RNA-binding protein 4B

Overview
NameRNA-binding protein 4B
Smed IDSMED30010217
Length (bp)1141
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein 4B (SMED30010217) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein 4B (SMED30010217) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein 4B (SMED30010217) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein 4B (SMED30010217) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010217

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010217SMESG000059552.1 SmedASXL_011859SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010217SMESG000059552.1 SmedASXL_011859SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30010217SMESG000059552.1 dd_Smed_v4_1566_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010217SMESG000059552.1 dd_Smed_v4_1566_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010217SMESG000059552.1 dd_Smed_v4_1566_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010217SMESG000059552.1 dd_Smed_v4_1566_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010217SMESG000059552.1 dd_Smed_v4_1566_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein 4B vs. Ensembl Human
Match: RBM4 (RNA binding motif protein 4 [Source:HGNC Symbol;Acc:HGNC:9901])

HSP 1 Score: 61.2326 bits (147), Expect = 9.583e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKTSTKLHV 82          

HSP 2 Score: 48.1358 bits (113), Expect = 3.126e-6
Identity = 18/64 (28.12%), Postives = 38/64 (59.38%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIA 233
            KL VGN+ P+ +N+ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++   + 
Sbjct:   79 KLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQDIQLC 142          
BLAST of RNA-binding protein 4B vs. Ensembl Human
Match: RBM4B (RNA binding motif protein 4B [Source:HGNC Symbol;Acc:HGNC:28842])

HSP 1 Score: 61.2326 bits (147), Expect = 9.631e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 52.7582 bits (125), Expect = 6.560e-8
Identity = 20/61 (32.79%), Postives = 39/61 (63.93%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGF 224
            KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G+
Sbjct:   79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGW 139          
BLAST of RNA-binding protein 4B vs. Ensembl Human
Match: RBM4 (RNA binding motif protein 4 [Source:HGNC Symbol;Acc:HGNC:9901])

HSP 1 Score: 60.8474 bits (146), Expect = 1.127e-10
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKTSTKLHV 82          

HSP 2 Score: 50.0618 bits (118), Expect = 5.296e-7
Identity = 19/60 (31.67%), Postives = 38/60 (63.33%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRG 221
            KL VGN+ P+ +N+ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G
Sbjct:   79 KLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG 138          
BLAST of RNA-binding protein 4B vs. Ensembl Human
Match: RBM4 (RNA binding motif protein 4 [Source:HGNC Symbol;Acc:HGNC:9901])

HSP 1 Score: 60.8474 bits (146), Expect = 1.127e-10
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKTSTKLHV 82          

HSP 2 Score: 50.0618 bits (118), Expect = 5.296e-7
Identity = 19/60 (31.67%), Postives = 38/60 (63.33%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRG 221
            KL VGN+ P+ +N+ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G
Sbjct:   79 KLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG 138          
BLAST of RNA-binding protein 4B vs. Ensembl Human
Match: RBM4B (RNA binding motif protein 4B [Source:HGNC Symbol;Acc:HGNC:28842])

HSP 1 Score: 60.8474 bits (146), Expect = 1.195e-10
Identity = 27/79 (34.18%), Postives = 49/79 (62.03%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRK 272
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTK 79          

HSP 2 Score: 53.9138 bits (128), Expect = 2.363e-8
Identity = 22/64 (34.38%), Postives = 40/64 (62.50%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIA 233
            KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  IA
Sbjct:   79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGRIIA 142          
BLAST of RNA-binding protein 4B vs. Ensembl Celegans
Match: rsp-2 (Probable splicing factor, arginine/serine-rich 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23120])

HSP 1 Score: 54.6842 bits (130), Expect = 3.220e-8
Identity = 24/71 (33.80%), Postives = 43/71 (60.56%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            MV++++G LP  AS++ ++  F+ Y  L D  + + +GFV  + Q  A  AV+++NG E  G  + ++F R
Sbjct:    1 MVRVYIGRLPNRASDRDVEHFFRGYGKLSDVIMKNGFGFVDFQDQRDADDAVHDLNGKELCGERVILEFPR 71          
BLAST of RNA-binding protein 4B vs. Ensembl Fly
Match: lark (gene:FBgn0011640 transcript:FBtr0076843)

HSP 1 Score: 58.151 bits (139), Expect = 4.308e-9
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKI 299
            KLF+GNL        L+ +F+ Y  + +  ++ NYGFV++ET++    A+ N+NG     F I V+ A+      R+A  T   KI
Sbjct:    8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKVEAAKS-----RRAPNTPTTKI 88          
BLAST of RNA-binding protein 4B vs. Ensembl Fly
Match: lark (gene:FBgn0011640 transcript:FBtr0076844)

HSP 1 Score: 58.151 bits (139), Expect = 4.308e-9
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKI 299
            KLF+GNL        L+ +F+ Y  + +  ++ NYGFV++ET++    A+ N+NG     F I V+ A+      R+A  T   KI
Sbjct:    8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKVEAAKS-----RRAPNTPTTKI 88          
BLAST of RNA-binding protein 4B vs. Ensembl Fly
Match: lark (gene:FBgn0011640 transcript:FBtr0076842)

HSP 1 Score: 58.151 bits (139), Expect = 4.308e-9
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKI 299
            KLF+GNL        L+ +F+ Y  + +  ++ NYGFV++ET++    A+ N+NG     F I V+ A+      R+A  T   KI
Sbjct:    8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKVEAAKS-----RRAPNTPTTKI 88          
BLAST of RNA-binding protein 4B vs. Ensembl Fly
Match: lark (gene:FBgn0011640 transcript:FBtr0076841)

