Reticulon-like protein

Overview
NameReticulon-like protein
Smed IDSMED30010219
Length (bp)1101
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulon-like protein (SMED30010219) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulon-like protein (SMED30010219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulon-like protein (SMED30010219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulon-like protein (SMED30010219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010219

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010219h1SMcG0010482 Contig20GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30010219h1SMcG0010482 dd_Smed_v4_878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010219h1SMcG0010482 dd_Smed_v4_878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010219h1SMcG0010482 dd_Smed_v4_878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010219h1SMcG0010482 dd_Smed_v4_878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 73.9442 bits (180), Expect = 1.255e-13
Identity = 45/188 (23.94%), Postives = 92/188 (48.94%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATL 730
            ++ +++ WR    +G +  + L   + +   S +SV AYI L  +  ++  R Y   I     ++  +PF+ YLE ++ +    +  Y    + +   H    I  L  +FL++  +D +KF ++     YVG  FN + L+ + + +L + P IY  ++ QID +   A + + + +A ++ K+  L
Sbjct: 1004 SVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKY----SNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 1187          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN3 (reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469])

HSP 1 Score: 71.2478 bits (173), Expect = 1.291e-13
Identity = 47/185 (25.41%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            A+ ++I WR    +G +  + L+  + +   S ISV++Y+ L  +  ++  R Y + I     +E  +PF+ YL+ D+ +      +Y++        H  +A+  +  +FL+E  +D +K  +    + YVG  FN I L+ +    + + P +Y  Y+ QID +   AR +  ++V  ++ KL
Sbjct:   47 AVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMV----HINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 227          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN3 (reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469])

HSP 1 Score: 69.707 bits (169), Expect = 6.207e-13
Identity = 46/184 (25.00%), Postives = 92/184 (50.00%), Query Frame = 2
Query:  182 IKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            + ++I WR    +G +  + L+  + +   S ISV++Y+ L  +  ++  R Y + I     +E  +PF+ YL+ D+ +      +Y++        H  +A+  +  +FL+E  +D +K  +    + YVG  FN I L+ +    + + P +Y  Y+ QID +   AR +  ++V  ++ KL
Sbjct:   67 VHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMV----HINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 246          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 68.1662 bits (165), Expect = 7.579e-13
Identity = 45/185 (24.32%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATL 730
            +++ WR    +G +  + L   + +   S +SV AYI L  +  ++  R Y   I     ++  +PF+ YLE ++ +    +  Y    + +   H    I  L  +FL++  +D +KF ++     YVG  FN + L+ + + +L + P IY  ++ QID +   A + + + +A ++ K+  L
Sbjct:   14 DLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKY----SNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 194          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 67.3958 bits (163), Expect = 9.087e-12
Identity = 46/188 (24.47%), Postives = 92/188 (48.94%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATL 730
            A+ +++ WR    +G +  + L   + +   S +SV AYI L  +  ++  R Y   I     ++  +PF+ YLE ++ +    +  Y    + +   H    I  L  +FL++  +D +KF ++     YVG  FN + L+ + + +L + P IY  ++ QID +   A + + + +A ++ K+  L
Sbjct:  204 AVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKY----SNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 387          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0332413)

HSP 1 Score: 75.8702 bits (185), Expect = 1.123e-15
Identity = 52/174 (29.89%), Postives = 87/174 (50.00%), Query Frame = 2
Query:  152 CSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN-----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQID 658
            CS+L+ +    +++I WR    SG +  + L+    I + S ISV AY+ LL +  ++  R Y +        NE  +PF++YLE D+ +   K+ +          +H    I+ L  +FL+E  +D +KF ++     YVG  FN + LV +   +L T PK+Y   +  ID
Sbjct:   20 CSILDPM----ESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEG-HPFKDYLELDLTLSHEKVQNIAGVAV----AHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSID 184          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079040)

HSP 1 Score: 75.8702 bits (185), Expect = 1.471e-15
Identity = 54/182 (29.67%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  152 CSVL--------ESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN-----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQID 658
            CS+L        E L   ++++I WR    SG +  + L+    I + S ISV AY+ LL +  ++  R Y +        NE  +PF++YLE D+ +   K+ +          +H    I+ L  +FL+E  +D +KF ++     YVG  FN + LV +   +L T PK+Y   +  ID
Sbjct:   20 CSILDPNAWFKPERLHPQVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEG-HPFKDYLELDLTLSHEKVQNIAGVAV----AHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSID 196          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0301540)

HSP 1 Score: 75.8702 bits (185), Expect = 1.471e-15
Identity = 54/182 (29.67%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  152 CSVL--------ESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN-----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQID 658
            CS+L        E L   ++++I WR    SG +  + L+    I + S ISV AY+ LL +  ++  R Y +        NE  +PF++YLE D+ +   K+ +          +H    I+ L  +FL+E  +D +KF ++     YVG  FN + LV +   +L T PK+Y   +  ID
Sbjct:   20 CSILDPNAWFKPERLHPQVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEG-HPFKDYLELDLTLSHEKVQNIAGVAV----AHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSID 196          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0301539)

HSP 1 Score: 75.8702 bits (185), Expect = 1.471e-15
Identity = 54/182 (29.67%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  152 CSVL--------ESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN-----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQID 658
            CS+L        E L   ++++I WR    SG +  + L+    I + S ISV AY+ LL +  ++  R Y +        NE  +PF++YLE D+ +   K+ +          +H    I+ L  +FL+E  +D +KF ++     YVG  FN + LV +   +L T PK+Y   +  ID
Sbjct:   20 CSILDPNAWFKPERLHPQVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEG-HPFKDYLELDLTLSHEKVQNIAGVAV----AHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSID 196          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079039)

