableSUPERFAMILYSSF54534FKBP-likecoord: 38..142
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00254FKBP_Ccoord: 44..135
e-value: 3.9E-36
score: 123.2
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50059FKBP_PPIASEcoord: 50..139
score: 32.307