HSP 1 Score: 58.151 bits (139), Expect = 4.308e-9
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKI 299
            KLF+GNL        L+ +F+ Y  + +  ++ NYGFV++ET++    A+ N+NG     F I V+ A+      R+A  T   KI
Sbjct:    8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKVEAAKS-----RRAPNTPTTKI 88          
BLAST of RNA-binding protein 4B vs. Ensembl Fly
Match: lark (gene:FBgn0011640 transcript:FBtr0076845)

HSP 1 Score: 58.151 bits (139), Expect = 4.308e-9
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKI 299
            KLF+GNL        L+ +F+ Y  + +  ++ NYGFV++ET++    A+ N+NG     F I V+ A+      R+A  T   KI
Sbjct:    8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKVEAAKS-----RRAPNTPTTKI 88          
BLAST of RNA-binding protein 4B vs. Ensembl Zebrafish
Match: rbm4.3 (RNA binding motif protein 4.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1938])

HSP 1 Score: 60.4622 bits (145), Expect = 8.263e-10
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENK 296
            MVK+F+GNLP  A    LK +F  Y  + +  +I N+ FV+++ ++SA  A+ N++  +  G  I V+ +R  NQ   K  +    K
Sbjct:    1 MVKIFIGNLPQQAEVDELKSLFSQYGTVTECAIIKNFAFVHMDDRKSATKAIKNLHLYKLHGTPINVEASRGKNQGPVKLHVANVEK 87          
BLAST of RNA-binding protein 4B vs. Ensembl Zebrafish
Match: rbm4.3 (RNA binding motif protein 4.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1938])

HSP 1 Score: 60.4622 bits (145), Expect = 8.263e-10
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENK 296
            MVK+F+GNLP  A    LK +F  Y  + +  +I N+ FV+++ ++SA  A+ N++  +  G  I V+ +R  NQ   K  +    K
Sbjct:    1 MVKIFIGNLPQQAEVDELKSLFSQYGTVTECAIIKNFAFVHMDDRKSATKAIKNLHLYKLHGTPINVEASRGKNQGPVKLHVANVEK 87          
BLAST of RNA-binding protein 4B vs. Ensembl Zebrafish
Match: zgc:77262 (zgc:77262 [Source:ZFIN;Acc:ZDB-GENE-040426-1811])

HSP 1 Score: 59.6918 bits (143), Expect = 1.554e-9
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
            MVK+FVGN+  + +   L+ +F+ Y  + D  ++ NYGFV+++ +E+A  AV+ ++  E  G  I V++A
Sbjct:    1 MVKIFVGNVASATTEDELRALFEKYGAVSDCDILKNYGFVHMDEEEAAQKAVSALHKHEVNGSRITVEYA 70          

HSP 2 Score: 51.9878 bits (123), Expect = 4.572e-7
Identity = 22/76 (28.95%), Postives = 43/76 (56.58%), Query Frame = 3
Query:   27 IFNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAREN 254
            + N  K++VGN+P   +   +KE+FQ +  + +  ++ NY FV+++ +  A+ A+  +N  +  G  I V  +R N
Sbjct:   74 VRNATKIYVGNVPEGVAAAKIKELFQPFGKVVECDIVKNYAFVHMQRENEALDAIAKLNHSKVDGQKIFVSLSRSN 149          
BLAST of RNA-binding protein 4B vs. Ensembl Zebrafish
Match: rbm4.2 (RNA binding motif protein 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-3019])

HSP 1 Score: 56.6102 bits (135), Expect = 2.210e-8
Identity = 21/71 (29.58%), Postives = 47/71 (66.20%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            MVK+F+GNL P+++   L+ +F  +  +++  ++ NYGFV++++++ A  A+  ++  E +G  I V+ ++
Sbjct:    1 MVKIFIGNLSPTSTADDLRSLFSEFGIVKECDVLKNYGFVHMDSKKEAEAAIRKLHHYELKGQAINVELSK 71          
BLAST of RNA-binding protein 4B vs. Ensembl Zebrafish
Match: rbm4.2 (RNA binding motif protein 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-3019])

HSP 1 Score: 56.6102 bits (135), Expect = 2.210e-8
Identity = 21/71 (29.58%), Postives = 47/71 (66.20%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            MVK+F+GNL P+++   L+ +F  +  +++  ++ NYGFV++++++ A  A+  ++  E +G  I V+ ++
Sbjct:    1 MVKIFIGNLSPTSTADDLRSLFSEFGIVKECDVLKNYGFVHMDSKKEAEAAIRKLHHYELKGQAINVELSK 71          
BLAST of RNA-binding protein 4B vs. Ensembl Xenopus
Match: rbm4b (NF-kappa-B inhibitor zeta-like [Source:Xenbase;Acc:XB-GENE-5965587])

HSP 1 Score: 66.6254 bits (161), Expect = 1.154e-11
Identity = 31/83 (37.35%), Postives = 51/83 (61.45%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADIT 284
            MVKLFVGNLPP A+   LK +F+ +  + +  +I NYGFV++E +++A  AV+N+N  +     I V+ +R   +   K  ++
Sbjct:    1 MVKLFVGNLPPEATQSELKSLFEQFGRVTECDIIKNYGFVHMEDRKAADEAVHNLNHYKLHSVPINVEHSRGKPKASTKLHVS 83          
BLAST of RNA-binding protein 4B vs. Ensembl Xenopus
Match: snx15 (sorting nexin 15 [Source:NCBI gene;Acc:734054])