HSP 1 Score: 75.8702 bits (185), Expect = 1.471e-15
Identity = 54/182 (29.67%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  152 CSVL--------ESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN-----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQID 658
            CS+L        E L   ++++I WR    SG +  + L+    I + S ISV AY+ LL +  ++  R Y +        NE  +PF++YLE D+ +   K+ +          +H    I+ L  +FL+E  +D +KF ++     YVG  FN + LV +   +L T PK+Y   +  ID
Sbjct:   20 CSILDPNAWFKPERLHPQVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEG-HPFKDYLELDLTLSHEKVQNIAGVAV----AHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSID 196          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 78.9518 bits (193), Expect = 6.033e-17
Identity = 48/188 (25.53%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  170 LPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            +  ++ +++ WR    SG +  S L+    +   S +SVIAY+ L  + +++  R Y + +      +  +PF+ YLE ++++   +IS YV         +    +  L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ + P +Y  Y+ QID +    R ++ +V+  ++EK+
Sbjct:    1 MGGSVVDLVHWRDLKQSGLVFGSVLLLLFSLTQFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVD----KTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREKV 184          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 78.9518 bits (193), Expect = 9.385e-17
Identity = 48/182 (26.37%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            +++ WR    SG +  S L+    +   S +SVIAY+ L  + +++  R Y + +      +  +PF+ YLE ++++   +IS YV         +    +  L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ + P +Y  Y+ QID +    R ++ +V+  ++EK+
Sbjct:   19 DLVHWRDLKQSGLVFGSVLLLLFSLTQFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVD----KTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREKV 196          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1a (reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426])

HSP 1 Score: 77.411 bits (189), Expect = 2.284e-15
Identity = 48/183 (26.23%), Postives = 95/183 (51.91%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLA 724
            +++ WR    SG +  S L+    +   S +SVIAY+ L  + +++  R Y + +      +  +PF+ YLE ++++   +IS YV         +    +  L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ + P +Y  Y+ QID +    R ++ +V+  ++EK+ 
Sbjct:  169 DLVHWRDLKQSGLVFGSVLLLLFSLTQFSVVSVIAYLALAVLSATISFRVYKSVLQAVQKTDEGHPFKSYLEVEISLSADQISKYVD----KTQLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREKVP 347          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn4a (reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1])

HSP 1 Score: 74.7146 bits (182), Expect = 2.290e-15
Identity = 50/197 (25.38%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVK 754
            + +  ++ WR    +G +  + L   + +   S ISV++Y+ L  +  ++  R Y   +     +E  +PF+ YL+KD  +     ++ VH  + +   H    I  L  +FL+E  +D +KF ++   L YVG  FN + L+ +      +CP IY  ++ QID +     ++  +VV  ++ K   +P   PK +
Sbjct:    7 KQVVELLYWRDLQRTGVVFGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAVQKSEDGHPFKMYLDKDTAL----PAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVLMWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHYYGLVNKQFKDVVGKIQAK---IPGAKPKTE 196          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn4a (reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1])

HSP 1 Score: 74.7146 bits (182), Expect = 2.290e-15
Identity = 50/197 (25.38%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVK 754
            + +  ++ WR    +G +  + L   + +   S ISV++Y+ L  +  ++  R Y   +     +E  +PF+ YL+KD  +     ++ VH  + +   H    I  L  +FL+E  +D +KF ++   L YVG  FN + L+ +      +CP IY  ++ QID +     ++  +VV  ++ K   +P   PK +
Sbjct:    7 KQVVELLYWRDLQRTGVVFGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAVQKSEDGHPFKMYLDKDTAL----PAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVLMWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHYYGLVNKQFKDVVGKIQAK---IPGAKPKTE 196          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 79.337 bits (194), Expect = 4.347e-16
Identity = 52/167 (31.14%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF 664
            RA+K+++ WR  +LS   L    +  + +   S ISV AY  L+ +  ++ LR Y+  ++       ANPFQ YL+ D+ +  TK ++ +   T    S     I  L S+FL+E   D +KF ++   L YVG  FN I ++ + V    T P +Y  ++ Q+D +
Sbjct:  120 RAVKDLLYWRDILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPFQYYLDADLKL-TTKQAEEI---TARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHY 282          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 78.9518 bits (193), Expect = 6.425e-16
Identity = 52/167 (31.14%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF 664
            RA+K+++ WR  +LS   L    +  + +   S ISV AY  L+ +  ++ LR Y+  ++       ANPFQ YL+ D+ +  TK ++ +   T    S     I  L S+FL+E   D +KF ++   L YVG  FN I ++ + V    T P +Y  ++ Q+D +
Sbjct:  129 RAVKDLLYWRDILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPFQYYLDADLKL-TTKQAEEI---TARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHY 291          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 78.5666 bits (192), Expect = 8.113e-16
Identity = 52/167 (31.14%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF 664
            RA+K+++ WR  +LS   L    +  + +   S ISV AY  L+ +  ++ LR Y+  ++       ANPFQ YL+ D+ +  TK ++ +   T    S     I  L S+FL+E   D +KF ++   L YVG  FN I ++ + V    T P +Y  ++ Q+D +
Sbjct:  132 RAVKDLLYWRDILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPFQYYLDADLKL-TTKQAEEI---TARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHY 294          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 78.1814 bits (191), Expect = 1.252e-15
Identity = 52/167 (31.14%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF 664
            RA+K+++ WR  +LS   L    +  + +   S ISV AY  L+ +  ++ LR Y+  ++       ANPFQ YL+ D+ +  TK ++ +   T    S     I  L S+FL+E   D +KF ++   L YVG  FN I ++ + V    T P +Y  ++ Q+D +
Sbjct:  125 RAVKDLLYWRDILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPFQYYLDADLKL-TTKQAEEI---TARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHY 287          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: ENSXETT00000037176.1 (reticulon 3 [Source:NCBI gene;Acc:549516])

HSP 1 Score: 75.0998 bits (183), Expect = 4.506e-15
Identity = 49/185 (26.49%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            A+++++ WR    SG +    +V  + +   S ISVI+Y+ L  +  ++  R Y + +      +  +PF+  LEKD+ +     SD      +   +H   A+ Y+  +FL+E  +D +K  L+   + YVG  FN I L+ + V    T P +Y  Y+ QID +       + ++   ++ KL
Sbjct:   43 AVQDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLAVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDIALS----SDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLAFTAPIVYEKYKVQIDHYVSLVHSHVKSITEKIQAKL 223          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn2 (reticulon 2 (Z-band associated protein) [Source:MGI Symbol;Acc:MGI:107612])

