NPHS1-3

Overview
NameNPHS1-3 (AKN21719.1)
Smed IDSMED30010202
Length (bp)3930
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHS1-3 (SMED30010202) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHS1-3 (SMED30010202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPHS1-3 (SMED30010202) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPHS1-3 (SMED30010202) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010202SMESG000070688.1 SmedASXL_015644SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30010202SMESG000070688.1 dd_Smed_v4_14980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010202SMESG000070688.1 dd_Smed_v6_14980_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHS1-3 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 97.0561 bits (240), Expect = 1.471e-19
Identity = 127/578 (21.97%), Postives = 215/578 (37.20%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLI----INVIFPPVHLEISCLNCIPNKIMANRTNEFL---CESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLY-PPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            G  + L C + GGNP P+L WYK++  V  S  +  +     L  + +     + + V     S+N      K+  L     + V FPP ++ I           A R  + L   C S SSNP   ++W              +     ++G  +      + G      + L ++ + +   + C++  +     E  + +    +L VLY P F+   +  +   E     L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A     +DV Y+P +      T +N+   S +  C    NPI       W R+  ++     D  + +           +  PT ++RI+           ++KL       +  G YQC+  NG+    R  L L +   P     +  +K     D +  + L C      N    W    VP   +    T  T  +       L +  V     +  + C A N  GS +   + L+   +PD P   K+  L  +++ L W  G DGG  Q F +R+
Sbjct:  458 GTRVRLVCLAIGGNPEPSLMWYKDSRTVTES-RLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLAVQFPPTNVTILA------NASALRPGDALNLTCVSVSSNPPVNLSW--------------DKEGERLEGVAAPPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSA-----ELRETVSSFYRLNVLYRPEFLGEQVLVVTAVEQGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNV-GGSVDIVCTVDANPILPGM-FNWERLGEDEEDQSLDDMEKI-----------SRGPTGRLRIH-----------HAKL-------AQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQGGVHSSLLTIANVSAAQDYALFTCTATNALGSDQ-TNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRY 977          

HSP 2 Score: 59.3066 bits (142), Expect = 6.106e-8
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  201 SIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLL 425
            S+ + C V+     VQW    L+LG D  +PG PR ++ GD  +GE +L I      D  +YECQV   +  P L
Sbjct:   48 SVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL 122          
BLAST of NPHS1-3 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 97.0561 bits (240), Expect = 1.743e-19
Identity = 127/578 (21.97%), Postives = 215/578 (37.20%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLI----INVIFPPVHLEISCLNCIPNKIMANRTNEFL---CESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLY-PPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            G  + L C + GGNP P+L WYK++  V  S  +  +     L  + +     + + V     S+N      K+  L     + V FPP ++ I           A R  + L   C S SSNP   ++W              +     ++G  +      + G      + L ++ + +   + C++  +     E  + +    +L VLY P F+   +  +   E     L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A     +DV Y+P +      T +N+   S +  C    NPI       W R+  ++     D  + +           +  PT ++RI+           ++KL       +  G YQC+  NG+    R  L L +   P     +  +K     D +  + L C      N    W    VP   +    T  T  +       L +  V     +  + C A N  GS +   + L+   +PD P   K+  L  +++ L W  G DGG  Q F +R+
Sbjct:  458 GTRVRLVCLAIGGNPEPSLMWYKDSRTVTES-RLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLAVQFPPTNVTILA------NASALRPGDALNLTCVSVSSNPPVNLSW--------------DKEGERLEGVAAPPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSA-----ELRETVSSFYRLNVLYRPEFLGEQVLVVTAVEQGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNV-GGSVDIVCTVDANPILPGM-FNWERLGEDEEDQSLDDMEKI-----------SRGPTGRLRIH-----------HAKL-------AQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQGGVHSSLLTIANVSAAQDYALFTCTATNALGSDQ-TNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRY 977          

HSP 2 Score: 59.3066 bits (142), Expect = 6.000e-8
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  201 SIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLL 425
            S+ + C V+     VQW    L+LG D  +PG PR ++ GD  +GE +L I      D  +YECQV   +  P L
Sbjct:   48 SVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL 122          
BLAST of NPHS1-3 vs. Ensembl Human
Match: KIRREL2 (kirre like nephrin family adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:18816])