HSP 1 Score: 63.929 bits (154), Expect = 1.883e-10
Identity = 31/102 (30.39%), Postives = 58/102 (56.86%), Query Frame = 3
Query:   15 VYILIFNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQ 320
             +IL   MVK+FVG + PSAS   LK++F+ Y  + +  ++ NY FV++E ++ A  A++ ++  E+ G  + V++A   ++++    I   N  S+    Q
Sbjct:  310 TWILAIAMVKIFVGGVSPSASPDELKKLFERYGQVNECDILKNYAFVHMEREQDAHRAISELHKQEFYGSHLTVEYA--TSKIRNATKIYVGNVSSRATTSQ 409          
BLAST of RNA-binding protein 4B vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 55.0694 bits (131), Expect = 1.117e-7
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = 3
Query:   45 LFVGNLPPSASNQSLKEIFQNYKDLQDYKLI--------SNYGFVYLETQESAIHAVNNINGLEYRGFTIAVD-FARENNQLKRKADITTENKISKP 308
            +FVGN+P  A+ + LK+IF     +  ++L+          YGF   + QE+A+ A+ N+NG E+ G  + VD  A E N+ + K+  T    I  P
Sbjct:   18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPIIESP 114          
BLAST of RNA-binding protein 4B vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 55.0694 bits (131), Expect = 1.195e-7
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = 3
Query:   45 LFVGNLPPSASNQSLKEIFQNYKDLQDYKLI--------SNYGFVYLETQESAIHAVNNINGLEYRGFTIAVD-FARENNQLKRKADITTENKISKP 308
            +FVGN+P  A+ + LK+IF     +  ++L+          YGF   + QE+A+ A+ N+NG E+ G  + VD  A E N+ + K+  T    I  P
Sbjct:   18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPIIESP 114          
BLAST of RNA-binding protein 4B vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 55.0694 bits (131), Expect = 1.255e-7
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = 3
Query:   45 LFVGNLPPSASNQSLKEIFQNYKDLQDYKLI--------SNYGFVYLETQESAIHAVNNINGLEYRGFTIAVD-FARENNQLKRKADITTENKISKP 308
            +FVGN+P  A+ + LK+IF     +  ++L+          YGF   + QE+A+ A+ N+NG E+ G  + VD  A E N+ + K+  T    I  P
Sbjct:   18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPIIESP 114          
BLAST of RNA-binding protein 4B vs. Ensembl Mouse
Match: Rbm4b (RNA binding motif protein 4B [Source:MGI Symbol;Acc:MGI:1913954])

HSP 1 Score: 61.2326 bits (147), Expect = 5.887e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 51.9878 bits (123), Expect = 9.752e-8
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRG 221
            KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G
Sbjct:   79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG 138          
BLAST of RNA-binding protein 4B vs. Ensembl Mouse
Match: Rbm4 (RNA binding motif protein 4 [Source:MGI Symbol;Acc:MGI:1100865])

HSP 1 Score: 61.6178 bits (148), Expect = 6.770e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 52.373 bits (124), Expect = 1.022e-7
Identity = 21/69 (30.43%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  + V  +
Sbjct:   78 TKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146          
BLAST of RNA-binding protein 4B vs. Ensembl Mouse
Match: Rbm4 (RNA binding motif protein 4 [Source:MGI Symbol;Acc:MGI:1100865])

HSP 1 Score: 60.4622 bits (145), Expect = 8.363e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 51.6026 bits (122), Expect = 1.051e-7
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRG 221
            KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G
Sbjct:   79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG 138          
BLAST of RNA-binding protein 4B vs. Ensembl Mouse
Match: Rbm4 (RNA binding motif protein 4 [Source:MGI Symbol;Acc:MGI:1100865])

HSP 1 Score: 60.4622 bits (145), Expect = 8.363e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 51.6026 bits (122), Expect = 1.051e-7
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRG 221
            KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G
Sbjct:   79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG 138          
BLAST of RNA-binding protein 4B vs. Ensembl Mouse
Match: Rbm4b (RNA binding motif protein 4B [Source:MGI Symbol;Acc:MGI:1913954])

HSP 1 Score: 60.4622 bits (145), Expect = 8.760e-11
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 49.6766 bits (117), Expect = 6.115e-7
Identity = 19/61 (31.15%), Postives = 37/61 (60.66%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGF 224
            KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++  
Sbjct:   79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQAV 139          
BLAST of RNA-binding protein 4B vs. UniProt/SwissProt
Match: sp|Q64LC9|RBM4B_RAT (RNA-binding protein 4B OS=Rattus norvegicus OX=10116 GN=Rbm4b PE=2 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 2.141e-9
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 52.7582 bits (125), Expect = 2.178e-6
Identity = 21/69 (30.43%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  + V  +
Sbjct:   78 TKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146          
BLAST of RNA-binding protein 4B vs. UniProt/SwissProt
Match: sp|Q8VE92|RBM4B_MOUSE (RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.141e-9
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 52.7582 bits (125), Expect = 2.178e-6
Identity = 21/69 (30.43%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  + V  +
Sbjct:   78 TKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146          
BLAST of RNA-binding protein 4B vs. UniProt/SwissProt
Match: sp|Q9BQ04|RBM4B_HUMAN (RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.179e-9
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHV 82          

HSP 2 Score: 52.7582 bits (125), Expect = 2.251e-6
Identity = 21/69 (30.43%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+ P+ +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  + V  +
Sbjct:   78 TKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146          
BLAST of RNA-binding protein 4B vs. UniProt/SwissProt
Match: sp|Q4R979|RBM4_MACFA (RNA-binding protein 4 OS=Macaca fascicularis OX=9541 GN=RBM4 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.204e-9
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKTSTKLHV 82          

HSP 2 Score: 51.2174 bits (121), Expect = 7.094e-6
Identity = 20/69 (28.99%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+ P+ +N+ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  + V  +
Sbjct:   78 TKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146          
BLAST of RNA-binding protein 4B vs. UniProt/SwissProt
Match: sp|Q9BWF3|RBM4_HUMAN (RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.204e-9
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVKLF+GNLP  A+ Q ++ +F+ Y  + +  +I NYGFV++E + +A  A+ N++  +  G  I V+ ++  ++   K  +
Sbjct:    1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKTSTKLHV 82          