HSP 1 Score: 74.7146 bits (182), Expect = 2.995e-15
Identity = 49/192 (25.52%), Postives = 92/192 (47.92%), Query Frame = 2
Query:  182 IKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGP 745
            + +++ W+    SG++    +   + +   S +SV A++ LL + +++ LR Y   +      +  NPFQ YL  DM++ LT+  +     +    SH       L   FL+E  +D +K  L+   L +VG  FN + LV + V  L T P +Y  ++ QID +      ++ ++ A ++ K+     + P
Sbjct:    5 VADLLYWKDTRTSGAVFTGLMASLLCLLHFSIVSVAAHLALLGLCATISLRVYRKVLQAVHRGDGTNPFQAYL--DMDLTLTR--EQTERLSQQIASHVVSTATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGTLAP 192          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn4 (reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835])

HSP 1 Score: 75.485 bits (184), Expect = 3.235e-14
Identity = 45/188 (23.94%), Postives = 92/188 (48.94%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATL 730
            ++ +++ WR    +G +  + L   + +   S +SV AYI L  +  ++  R Y   I     ++  +PF+ YLE ++ +    +  Y    + +   H    I  L  +FL++  +D +KF ++     YVG  FN + L+ + + +L + P IY  ++ QID +   A + + + +A ++ K+  L
Sbjct:  974 SVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKY----SNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGL 1157          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn3 (reticulon 3 [Source:MGI Symbol;Acc:MGI:1339970])

HSP 1 Score: 71.633 bits (174), Expect = 6.009e-14
Identity = 48/185 (25.95%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            A+ ++I WR    +G +  + L+  + +   S ISV++Y+ L  +  ++  R Y + I     +E  +PF+ YL+ D+ +      +Y++        H  KA+  +  +FL+E  +D +K  +    + YVG  FN I L+ +    + + P +Y  Y+ QID +   AR +  ++V  ++ KL
Sbjct:   48 AVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMV----HVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 228          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn2 (reticulon 2 (Z-band associated protein) [Source:MGI Symbol;Acc:MGI:107612])

HSP 1 Score: 72.4034 bits (176), Expect = 1.700e-13
Identity = 49/192 (25.52%), Postives = 92/192 (47.92%), Query Frame = 2
Query:  182 IKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGP 745
            + +++ W+    SG++    +   + +   S +SV A++ LL + +++ LR Y   +      +  NPFQ YL  DM++ LT+  +     +    SH       L   FL+E  +D +K  L+   L +VG  FN + LV + V  L T P +Y  ++ QID +      ++ ++ A ++ K+     + P
Sbjct:  272 VADLLYWKDTRTSGAVFTGLMASLLCLLHFSIVSVAAHLALLGLCATISLRVYRKVLQAVHRGDGTNPFQAYL--DMDLTLTR--EQTERLSQQIASHVVSTATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGTLAP 459          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn4 (reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835])