HSP 1 Score: 68.1662 bits (165), Expect = 3.772e-12
Identity = 35/101 (34.65%), Postives = 46/101 (45.54%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYIL 479
            D  VL+ +   + C +    G VQW    L LG  R +PG  R  I G+   G+H+L I   + ED   YECQ        L  R + LHV   P  P +L
Sbjct:   32 DLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAG---LRSRPAQLHVLVPPEAPQVL 129          
BLAST of NPHS1-3 vs. Ensembl Human
Match: KIRREL2 (kirre like nephrin family adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:18816])

HSP 1 Score: 68.5514 bits (166), Expect = 6.272e-11
Identity = 43/143 (30.07%), Postives = 56/143 (39.16%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEG-GLPQPIFQWF 602
            D  VL+ +   + C +    G VQW    L LG  R +PG  R  I G+   G+H+L I   + ED   YECQ        L  R + LHV   P  P +L               ++       L C S G   P P   WF
Sbjct:   32 DLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAG---LRSRPAQLHVLVPPEAPQVL----------GGPSVSLVAGVPANLTCRSRGDARPTPELLWF 161          
BLAST of NPHS1-3 vs. Ensembl Human
Match: KIRREL2 (kirre like nephrin family adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:18816])

HSP 1 Score: 68.1662 bits (165), Expect = 7.865e-11
Identity = 43/143 (30.07%), Postives = 56/143 (39.16%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEG-GLPQPIFQWF 602
            D  VL+ +   + C +    G VQW    L LG  R +PG  R  I G+   G+H+L I   + ED   YECQ        L  R + LHV   P  P +L               ++       L C S G   P P   WF
Sbjct:   32 DLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAG---LRSRPAQLHVLVPPEAPQVL----------GGPSVSLVAGVPANLTCRSRGDARPTPELLWF 161          
BLAST of NPHS1-3 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 130.183 bits (326), Expect = 3.411e-30
Identity = 136/611 (22.26%), Postives = 258/611 (42.23%), Query Frame = 3
Query: 1464 IECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFS-DEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSW--------YFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS---INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII------FSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            +EC AT       KQ     +    K  +I+G +      EGDI+++TC + GGNP   L WY+ +  V  + +E+       TL    RV +  N Q++ CEA +  +    ++S +L  +V +PP  + I   +    +++  ++   +C + SSNP + I+W+    +           + V  G +S N   + NG+  ++ L+     + +  ++ C +  +H   PE    +  +  L V+YPP  ++N   ++ + EG +      +  NP  + + W        +   R  +    L  K +   D+G Y     N +GS   + ++ V+YS ++   S   I    D+    CEA   P  +N  + W          Y++      IL+  +  +  +     +R+N+                    E   G Y C   NGIG+       L +   P  L +++Y+K    +   +   C    +  P++ ++     ++I      +S   T+I  ST+   L +  +  + Y  + KC A+N  G+  L+ + ++P   PD P +  +     N I ++W    DGGS+Q F++++
Sbjct:  106 VECMATNPEGSSAKQHV-IKIIAPPKAPIITG-LEDRKFFEGDIVNVTCEAQGGNPLAELSWYRGSEKVNGAHNEVAGFSSYSTLAL--RVDRTMNTQRLKCEATNAALDEPLIESQYL--SVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFSRATD---------DNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIA--NH---PEWKHSVNTSFPLNVMYPPKMLVNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDTVLLECEADGEPSKANM-IHW----------YKNGE----ILAAQHRGHKKAI----LRLNAT-------------------EQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKV--YAVPTVEFVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLS-IPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKY 655          
BLAST of NPHS1-3 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 130.183 bits (326), Expect = 4.631e-30
Identity = 136/611 (22.26%), Postives = 258/611 (42.23%), Query Frame = 3
Query: 1464 IECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFS-DEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSW--------YFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS---INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII------FSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            +EC AT       KQ     +    K  +I+G +      EGDI+++TC + GGNP   L WY+ +  V  + +E+       TL    RV +  N Q++ CEA +  +    ++S +L  +V +PP  + I   +    +++  ++   +C + SSNP + I+W+    +           + V  G +S N   + NG+  ++ L+     + +  ++ C +  +H   PE    +  +  L V+YPP  ++N   ++ + EG +      +  NP  + + W        +   R  +    L  K +   D+G Y     N +GS   + ++ V+YS ++   S   I    D+    CEA   P  +N  + W          Y++      IL+  +  +  +     +R+N+                    E   G Y C   NGIG+       L +   P  L +++Y+K    +   +   C    +  P++ ++     ++I      +S   T+I  ST+   L +  +  + Y  + KC A+N  G+  L+ + ++P   PD P +  +     N I ++W    DGGS+Q F++++
Sbjct:  408 VECMATNPEGSSAKQHV-IKIIAPPKAPIITG-LEDRKFFEGDIVNVTCEAQGGNPLAELSWYRGSEKVNGAHNEVAGFSSYSTLAL--RVDRTMNTQRLKCEATNAALDEPLIESQYL--SVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFSRATD---------DNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIA--NH---PEWKHSVNTSFPLNVMYPPKMLVNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDTVLLECEADGEPSKANM-IHW----------YKNGE----ILAAQHRGHKKAI----LRLNAT-------------------EQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKV--YAVPTVEFVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLS-IPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKY 957          