HSP 2 Score: 51.2174 bits (121), Expect = 7.094e-6
Identity = 20/69 (28.99%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+ P+ +N+ L+  F+ Y  + +  ++ +Y FV++E  E A+ A+  ++  E++G  + V  +
Sbjct:   78 TKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146          
BLAST of RNA-binding protein 4B vs. TrEMBL
Match: C1C3T3 (RNA-binding protein 4B OS=Lithobates catesbeianus OX=8400 GN=RBM4B PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.495e-11
Identity = 33/84 (39.29%), Postives = 55/84 (65.48%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITT 287
            MVKLFVGNLPP+A+   LK +F+ +  + +  +I+NY FV++E ++SA  AVNN+N  +  G +I V+ +R   +   K  +++
Sbjct:    1 MVKLFVGNLPPAATQTELKSLFEQFGKVSECDIITNYAFVHMEDKKSADEAVNNLNQCKLHGVSINVEHSRGKPRASTKLHVSS 84          
BLAST of RNA-binding protein 4B vs. TrEMBL
Match: A0A0P7UHK0 (RRM domain-containing protein (Fragment) OS=Scleropages formosus OX=113540 GN=Z043_113650 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 5.209e-9
Identity = 29/70 (41.43%), Postives = 46/70 (65.71%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
            MVK+FVGN+  S + Q L+E+F+ Y  + D  ++ NYGFV++E +E+A  AV  ++  E  G  I V++A
Sbjct:   10 MVKIFVGNVNSSTTEQELRELFEKYGAVSDCDILKNYGFVHMEEEEAAQKAVAALHKHELNGSRITVEYA 79          
BLAST of RNA-binding protein 4B vs. TrEMBL
Match: A0A444T0K6 (RNA-binding protein 14 OS=Armadillidium vulgare OX=13347 GN=Avbf_04914 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.874e-9
Identity = 24/67 (35.82%), Postives = 46/67 (68.66%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVD 239
             K+FVG LPPS  +  L+++F+ Y ++ +  ++ NY FV+++ +E A +A+ N+N  + +GF I+V+
Sbjct:    5 TKIFVGKLPPSCKDYELRKLFERYGEVTECSILGNYAFVHMKGEEEAANAIRNLNNWDLKGFKISVE 71          
BLAST of RNA-binding protein 4B vs. TrEMBL
Match: A0A550C3B4 (Uncharacterized protein OS=Auriculariopsis ampla OX=97359 GN=BD626DRAFT_550386 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.998e-9
Identity = 29/71 (40.85%), Postives = 47/71 (66.20%), Query Frame = 3
Query:   42 KLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAREN 254
            +L++G LPP  S + +K+ F  Y  + D ++++ +GF+  ET + A  AV  +NG ++ G TIAV+FAREN
Sbjct:   10 RLYLGKLPPDTSPEDVKKTFTAYGPVVDCRVMTGFGFIEYETTKDAEDAVTEMNGKDFMGNTIAVEFAREN 80          
BLAST of RNA-binding protein 4B vs. TrEMBL
Match: A0A401SVN3 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0012914 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.045e-8
Identity = 29/83 (34.94%), Postives = 52/83 (62.65%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADIT 284
            MVK+F+GNLP  A+ + +KE+F+ Y  L +  +I NYGFV++E +E+A  A+ N++  +  G  I V+ ++   +   K  ++
Sbjct:    1 MVKIFIGNLPRIATKEEIKELFEKYGKLTECDIIKNYGFVHMEDKEAADEAIKNLHHHKLHGLPINVEASKSKVKTSTKLHVS 83          
BLAST of RNA-binding protein 4B vs. Ensembl Cavefish
Match: rbm4.3 (RNA binding motif protein 4.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1938])

HSP 1 Score: 56.9954 bits (136), Expect = 5.761e-9
Identity = 25/75 (33.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQ 260
            MVK+FVGNLP  A    ++ +F  Y  + +  +I N+ FV+++ ++SA  A+ +++  +  G  I V+ +R  NQ
Sbjct:    1 MVKIFVGNLPSEAETDEIQSLFSQYGTVTECAIIKNFAFVHMDDRKSATKAIRSLHLYKLHGTPINVEASRGKNQ 75          
BLAST of RNA-binding protein 4B vs. Ensembl Cavefish
Match: rbm14b (RNA-binding protein 4-like [Source:NCBI gene;Acc:103039667])

HSP 1 Score: 56.225 bits (134), Expect = 2.935e-8
Identity = 21/73 (28.77%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   30 FNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
             +  K+FVGNL    + + LKE+FQ +  + +   +  Y FV++E +E A+ A+ +++G  ++G  ++V+ ++
Sbjct:   80 LHSTKVFVGNLSGMCTTEDLKELFQTFGKVLECDKVKGYAFVHMENKEDALQAIESLHGTSFKGRPLSVELSK 152          

HSP 2 Score: 51.6026 bits (122), Expect = 9.063e-7
Identity = 22/72 (30.56%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   33 NMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            + VKLFVGNL    + + L  IF++Y  +    ++  + FV+L+ + +A  A+  ++G E++G  + V+ +R
Sbjct:    5 HTVKLFVGNLALDTTQEELSAIFESYGQVVSCSVLRQFAFVHLQGEGAAERAIRELSGREFKGRNLVVEESR 76          
BLAST of RNA-binding protein 4B vs. Ensembl Cavefish
Match: rbm14b (RNA-binding protein 4-like [Source:NCBI gene;Acc:103039667])

HSP 1 Score: 55.8398 bits (133), Expect = 3.988e-8
Identity = 21/73 (28.77%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   30 FNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
             +  K+FVGNL    + + LKE+FQ +  + +   +  Y FV++E +E A+ A+ +++G  ++G  ++V+ ++
Sbjct:   80 LHSTKVFVGNLSGMCTTEDLKELFQTFGKVLECDKVKGYAFVHMENKEDALQAIESLHGTSFKGRPLSVELSK 152          