HSP 1 Score: 68.9366 bits (167), Expect = 2.775e-13
Identity = 45/185 (24.32%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATL 730
            +++ WR    +G +  + L   + +   S +SV AYI L  +  ++  R Y   I     ++  +PF+ YLE ++ +    +  Y    + +   H    I  L  +FL++  +D +KF ++     YVG  FN + L+ + + +L + P IY  ++ QID +   A + + + +A ++ K+  L
Sbjct:   14 DLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKY----SNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGL 194          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q4FZ58|RTN2_XENTR (Reticulon-2 OS=Xenopus tropicalis OX=8364 GN=rtn2 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.668e-15
Identity = 52/167 (31.14%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF 664
            RA+K+++ WR  +LS   L    +  + +   S ISV AY  L+ +  ++ LR Y+  ++       ANPFQ YL+ D+ +  TK ++ +   T    S     I  L S+FL+E   D +KF ++   L YVG  FN I ++ + V    T P +Y  ++ Q+D +
Sbjct:  132 RAVKDLLYWRDILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPFQYYLDADLKL-TTKQAEEI---TARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHY 294          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q5J6M8|RTN3A_XENLA (Reticulon-3-A OS=Xenopus laevis OX=8355 GN=rtn3-a PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 6.669e-15
Identity = 49/185 (26.49%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            A+++++ WR    SG +    +V  + +   S ISVI+Y+ L  +  ++  R Y + +      +  +PF+  LEKD+ +     SD      T   +H   A+ Y+  +FL++  +D +K  L+   + YVG  FN I L+ + V    T P +Y  Y+ QID +      ++ ++   ++ KL
Sbjct:   25 AVRDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLTVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDITLS----SDSFQKALTASLAHVNHALKYIVRLFLVDDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLTFTAPIVYEKYKVQIDHYVSLVHSQVKSITEKIQAKL 205          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q28D16|RTN3_XENTR (Reticulon-3 OS=Xenopus tropicalis OX=8364 GN=rtn3 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.640e-14
Identity = 49/185 (26.49%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            A+++++ WR    SG +    +V  + +   S ISVI+Y+ L  +  ++  R Y + +      +  +PF+  LEKD+ +     SD      +   +H   A+ Y+  +FL+E  +D +K  L+   + YVG  FN I L+ + V    T P +Y  Y+ QID +       + ++   ++ KL
Sbjct:   24 AVQDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLAVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDIALS----SDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLAFTAPIVYEKYKVQIDHYVSLVHSHVKSITEKIQAKL 204          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q4FZ76|RTN2_XENLA (Reticulon-2 OS=Xenopus laevis OX=8355 GN=rtn2 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.732e-14
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF 664
            RA+K+++ WR  +LS   L    +  + +   S ISV AY  L+ +  ++ LR Y+  ++       ANPFQ YL+ D+ +   +  + V        S     +  L S+FL+E   D +KF ++   L YVG  FN I ++ + V    T P +Y  ++ Q+D +
Sbjct:  132 RAVKDLLYWRDTLLSTGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPFQYYLDTDLKLTTKQAEEIV----ARAFSLASTTLCTLRSLFLVEELKDSLKFLVIVYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHY 294          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q68EW1|RTN3B_XENLA (Reticulon-3-B OS=Xenopus laevis OX=8355 GN=rtn3-b PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.160e-14
Identity = 48/185 (25.95%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            A+++++ WR    SG +    +V  + +   S ISVI+Y+ L  +  ++  R Y + +      E  +PF+  LEKD+ +     SD      ++  +H   A+  +  +FL+E  +D +K  L+   + Y+G  FN I L+ + V    T P +Y  Y+ QID +      ++ ++   ++ KL
Sbjct:   25 AVRDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLSVTISFRVYKSVLQAVQKTEEGHPFKPLLEKDIALS----SDSFQKGLSSSLAHVNHALKSIVRLFLVEDLVDSLKLALLMWLMTYIGAVFNGITLLILGVLLAFTTPLVYEKYKVQIDHYVSLVHSQVKSITEKIQAKL 205          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A131Z673 (Reticulon-like protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 8.135e-23
Identity = 68/216 (31.48%), Postives = 111/216 (51.39%), Query Frame = 2
Query:  140 NEFNCSVLESLPR----AIKNIISWRCPILSGSLLVSWLVFAIMIK--TLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVKQ 757
            N    +  E LPR     ++ ++ WR P  SG  LV  LV A+++     S ISV+AY+ L  ++ ++  R Y N +     +   +PF+EYLEKD+++      D VH        H    +A L S+FL+E  +D +K  L+   L YVG  FN + L+ +   +  T PK+Y  Y+ +ID +   AR  + NV+  +K K   +P+ G + ++
Sbjct:    8 NSAAATTAEELPRLDETQLEELVYWRQPKKSG--LVFGLVLAVLLSLTCFSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSL----PKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK---IPMGGQQAQR 214          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A224YQ66 (Reticulon-like protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.009e-22
Identity = 68/216 (31.48%), Postives = 111/216 (51.39%), Query Frame = 2
Query:  140 NEFNCSVLESLPR----AIKNIISWRCPILSGSLLVSWLVFAIMIK--TLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVKQ 757
            N    +  E LPR     ++ ++ WR P  SG  LV  LV A+++     S ISV+AY+ L  ++ ++  R Y N +     +   +PF+EYLEKD+++      D VH        H    +A L S+FL+E  +D +K  L+   L YVG  FN + L+ +   +  T PK+Y  Y+ +ID +   AR  + NV+  +K K   +P+ G + ++
Sbjct:    8 NNAAATTAEELPRLDETQLEELVYWRQPKKSG--LVFGLVLAVLLSLTCFSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSL----PKDRVHETVDVVIKHVDATVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK---IPMGGQQAQR 214          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A293M4H4 (Reticulon-like protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.077e-22
Identity = 66/224 (29.46%), Postives = 114/224 (50.89%), Query Frame = 2
Query:  104 METCDSNEKLIENEFNC--SVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVKQ 757
            M+T +SN K+      C    L ++P+ ++ ++ WRCP  SG      LV  + +   S ISV+A++ L  ++ ++  R Y N +     +   +PF++ LEKD+ +   ++ +     T     H   A+  L S+FL+E  +D +K  +V   L YVG  FN + L+ +    L T PK+Y  Y+ +ID +   AR ++  V+  +K K+     VG K K+
Sbjct:    1 MDTENSNAKVESAPSGCIFRRLLTVPQ-VEELVYWRCPKKSGVAFAGGLVLLLSLTCFSLISVVAHVALGALVVAIAFRVYKNILQAVQKSSEGHPFKDLLEKDVTLPKQRVQEM----TETVVKHVEHAVVRLRSLFLVEDLVDSLKLAVVLWLLTYVGSWFNGMTLIILGYVALFTLPKVYETYKVEIDKYLAVARSQVGGVLGSIKSKIP----VGQKPKE 215          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A212F699 (Reticulon-like protein OS=Danaus plexippus plexippus OX=278856 GN=KGM_209444 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.764e-22
Identity = 68/205 (33.17%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  140 NEFNCSVLESLPRA-IKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN-----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPI 736
            + FN SV E  PR  ++++I WRC   SG+ L + LV  + +   S +SV+AY  LL +++++  R Y N +      NE  +PF+  LEKD++V + +        T    +    A+A L  +FL+E  +D +KF ++   L YVG CFN I L+ +    L T PK Y M + Q+D     AR +I  + A ++   A +P+
Sbjct:    8 SRFNSSV-ELPPRGPVESLIYWRCAARSGAALGAGLVLLVALACCSVVSVLAYGSLLALVAAVAFRIYKNVLQAVQKTNEG-HPFKWLLEKDVSVSVERAQSLAASAT----AQLNAALAELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYEMNKAQVDANLELARAKINEISAKVR---AAVPL 203          
BLAST of Reticulon-like protein vs. TrEMBL
Match: L7MDM0 (Reticulon-like protein (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.117e-21
Identity = 66/216 (30.56%), Postives = 114/216 (52.78%), Query Frame = 2
Query:  140 NEFNCSVLESLPR----AIKNIISWRCPILSGSLLVSWLVFAIMIK--TLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVKQ 757
            N    +  E LPR     ++ ++ WR P  SG  LV  LV A+++     S ISV+AY+ L  ++ ++  R Y N +     +   +PF+EYLEKD+++   ++ + V     + D+     +A L S+FL+E  +D +K  L+   L YVG  FN + L+ +   +  T PK+Y  Y+ +ID +   AR  + NV+  +K K   +P+ G + ++
Sbjct:   88 NSAAATTAEELPRLDETQLEELVYWRQPKKSG--LVFGLVLAVLLSLTCFSLISVVAYLALGSLMVAIAFRVYRNVLQAVQKSSEGHPFKEYLEKDLSLPKERVHETVDVVIKHVDA----TVARLRSLFLVEDLVDSLKLALLFWVLTYVGSWFNGMTLIILAYVSAFTLPKVYETYKTEIDQYLGLARTHVGNVIGTIKSK---IPMGGQQAQR 294          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn3 (reticulon-3-like [Source:NCBI gene;Acc:103032175])

HSP 1 Score: 74.3294 bits (181), Expect = 4.664e-15
Identity = 49/185 (26.49%), Postives = 94/185 (50.81%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            ++ +++ WR P  +G +  + L+  + +   S ISVI+Y+ L  +  ++  R Y + +     +   +PF+  +EKD++V       +V    T    +  +A+  ++ +FL+E  +D +K  +    L YVG  FN I ++ +    + + P +Y   + QID +   AR +I   VA L+EKL
Sbjct:   31 SVHDLVHWRDPKKTGVVFGTSLLLLLSLAAFSVISVISYLLLALLCVTITFRIYKSVVQAVQKSSEGHPFKALMEKDVSVPPETFRKHVDASLT----YINRALKKMSRLFLVEDLVDSLKLAVAMWLLTYVGAVFNGITILILADILIFSVPPLYEKNKTQIDHYIDVARTQINATVAKLQEKL 211          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn4a (reticulon-4-like [Source:NCBI gene;Acc:103037090])

HSP 1 Score: 73.1738 bits (178), Expect = 6.664e-15
Identity = 53/197 (26.90%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVK 754
            + +  ++ WR    +G    + L   + +   S +SVIAYI L  +  ++  R Y   I     +E  +PF+ YLE+D+ +     SD VH  +    + F   +  L  +FL+E  +D +KF ++   L YVG  FN + L+ +    + T P +Y  ++ QID +      ++ +V   +K+  A +P   PK +
Sbjct:    4 KHVVELLHWRDLQRTGVCFGASLFLLLSLSVCSIVSVIAYISLALLSVTISFRIYKGIIQAVQKSEDGHPFKMYLEQDIAIS----SDLVHKYSELALARFNTLVKELRRLFLVEDLVDSLKFAVLMWLLTYVGGLFNGLTLIIIAHIAVFTWPVVYEKHQVQIDHYYELVNNQVKDV---MKKIQAKIPGAKPKTE 193          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn4a (reticulon-4-like [Source:NCBI gene;Acc:103037090])

HSP 1 Score: 72.7886 bits (177), Expect = 1.043e-14
Identity = 53/193 (27.46%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVK 754
             ++ WR    +G    + L   + +   S +SVIAYI L  +  ++  R Y   I     +E  +PF+ YLE+D+ +     SD VH  +    + F   +  L  +FL+E  +D +KF ++   L YVG  FN + L+ +    + T P +Y  ++ QID +      ++ +V   +K+  A +P   PK +
Sbjct:   12 ELLHWRDLQRTGVCFGASLFLLLSLSVCSIVSVIAYISLALLSVTISFRIYKGIIQAVQKSEDGHPFKMYLEQDIAIS----SDLVHKYSELALARFNTLVKELRRLFLVEDLVDSLKFAVLMWLLTYVGGLFNGLTLIIIAHIAVFTWPVVYEKHQVQIDHYYELVNNQVKDV---MKKIQAKIPGAKPKTE 197          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1a (reticulon 1 [Source:NCBI gene;Acc:103026308])

HSP 1 Score: 68.5514 bits (166), Expect = 3.527e-13
Identity = 46/194 (23.71%), Postives = 96/194 (49.48%), Query Frame = 2
Query:  197 SWRCPILSGSL--LVSW-------------LVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            SW+  +++G++  L+ W             L+    +   S +SV+AY+ L  + +++  R Y + +      +  +PF+ YLE ++ +   +IS YV         +    +  L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ + P +Y  Y+ QID +    R ++  ++  ++EK+
Sbjct:   12 SWKGQVMAGTVVDLLHWRDVRQSGLLFGSVLLLLFSLTQFSVVSVVAYLALATLSATISFRVYKSVLQAVQKTDEGHPFKAYLEVEIAMSPEQISKYVD----KVQLYVNYTLKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVVSMFSMPLVYEKYQTQIDQYVGLVRTQVNTIMGKIREKV 201          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn1a (reticulon 1 [Source:NCBI gene;Acc:103026308])

HSP 1 Score: 68.1662 bits (165), Expect = 5.456e-13
Identity = 40/154 (25.97%), Postives = 81/154 (52.60%), Query Frame = 2
Query:  272 SFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            S +SV+AY+ L  + +++  R Y + +      +  +PF+ YLE ++ +   +IS YV         +    +  L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ + P +Y  Y+ QID +    R ++  ++  ++EK+
Sbjct:   47 SVVSVVAYLALATLSATISFRVYKSVLQAVQKTDEGHPFKAYLEVEIAMSPEQISKYVD----KVQLYVNYTLKELRRLFLVQDLVDSIKFAVLMWLLTYVGALFNGLTLLILAVVSMFSMPLVYEKYQTQIDQYVGLVRTQVNTIMGKIREKV 196          
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006786.1 (pep scaffold:Pmarinus_7.0:GL481818:2303:8766:1 gene:ENSPMAG00000006114.1 transcript:ENSPMAT00000006786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 3.910e-15
Identity = 54/200 (27.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query:  167 SLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVK 754
            + P A+ +++ WR    S ++    L+  + +   S +SV+AY+ L  +  ++  R Y + +      E  +PF+EYL+ D+ +       YV    ++ +   R    +L  +FL+   +D +KF +V   L YVG  FN + +V + +    T P +Y  Y+ QID      R+ +  VV    EK+  + I G K K
Sbjct:    5 TTPPAVLDLLYWRDIKTSAAVFGGSLLLLLSLTQFSVVSVLAYLTLAVLSVTISYRVYKSVLQAVQKTEDGHPFREYLDADLAMSPETAQKYVDTALSHVNCQLR----HLRRLFLVHDLVDSIKFAVVLWLLTYVGALFNGLTIVILALIGAFTVPMVYEKYQVQIDQQVGMVRKHVGEVV----EKVQAM-IPGAKRK 195          
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007319.1 (pep scaffold:Pmarinus_7.0:GL490398:662:6495:-1 gene:ENSPMAG00000006605.1 transcript:ENSPMAT00000007319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 3.205e-12
Identity = 37/128 (28.91%), Postives = 66/128 (51.56%), Query Frame = 2
Query:  353 NNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPI 736
             +++ +PF+  LE D+ V    +  ++        + F   +  L  +FL+E  +D +KF ++   L Y+G  FN + L+ + V TL T P +Y  Y+ QID +   AR  +  V+A  K +L+  P+
Sbjct:   65 KSDSGHPFRACLECDLGVSQATVETHLDVAL----ARFNAVVRELRRLFLVEDLVDSLKFAVLMWLLTYIGAIFNGLTLLILGVLTLFTAPVVYEKYQKQIDHYLALARSNLNGVIA--KGELSRAPL 186          
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Match: EDO30766 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:A7SZV0])