HSP 2 Score: 51.2174 bits (121), Expect = 1.150e-6
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            VKLFVGNL    + + L  IF++Y  +    ++  + FV+L+ + +A  A+  ++G E++G  + V+ +R
Sbjct:    7 VKLFVGNLALDTTQEELSAIFESYGQVVSCSVLRQFAFVHLQGEGAAERAIRELSGREFKGRNLVVEESR 76          
BLAST of RNA-binding protein 4B vs. Ensembl Cavefish
Match: rbm4.1 (RNA binding motif protein 4.1 [Source:NCBI gene;Acc:573001])

HSP 1 Score: 55.0694 bits (131), Expect = 5.234e-8
Identity = 23/82 (28.05%), Postives = 45/82 (54.88%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADI 281
            MVK+FVGNL P+ +   L+ +F  Y  + +  ++ N+GFV+++ +  A  A+ N++     G  + V+ +R   +   K  +
Sbjct:    1 MVKIFVGNLSPNTTTDELRSLFSQYGKISECDIVKNFGFVHMDDKAEAEEAIRNLHHYMLNGLAMNVEMSRGKPKASTKLHV 82          

HSP 2 Score: 50.0618 bits (118), Expect = 2.360e-6
Identity = 20/69 (28.99%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KL VGN+  S +NQ L+  F+ Y  + +  ++ +Y FV++E  E A+ A++ ++   ++G  ++V  +
Sbjct:   78 TKLHVGNISSSCTNQELRAKFEEYGPVVECDIVKDYAFVHMERVEDAMEAISGLDNTAFQGKLMSVKLS 146          
BLAST of RNA-binding protein 4B vs. Ensembl Cavefish
Match: ENSAMXT00000025899.2 (RNA-binding protein lark-like [Source:NCBI gene;Acc:103046343])

HSP 1 Score: 53.9138 bits (128), Expect = 9.658e-8
Identity = 22/76 (28.95%), Postives = 43/76 (56.58%), Query Frame = 3
Query:   27 IFNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAREN 254
            + N  K++VGN+P   +   +KE+FQ Y  + +  ++ N+ FV+++ +  A+ A+  +N  +  G  I V  +R N
Sbjct:   74 VRNATKIYVGNVPEGVTAAKIKELFQAYGKVVECDIVKNFAFVHMQRENEALEAIRELNHSKVEGQKIFVSLSRSN 149          

HSP 2 Score: 53.1434 bits (126), Expect = 1.930e-7
Identity = 22/70 (31.43%), Postives = 43/70 (61.43%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
            MVK+FVGN+  + +   L+ +F+ +  + D  ++ NYGFV+++ +++A  AV  ++     G  I V++A
Sbjct:    1 MVKIFVGNVASATTEAELRALFEEHGAVSDCDILKNYGFVHMDEEDAAQKAVAALHKYVLNGSRITVEYA 70          
BLAST of RNA-binding protein 4B vs. Ensembl Sea Lamprey
Match: rbm4.2 (RNA binding motif protein 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-3019])

HSP 1 Score: 52.373 bits (124), Expect = 2.595e-8
Identity = 20/72 (27.78%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   33 NMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            +  K++VGN+ P  +N  L+  F+ +  + +  ++ +Y FV++E ++ A  A+  ++G E++G  I V  +R
Sbjct:   76 STTKMYVGNVTPDCTNVELRAKFEEFGPVAECDIVKDYAFVHMEREDDARAAIRALDGSEFKGRRILVQLSR 147          
BLAST of RNA-binding protein 4B vs. Ensembl Nematostella
Match: EDO38734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC26])

HSP 1 Score: 54.6842 bits (130), Expect = 2.160e-8
Identity = 25/76 (32.89%), Postives = 41/76 (53.95%), Query Frame = 3
Query:   18 YILIFNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
            Y ++  +  ++V N+P   S   LK +F  Y  ++  + I +YGFVY   +ESA+ A++ ING    G  + V  A
Sbjct:  283 YAVMSKVKSIYVRNVPLPMSETQLKAVFTKYGQIEKVRKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLA 358          
BLAST of RNA-binding protein 4B vs. Ensembl Nematostella
Match: EDO39290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ5])

HSP 1 Score: 46.595 bits (109), Expect = 4.439e-6
Identity = 20/71 (28.17%), Postives = 38/71 (53.52%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            M ++F+G LP       +++  + Y  ++D  L   YGFV  +    A  AV+++NG +  G  + V+F++
Sbjct:    1 MSRIFLGRLPRDVRESDVEKFLRGYGKIRDISLKRGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSK 71          
BLAST of RNA-binding protein 4B vs. Ensembl Nematostella
Match: EDO39887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8T7])

HSP 1 Score: 44.2838 bits (103), Expect = 9.917e-6
Identity = 23/67 (34.33%), Postives = 35/67 (52.24%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVD 239
             ++++G LP   +   ++  F++Y  L+D  L +NYGFV  E    A  AV   NG E  G  I V+
Sbjct:    3 CRVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNNYGFVEFEDDRDADDAVYECNGKEMLGERILVE 69          
BLAST of RNA-binding protein 4B vs. Ensembl Medaka
Match: ENSORLT00000031267.1 (RNA-binding protein 4B [Source:NCBI gene;Acc:101169980])

HSP 1 Score: 59.3066 bits (142), Expect = 2.337e-9
Identity = 27/87 (31.03%), Postives = 49/87 (56.32%), Query Frame = 3
Query:   12 IVYILI-----FNMVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENN 257
            IV+  +       MVK+FVGNLP  A+ + +K +F+ Y  + +  +I N+ FV++E +++A  A+ N++     G  I V+ +   N
Sbjct:   15 IVFFCVSLSCSLKMVKIFVGNLPREATEEEIKALFEEYGAVTECAIIKNFAFVHMEDRKAATKAIKNLHQHSLHGTAINVEASHGKN 101          
BLAST of RNA-binding protein 4B vs. Ensembl Medaka
Match: ENSORLT00000014524.2 (RNA-binding protein 4B [Source:NCBI gene;Acc:101169980])