HSP 1 Score: 51.2174 bits (121), Expect = 8.571e-8
Identity = 37/144 (25.69%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  242 LVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDD 661
            LV  I +   S +SVI +  +  +  +++ R     +     +   NPF+  L+K++ +   K  +    E+  E  H       L  +FL+E  +D +KF ++   L YVG  F+++ L+   V  + + PK+Y  Y+ +ID+
Sbjct:   23 LVVLISLSCCSLLSVITFFSMAVLTVALLYRVGMTVMGAIQKSGTENPFKTLLDKEIEIPKEKAVEMA--ESLAE--HINCLTKSLRRLFLVEDIVDSIKFGVMLWVLSYVGAWFSMLTLIIFAVVMVFSLPKVYEEYQDKIDE 162          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn4a (reticulon-4 [Source:NCBI gene;Acc:101163104])

HSP 1 Score: 76.2554 bits (186), Expect = 5.763e-16
Identity = 49/190 (25.79%), Postives = 96/190 (50.53%), Query Frame = 2
Query:  173 PRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATL 730
             + + +++ WR    +G +  + L+  + +   S +SV +YIGL  +  ++  R Y   +     ++  +PF++YL  D  V L++  + VH  +    S   K I  L  +FL+E  +D +KF ++   L YVG  FN + L+ + +    TCP +Y  ++ QID +      ++ +VV  ++ K+  +
Sbjct:    3 AKQVVDLLYWRDVKNTGVVFGAALLLLLSLTMCSIVSVCSYIGLALLSVTICFRIYKGILQAIQKSDEGHPFKQYL--DQEVALSE--EMVHKYSDVALSKLNKTIGELRRVFLVEDLVDSIKFAVLMWILTYVGAFFNGLTLIILGLIAAFTCPIVYEKHQAQIDHYVALVNNQVKDVVGKIQAKVPGM 188          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn3 (reticulon-3-B [Source:NCBI gene;Acc:101170222])

HSP 1 Score: 72.0182 bits (175), Expect = 8.021e-14
Identity = 50/185 (27.03%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  179 AIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            ++K++I WR P  SG +    L+  + +   S ISV +Y+ L  +I ++  R Y + +     +   +PF+  + KD+++       +V    T    +  + +  ++ +FL+E  +D +K  +V   L YVG  FN I L+ +    L   P +Y   + QID +    R ++   VA L+EKL
Sbjct:  102 SVKDLIHWRDPKKSGVVFGLSLLMLLSLAAFSVISVASYLLLALLIVTISFRIYKSVLQAVQKSNDGHPFKMLINKDVSIPPETFRKHVDASLT----YINRGLKQMSRLFLVEDLVDSLKLAVVMWLLTYVGAVFNGITLLILADILLFAVPPVYEKNKTQIDQYIDVVRTQVNATVAKLQEKL 282          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 56.225 bits (134), Expect = 5.672e-9
Identity = 45/182 (24.73%), Postives = 94/182 (51.65%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKL 721
            +++ WR    SG++  S L+    +   S +SV AY+ L  + +++  R Y + +      +  +PF+ YLE ++ +   +I+ Y        ++  ++    L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ T P +Y  ++ QID +    R ++ +VV  ++ K+
Sbjct:    7 DLLYWRNVKQSGAVFSSVLLLLFSLTQFSVVSVGAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLEMEIALSQDQITKYADKILLYTNTCMKE----LRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAKI 184          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 55.8398 bits (133), Expect = 9.230e-9
Identity = 51/198 (25.76%), Postives = 97/198 (48.99%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVH----YETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVKQ 757
            +++ WR    SG++  S L+    +   S +SV AY+ L  + +++  R Y + +      +  +PF+ YLE ++ +   +I+ Y      Y  T         +  L  +FL++  +D +KF ++   L YVG  FN + L+ + V ++ T P +Y  ++ QID +    R ++ +VV  ++ K     I G K K+
Sbjct:   23 DLLYWRNVKQSGAVFSSVLLLLFSLTQFSVVSVGAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLEMEIALSQDQITKYADKILLYTNT--------CMKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAK-----IPGTKRKE 207          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: ENSORLT00000043478.1 (pep primary_assembly:ASM223467v1:1:24997:55021:-1 gene:ENSORLG00000025847.1 transcript:ENSORLT00000043478.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 4.226e-7
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 2
Query:  188 NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFIN----NEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLV 592
             +I+WR P  S +     L+  I + TLS ISV++Y+ L  +  ++  R Y + I     ++  +PF+  LEKD+++     S+ V         H     +    + L+E  +D +K   V   + YVG  FN I ++
Sbjct:    5 QLINWREPKRSAAAFGLSLLVLISVATLSVISVLSYLVLACLCVTITFRIYKSVIQAIQKSDEGHPFRSLLEKDISIS----SEAVRELGDQCLLHLNCFTSRTRRLLLVEDLVDSLKLATVMWVMTYVGGMFNGITIL 139          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000002945.1 (SMESG000002945.1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.756e-157
Identity = 216/219 (98.63%), Postives = 218/219 (99.54%), Query Frame = 2
Query:  104 METCDSNEKLIENEFNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKVKQM 760
            METCDSNEKLIENEFNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVN+ALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDF IKAR+RILNVVAILKEKLATLPIVGPKVKQM
Sbjct:    1 METCDSNEKLIENEFNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNVALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFVIKARERILNVVAILKEKLATLPIVGPKVKQM 219          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.412e-24
Identity = 64/214 (29.91%), Postives = 104/214 (48.60%), Query Frame = 2
Query:  104 METCDSNEKLIENEFNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGP 745
            M   D+    +ENE         P+  KNII WR P+ + ++L+S L   I +   S ISV+AY GL F+I +   R Y  F      N  Q YL+KD+ +  +K S +        D+   K    + S+ L+E Y + +K  +    + Y+G  FN + L  +    +   PKIY  Y+ ++D+       +I  V++ L +K+  LP++GP
Sbjct:    1 MSISDTEHSAVENE---------PKDFKNIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLK----IRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGP 201          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.241e-22
Identity = 64/222 (28.83%), Postives = 107/222 (48.20%), Query Frame = 2
Query:  104 METCDSNEKLIENE--------FNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGP 745
            M   D+    +ENE        +  + +E L   I +II WR P+ + ++L+S L   I +   S ISV+AY GL F+I +   R Y  F      N  Q YL+KD+ +  +K S +        D+   K    + S+ L+E Y + +K  +    + Y+G  FN + L  +    +   PKIY  Y+ ++D+       +I  V++ L +K+  LP++GP
Sbjct:    1 MSISDTEHSAVENEPKDFKNRKYFGNQIEILNHPILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLK----IRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGP 218          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.452e-22
Identity = 63/216 (29.17%), Postives = 104/216 (48.15%), Query Frame = 2
Query:  104 METCDSNEKLIENEFNCSVLESLPRAIK--NIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGP 745
            M   D+    +ENE         P+  K  +II WR P+ + ++L+S L   I +   S ISV+AY GL F+I +   R Y  F      N  Q YL+KD+ +  +K S +        D+   K    + S+ L+E Y + +K  +    + Y+G  FN + L  +    +   PKIY  Y+ ++D+       +I  V++ L +K+  LP++GP
Sbjct:    1 MSISDTEHSAVENE---------PKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLK----IRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGP 203          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000007676.1 (SMESG000007676.1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.080e-7
Identity = 55/197 (27.92%), Postives = 91/197 (46.19%), Query Frame = 2
Query:  176 RAIKNIISWRCPILSGSLLVSWLVFAI-MIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYL----NSIFLLESYLDGVKFFLVNIALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVAILKEKLATLPIVGPKV 751
            R  K+I+ W+ P++S  +L   +V  + +I   S IS++AY GLL + SS   +    F      N  ++  + + N+ +T  SD V            K I YL     S+  + S+   +K F     L Y+G  FNL+ L+ +    L + P IY+ Y+  ID    + R +I + +   K K     I+G +V
Sbjct:  294 RKFKDIVCWKDPVMSSVVLSVIMVIELGLILDYSIISLMAYSGLLLLFSSFFYKVAVKF------NLVKKCDQSNCNISVT--SDDVQLCV----DCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQ--ILGRRV 476          
The following BLAST results are available for this feature:
BLAST of Reticulon-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTN41.255e-1323.94reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN31.291e-1325.41reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469][more]
RTN36.207e-1325.00reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469][more]