HSP 1 Score: 58.5362 bits (140), Expect = 3.312e-9
Identity = 25/74 (33.78%), Postives = 45/74 (60.81%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENN 257
            MVK+FVGNLP  A+ + +K +F+ Y  + +  +I N+ FV++E +++A  A+ N++     G  I V+ +   N
Sbjct:    1 MVKIFVGNLPREATEEEIKALFEEYGAVTECAIIKNFAFVHMEDRKAATKAIKNLHQHSLHGTAINVEASHGKN 74          
BLAST of RNA-binding protein 4B vs. Ensembl Medaka
Match: rbm14a (RNA-binding protein 4 [Source:NCBI gene;Acc:101157077])

HSP 1 Score: 58.9214 bits (141), Expect = 3.598e-9
Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            VKLFVGNLP  A+++ + +IF  Y ++    L+  Y FV L+ + +A  A+ +++G EYRG  + V+ +R
Sbjct:   24 VKLFVGNLPIDATHEEISKIFSPYGEINTCSLLRQYAFVTLKGEGAADRAIRHLDGKEYRGRPLVVEESR 93          

HSP 2 Score: 50.447 bits (119), Expect = 1.944e-6
Identity = 33/117 (28.21%), Postives = 62/117 (52.99%), Query Frame = 3
Query:   33 NMVKLFVGNLPPSASNQSLKEIFQNYKDLQDY-----KLISN--YGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAREN---NQLKRKADITTENKISKPLIPQPQRFIHSNQPQ 353
            N  K+FVGNL  + S   L  +F  +  + D      +L SN  Y FV++E +E A  A++ +NG  ++G  +AV+ ++     NQ+   +  ++ ++  + L+P+P   +  +Q Q
Sbjct:   98 NSTKIFVGNLSATCSADDLHGLFSTFGRVLDCDKVKARLCSNVGYAFVHMERKEEAQAAIDALNGTMFKGRQLAVELSKAQPLVNQMSGNSANSSGDR--EGLLPRPPPSLEHHQSQ 212          
BLAST of RNA-binding protein 4B vs. Ensembl Medaka
Match: rbm14a (RNA-binding protein 4 [Source:NCBI gene;Acc:101157077])

HSP 1 Score: 58.9214 bits (141), Expect = 3.965e-9
Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAR 248
            VKLFVGNLP  A+++ + +IF  Y ++    L+  Y FV L+ + +A  A+ +++G EYRG  + V+ +R
Sbjct:    8 VKLFVGNLPIDATHEEISKIFSPYGEINTCSLLRQYAFVTLKGEGAADRAIRHLDGKEYRGRPLVVEESR 77          

HSP 2 Score: 49.2914 bits (116), Expect = 5.127e-6
Identity = 32/117 (27.35%), Postives = 59/117 (50.43%), Query Frame = 3
Query:   33 NMVKLFVGNLPPSASNQSLKEIFQNYKDLQDY--------KLISN--YGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQPQRFIHSNQPQ 353
            N  K+FVGNL  + S   L  +F  +  + D         +L SN  Y FV++E +E A  A++ +NG  ++G  +AV+ ++    + +   ++  +  S  L+P+P   +  +Q Q
Sbjct:   82 NSTKIFVGNLSATCSADDLHGLFSTFGRVLDCDKVKGKKSRLCSNVGYAFVHMERKEEAQAAIDALNGTMFKGRQLAVELSKAQPLVNQ---MSGNSANSSGLLPRPPPSLEHHQSQ 195          
BLAST of RNA-binding protein 4B vs. Ensembl Medaka
Match: ENSORLT00000015617.2 (RNA-binding protein 4.1-like [Source:NCBI gene;Acc:101169128])

HSP 1 Score: 58.151 bits (139), Expect = 4.538e-9
Identity = 24/74 (32.43%), Postives = 45/74 (60.81%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENN 257
            MVK+FVGNLP  A+ + +K +F+ Y  + +  ++ N+ FV++E +++A  A+ N++     G  I V+ +   N
Sbjct:    1 MVKIFVGNLPQEATEEEIKALFEEYGTVTECDIVKNFAFVHMEDRKAATKAIKNLHQHSLHGTAINVEASHGKN 74          
BLAST of RNA-binding protein 4B vs. Planmine SMEST
Match: SMESG000059552.1 (SMESG000059552.1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 328/329 (99.70%), Postives = 329/329 (100.00%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQPQRFIHSNQPQRNMNPYNLPFLNNANSINRSLENITDKRYGSVPYNNGFDTYRDDCDPRSGLGVHMNNFPQHPMAPRPIINKRLKPNSFIDDDAYDFNYNNHYPMEHPSPEMFNSFRDDQFYGPERGNKHQARRPLLPDNDEDLEYFRREMMHRSGXXXXXXXXXXXLKSQPTWYEMNHQNANRQYLSDRDRRMYVPRRGNKRQIKNSYIDEYEDSTDYASVDPYPAYLKQYQK 1022
            MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQPQRFIHSNQPQRNMNPYNLPFLNNANSINRSLENITDKRYGSVPYNNGFDTYR+DCDPRSGLGVHMNNFPQHPMAPRPIINKRLKPNSFIDDDAYDFNYNNHYPMEHPSPEMFNSFRDDQFYGPERGNKHQARRPLLPDNDEDLEYFRREMMHRSGNPSMPNSNMNMLKSQPTWYEMNHQNANRQYLSDRDRRMYVPRRGNKRQIKNSYIDEYEDSTDYASVDPYPAYLKQYQK
Sbjct:    1 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQPQRFIHSNQPQRNMNPYNLPFLNNANSINRSLENITDKRYGSVPYNNGFDTYREDCDPRSGLGVHMNNFPQHPMAPRPIINKRLKPNSFIDDDAYDFNYNNHYPMEHPSPEMFNSFRDDQFYGPERGNKHQARRPLLPDNDEDLEYFRREMMHRSGNPSMPNSNMNMLKSQPTWYEMNHQNANRQYLSDRDRRMYVPRRGNKRQIKNSYIDEYEDSTDYASVDPYPAYLKQYQK 329          
BLAST of RNA-binding protein 4B vs. Planmine SMEST
Match: SMESG000033438.1 (SMESG000033438.1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.035e-11
Identity = 23/69 (33.33%), Postives = 43/69 (62.32%), Query Frame = 3
Query:   39 VKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFA 245
             KLFVGN+P   S + L  +F  Y ++ +  ++ N+GF+++ ++E A HA+  ++G E+ G  I V+ +
Sbjct:    4 TKLFVGNIPNGTSKEELSRLFSKYGEILEVTIVKNFGFIHMSSEEEANHAIELLDGTEFAGNVINVEIS 72          
BLAST of RNA-binding protein 4B vs. Planmine SMEST
Match: SMESG000015564.1 (SMESG000015564.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.259e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQPQRFIHSNQPQR 356
            M ++F+G L   AS + ++  F+ Y  ++D +L S YGFV  + +  A  A+++++  E  G  + ++ AR   +  R+ D +     + P I    R +  N P R
Sbjct:    1 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHARSGRRSPRRFDSSRRFAGNAP-IRTDYRLLVENLPSR 106          
BLAST of RNA-binding protein 4B vs. Planmine SMEST
Match: SMESG000045501.1 (SMESG000045501.1)