RTN47.579e-1324.32reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN49.087e-1224.47reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulon-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtnl11.123e-1529.89gene:FBgn0053113 transcript:FBtr0332413[more]
Rtnl11.471e-1529.67gene:FBgn0053113 transcript:FBtr0079040[more]
Rtnl11.471e-1529.67gene:FBgn0053113 transcript:FBtr0301540[more]
Rtnl11.471e-1529.67gene:FBgn0053113 transcript:FBtr0301539[more]
Rtnl11.471e-1529.67gene:FBgn0053113 transcript:FBtr0079039[more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn1a6.033e-1725.53reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn1a9.385e-1726.37reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn1a2.284e-1526.23reticulon 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2426... [more]
rtn4a2.290e-1525.38reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1][more]
rtn4a2.290e-1525.38reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs34.347e-1631.14regulator of G-protein signaling 3 [Source:Xenbase... [more]
rgs36.425e-1631.14regulator of G-protein signaling 3 [Source:Xenbase... [more]
rgs38.113e-1631.14regulator of G-protein signaling 3 [Source:Xenbase... [more]
rgs31.252e-1531.14regulator of G-protein signaling 3 [Source:Xenbase... [more]
ENSXETT00000037176.14.506e-1526.49reticulon 3 [Source:NCBI gene;Acc:549516][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtn22.995e-1525.52reticulon 2 (Z-band associated protein) [Source:MG... [more]
Rtn43.235e-1423.94reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835][more]
Rtn36.009e-1425.95reticulon 3 [Source:MGI Symbol;Acc:MGI:1339970][more]
Rtn21.700e-1325.52reticulon 2 (Z-band associated protein) [Source:MG... [more]
Rtn42.775e-1324.32reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835][more]
back to top
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4FZ58|RTN2_XENTR5.668e-1531.14Reticulon-2 OS=Xenopus tropicalis OX=8364 GN=rtn2 ... [more]
sp|Q5J6M8|RTN3A_XENLA6.669e-1526.49Reticulon-3-A OS=Xenopus laevis OX=8355 GN=rtn3-a ... [more]
sp|Q28D16|RTN3_XENTR1.640e-1426.49Reticulon-3 OS=Xenopus tropicalis OX=8364 GN=rtn3 ... [more]
sp|Q4FZ76|RTN2_XENLA1.732e-1429.34Reticulon-2 OS=Xenopus laevis OX=8355 GN=rtn2 PE=2... [more]
sp|Q68EW1|RTN3B_XENLA6.160e-1425.95Reticulon-3-B OS=Xenopus laevis OX=8355 GN=rtn3-b ... [more]
back to top
BLAST of Reticulon-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131Z6738.135e-2331.48Reticulon-like protein OS=Rhipicephalus appendicul... [more]
A0A224YQ661.009e-2231.48Reticulon-like protein OS=Rhipicephalus zambeziens... [more]
A0A293M4H41.077e-2229.46Reticulon-like protein (Fragment) OS=Ornithodoros ... [more]
A0A212F6994.764e-2233.17Reticulon-like protein OS=Danaus plexippus plexipp... [more]
L7MDM02.117e-2130.56Reticulon-like protein (Fragment) OS=Rhipicephalus... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn34.664e-1526.49reticulon-3-like [Source:NCBI gene;Acc:103032175][more]
rtn4a6.664e-1526.90reticulon-4-like [Source:NCBI gene;Acc:103037090][more]
rtn4a1.043e-1427.46reticulon-4-like [Source:NCBI gene;Acc:103037090][more]
rtn1a3.527e-1323.71reticulon 1 [Source:NCBI gene;Acc:103026308][more]
rtn1a5.456e-1325.97reticulon 1 [Source:NCBI gene;Acc:103026308][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006786.13.910e-1527.00pep scaffold:Pmarinus_7.0:GL481818:2303:8766:1 gen... [more]
ENSPMAT00000007319.13.205e-1228.91pep scaffold:Pmarinus_7.0:GL490398:662:6495:-1 gen... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO307668.571e-825.69Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn4a5.763e-1625.79reticulon-4 [Source:NCBI gene;Acc:101163104][more]
rtn38.021e-1427.03reticulon-3-B [Source:NCBI gene;Acc:101170222][more]
rtn1b5.672e-924.73reticulon 1 [Source:NCBI gene;Acc:101155557][more]
rtn1b9.230e-925.76reticulon 1 [Source:NCBI gene;Acc:101155557][more]
ENSORLT00000043478.14.226e-727.34pep primary_assembly:ASM223467v1:1:24997:55021:-1 ... [more]
back to top
BLAST of Reticulon-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002945.11.756e-15798.63SMESG000002945.1[more]
SMESG000079873.11.412e-2429.91SMESG000079873.1[more]
SMESG000079873.14.241e-2228.83SMESG000079873.1[more]
SMESG000079873.14.452e-2229.17SMESG000079873.1[more]
SMESG000007676.12.080e-727.92SMESG000007676.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010219 ID=SMED30010219|Name=Reticulon-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1101bp
TGAAAATGGTTGGTTTAAATATATTTTTTAAATCTATAAATTAAAATTAT
TTTAACAAAGAAAAGTTAGTCATATTGTTTTATATTTAATAACGTTATTT
AGAATGGAAACCTGTGATTCTAACGAAAAACTGATAGAAAATGAATTCAA
CTGCTCCGTTTTGGAATCCTTACCCAGAGCTATTAAGAACATAATATCTT
GGCGTTGCCCAATATTAAGTGGTTCACTATTAGTCTCCTGGCTAGTGTTT
GCAATTATGATTAAAACATTGTCATTTATATCGGTTATTGCATATATTGG
ATTATTGTTTATAATATCATCCATGATTTTGCGATTTTATTCCAACTTCA
TTAATAATGAAGCAGCAAACCCATTCCAAGAATATTTAGAAAAAGATATG
AATGTTTATTTAACTAAAATATCTGACTATGTACATTATGAAACAACTAA
CGAAGATAGTCATTTCAGGAAAGCCATAGCGTATTTAAATTCGATATTTC
TTTTAGAGAGTTACTTAGATGGTGTTAAGTTTTTCTTAGTTAATATAGCA
TTGATCTATGTTGGCATGTGTTTTAATCTTATTGATTTGGTAAGTGTTAC
AGTATTTACACTGTTGACATGTCCAAAAATATATTCCATGTATAGACCAC
AGATCGATGATTTTGCTATCAAAGCACGTCAACGAATCCTAAATGTTGTC
GCTATATTGAAGGAGAAATTAGCAACACTTCCTATTGTGGGGCCTAAAGT
GAAGCAAATGTGAACAATGGGAAAGAGAATTAAATTGAGATATGTAATTG
GTTGATTAAATGTTTGTGTGTGTTAACCAAATAAATTATTGACTTGATTA
ATAACTTCTGTTATCTTGTTTTAACAATGATTGGTTGATTTAATAGTGTG
CCTCTTATACTCTGTCTGATTTTTGTGGACTTTGTAATTGTCGTCTTTGT
TACGTGTTTCAGTTGACTGCTGAAATTTTGGTTTTGTAATTTATATGGTT
AAGTTGAAATTAACAATTGTGATACTGTTTACGTCATCAAGGAAGCTTCA
TTAATATTATTGTAAATATTTAATGTCAAATAAAAAATTATAATTTAAAA
A
back to top

protein sequence of SMED30010219-orf-1

>SMED30010219-orf-1 ID=SMED30010219-orf-1|Name=SMED30010219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
METCDSNEKLIENEFNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFA
IMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMN
VYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNIAL
IYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFAIKARQRILNVVA
ILKEKLATLPIVGPKVKQM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR003388Reticulon
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003388ReticulonPFAMPF02453Reticuloncoord: 29..190
e-value: 3.5E-21
score: 75.8
IPR003388ReticulonPROSITEPS50845RETICULONcoord: 27..219
score: 23.888
NoneNo IPR availablePANTHERPTHR45799FAMILY NOT NAMEDcoord: 25..209
NoneNo IPR availablePANTHERPTHR45799:SF2RETICULON-LIKE PROTEINcoord: 25..209
NoneNo IPR availableTMHMMTMhelixcoord: 30..49
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 149..171