HSP 1 Score: 50.447 bits (119), Expect = 1.128e-6
Identity = 23/73 (31.51%), Postives = 43/73 (58.90%), Query Frame = 3
Query:   36 MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIHAVNNINGLEYRGFTIAVDFAREN 254
            M +L+VGNLP     + +K+ F+ Y  ++   + + YGFV ++ +  A  AV++++G +  G  + V+ AR N
Sbjct:    1 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSN 73          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein 4B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM49.583e-1132.93RNA binding motif protein 4 [Source:HGNC Symbol;Ac... [more]
RBM4B9.631e-1132.93RNA binding motif protein 4B [Source:HGNC Symbol;A... [more]
RBM41.127e-1032.93RNA binding motif protein 4 [Source:HGNC Symbol;Ac... [more]
RBM41.127e-1032.93RNA binding motif protein 4 [Source:HGNC Symbol;Ac... [more]
RBM4B1.195e-1034.18RNA binding motif protein 4B [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsp-23.220e-833.80Probable splicing factor, arginine/serine-rich 2 ... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lark4.308e-933.72gene:FBgn0011640 transcript:FBtr0076843[more]
lark4.308e-933.72gene:FBgn0011640 transcript:FBtr0076844[more]
lark4.308e-933.72gene:FBgn0011640 transcript:FBtr0076842[more]
lark4.308e-933.72gene:FBgn0011640 transcript:FBtr0076841[more]
lark4.308e-933.72gene:FBgn0011640 transcript:FBtr0076845[more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm4.38.263e-1033.33RNA binding motif protein 4.3 [Source:ZFIN;Acc:ZDB... [more]
rbm4.38.263e-1033.33RNA binding motif protein 4.3 [Source:ZFIN;Acc:ZDB... [more]
zgc:772621.554e-935.71zgc:77262 [Source:ZFIN;Acc:ZDB-GENE-040426-1811][more]
rbm4.22.210e-829.58RNA binding motif protein 4.2 [Source:ZFIN;Acc:ZDB... [more]
rbm4.22.210e-829.58RNA binding motif protein 4.2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm4b1.154e-1137.35NF-kappa-B inhibitor zeta-like [Source:Xenbase;Acc... [more]
snx151.883e-1030.39sorting nexin 15 [Source:NCBI gene;Acc:734054][more]
mcm3ap1.117e-732.99minichromosome maintenance complex component 3 ass... [more]
mcm3ap1.195e-732.99minichromosome maintenance complex component 3 ass... [more]
mcm3ap1.255e-732.99minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbm4b5.887e-1132.93RNA binding motif protein 4B [Source:MGI Symbol;Ac... [more]
Rbm46.770e-1132.93RNA binding motif protein 4 [Source:MGI Symbol;Acc... [more]
Rbm48.363e-1132.93RNA binding motif protein 4 [Source:MGI Symbol;Acc... [more]
Rbm48.363e-1132.93RNA binding motif protein 4 [Source:MGI Symbol;Acc... [more]
Rbm4b8.760e-1132.93RNA binding motif protein 4B [Source:MGI Symbol;Ac... [more]
back to top
BLAST of RNA-binding protein 4B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64LC9|RBM4B_RAT2.141e-932.93RNA-binding protein 4B OS=Rattus norvegicus OX=101... [more]
sp|Q8VE92|RBM4B_MOUSE2.141e-932.93RNA-binding protein 4B OS=Mus musculus OX=10090 GN... [more]
sp|Q9BQ04|RBM4B_HUMAN2.179e-932.93RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=... [more]
sp|Q4R979|RBM4_MACFA2.204e-932.93RNA-binding protein 4 OS=Macaca fascicularis OX=95... [more]
sp|Q9BWF3|RBM4_HUMAN2.204e-932.93RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=R... [more]
back to top
BLAST of RNA-binding protein 4B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1C3T33.495e-1139.29RNA-binding protein 4B OS=Lithobates catesbeianus ... [more]
A0A0P7UHK05.209e-941.43RRM domain-containing protein (Fragment) OS=Sclero... [more]
A0A444T0K67.874e-935.82RNA-binding protein 14 OS=Armadillidium vulgare OX... [more]
A0A550C3B49.998e-940.85Uncharacterized protein OS=Auriculariopsis ampla O... [more]
A0A401SVN31.045e-834.94Uncharacterized protein OS=Chiloscyllium punctatum... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm4.35.761e-933.33RNA binding motif protein 4.3 [Source:ZFIN;Acc:ZDB... [more]
rbm14b2.935e-828.77RNA-binding protein 4-like [Source:NCBI gene;Acc:1... [more]
rbm14b3.988e-828.77RNA-binding protein 4-like [Source:NCBI gene;Acc:1... [more]
rbm4.15.234e-828.05RNA binding motif protein 4.1 [Source:NCBI gene;Ac... [more]
ENSAMXT00000025899.29.658e-828.95RNA-binding protein lark-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rbm4.22.595e-827.78RNA binding motif protein 4.2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO387342.160e-832.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392904.439e-628.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398879.917e-634.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein 4B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031267.12.337e-931.03RNA-binding protein 4B [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000014524.23.312e-933.78RNA-binding protein 4B [Source:NCBI gene;Acc:10116... [more]
rbm14a3.598e-938.57RNA-binding protein 4 [Source:NCBI gene;Acc:101157... [more]
rbm14a3.965e-938.57RNA-binding protein 4 [Source:NCBI gene;Acc:101157... [more]
ENSORLT00000015617.24.538e-932.43RNA-binding protein 4.1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of RNA-binding protein 4B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000059552.10.000e+099.70SMESG000059552.1[more]
SMESG000033438.14.035e-1133.33SMESG000033438.1[more]
SMESG000015564.14.259e-727.10SMESG000015564.1[more]
SMESG000045501.11.128e-631.51SMESG000045501.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010217 ID=SMED30010217|Name=RNA-binding protein 4B|organism=Schmidtea mediterranea sexual|type=transcript|length=1141bp
GACCTATTTAAATTGTTTACATTCTAATTTTCAATATGGTTAAACTTTTT
GTTGGAAATTTACCACCATCAGCATCAAACCAAAGCTTAAAAGAAATTTT
TCAGAATTATAAAGATCTCCAGGACTACAAGTTAATTTCAAATTATGGAT
TTGTTTATTTGGAAACTCAAGAATCTGCGATACATGCTGTGAATAATATA
AATGGACTTGAGTATCGGGGTTTTACGATTGCAGTGGACTTTGCACGCGA
AAATAATCAACTAAAACGAAAAGCAGACATTACCACCGAAAATAAAATCT
CAAAACCACTTATACCACAACCTCAAAGATTTATCCATTCAAATCAGCCT
CAGCGAAATATGAATCCTTATAATCTCCCATTTCTAAATAATGCCAACAG
TATAAATAGGTCCCTTGAAAATATAACTGACAAAAGATATGGCTCAGTGC
CATACAATAATGGTTTTGATACTTATCGGGATGATTGTGATCCAAGAAGT
GGACTTGGAGTTCATATGAATAATTTTCCCCAACATCCCATGGCTCCCAG
ACCTATAATTAACAAAAGACTGAAACCAAATTCCTTTATTGATGATGATG
CATACGATTTCAACTACAATAATCATTATCCTATGGAACATCCGTCTCCA
GAAATGTTCAATTCTTTTCGCGATGATCAATTTTATGGTCCAGAACGAGG
TAACAAGCACCAAGCTAGGAGGCCGCTTTTACCGGACAATGATGAAGATT
TAGAATACTTTAGAAGAGAAATGATGCACAGATCAGGAAATCCTTCAATG
CCCAATAGCAATATGAATATGTTAAAAAGTCAACCGACCTGGTACGAAAT
GAATCACCAAAATGCGAACCGGCAATATCTGTCTGATCGTGATCGACGAA
TGTACGTTCCGAGGAGGGGAAATAAGCGGCAAATTAAAAACTCCTACATT
GACGAATACGAAGACAGTACCGATTATGCCTCAGTGGATCCATATCCAGC
CTACTTGAAACAGTATCAGAAATAAGGATAGGTAAATATAAAAATAAGCT
AATAAAAAAATGAATGAAAGTTGTAAATTTTATTAATCGTTTGTTCGATG
TTGTTAGTGATAATTGGAAATAATAATAATAATAATAATAA
back to top

protein sequence of SMED30010217-orf-1

>SMED30010217-orf-1 ID=SMED30010217-orf-1|Name=SMED30010217-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=330bp
MVKLFVGNLPPSASNQSLKEIFQNYKDLQDYKLISNYGFVYLETQESAIH
AVNNINGLEYRGFTIAVDFARENNQLKRKADITTENKISKPLIPQPQRFI
HSNQPQRNMNPYNLPFLNNANSINRSLENITDKRYGSVPYNNGFDTYRDD
CDPRSGLGVHMNNFPQHPMAPRPIINKRLKPNSFIDDDAYDFNYNNHYPM
EHPSPEMFNSFRDDQFYGPERGNKHQARRPLLPDNDEDLEYFRREMMHRS
GNPSMPNSNMNMLKSQPTWYEMNHQNANRQYLSDRDRRMYVPRRGNKRQI
KNSYIDEYEDSTDYASVDPYPAYLKQYQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 3..68
e-value: 2.1E-14
score: 63.9
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 4..65
e-value: 4.0E-13
score: 49.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 2..72
score: 15.443
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..88
e-value: 1.9E-17
score: 65.3
NoneNo IPR availablePANTHERPTHR23003:SF27NUCLEOLAR PROTEIN 3coord: 3..92
NoneNo IPR availablePANTHERPTHR23003RNA RECOGNITION MOTIF RRM DOMAIN CONTAINING PROTEINcoord: 3..92
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 3..77