HSP 2 Score: 60.8474 bits (146), Expect = 8.170e-9
Identity = 57/252 (22.62%), Postives = 100/252 (39.68%), Query Frame = 3
Query: 1227 IISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHA-TTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSI 1979
            II+  EN  +N+ C   +      + W      ++DG     +++S  +K       N T   + +  ++  R  +   I C A   E  I +   T  +V +      +    +   +  GD + + C   GGNP P + WY  N  +     + T  +E  +  +Y      N      E ++ N +    K   + + V +PP  +E+   + I     AN      C+S  SNP S ITW ++N  S+
Sbjct:  139 IIAVKENTPLNITCVVPNVKPEPEVLW------YMDG-----KVMSRDVKQASTPHLNKTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKE--IKNIYSFIASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFGESNIRYGSSAN----IQCKSLPSNPASQITW-IINGRSV 372          
BLAST of NPHS1-3 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 124.79 bits (312), Expect = 1.292e-28
Identity = 135/622 (21.70%), Postives = 255/622 (41.00%), Query Frame = 3
Query: 1464 IECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIK------TDKEEQTLDF------LYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSW--------YFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS---INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII------FSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            +EC AT       KQ     +    K  +I+G +      EGDI+++TC + GGNP   L WY+ +   L     K           +   F        RV +  N Q++ CEA +  +    ++S +L  +V +PP  + I   +    +++  ++   +C + SSNP + I+W+    +           + V  G +S N   + NG+  ++ L+     + +  ++ C +  +H   PE    +  +  L V+YPP  ++N   ++ + EG +      +  NP  + + W        +   R  +    L  K +   D+G Y     N +GS   + ++ V+YS ++   S   I    D+    CEA   P  +N  + W          Y++      IL+  +  +  +     +R+N+                    E   G Y C   NGIG+       L +   P  L +++Y+K    +   +   C    +  P++ ++     ++I      +S   T+I  ST+   L +  +  + Y  + KC A+N  G+  L+ + ++P   PD P +  +     N I ++W    DGGS+Q F++++
Sbjct:  106 VECMATNPEGSSAKQHV-IKIIAPPKAPIITG-LEDRKFFEGDIVNVTCEAQGGNPLAELSWYRGSEKHLVKGRKKMKWSQVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEATNAALDEPLIESQYL--SVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFSRATD---------DNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIA--NH---PEWKHSVNTSFPLNVMYPPKMLVNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDTVLLECEADGEPSKANM-IHW----------YKNGE----ILAAQHRGHKKAI----LRLNAT-------------------EQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKV--YAVPTVEFVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLS-IPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKY 668          
BLAST of NPHS1-3 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 125.176 bits (313), Expect = 1.479e-28
Identity = 135/622 (21.70%), Postives = 255/622 (41.00%), Query Frame = 3
Query: 1464 IECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIK------TDKEEQTLDF------LYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSW--------YFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS---INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII------FSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            +EC AT       KQ     +    K  +I+G +      EGDI+++TC + GGNP   L WY+ +   L     K           +   F        RV +  N Q++ CEA +  +    ++S +L  +V +PP  + I   +    +++  ++   +C + SSNP + I+W+    +           + V  G +S N   + NG+  ++ L+     + +  ++ C +  +H   PE    +  +  L V+YPP  ++N   ++ + EG +      +  NP  + + W        +   R  +    L  K +   D+G Y     N +GS   + ++ V+YS ++   S   I    D+    CEA   P  +N  + W          Y++      IL+  +  +  +     +R+N+                    E   G Y C   NGIG+       L +   P  L +++Y+K    +   +   C    +  P++ ++     ++I      +S   T+I  ST+   L +  +  + Y  + KC A+N  G+  L+ + ++P   PD P +  +     N I ++W    DGGS+Q F++++
Sbjct:  408 VECMATNPEGSSAKQHV-IKIIAPPKAPIITG-LEDRKFFEGDIVNVTCEAQGGNPLAELSWYRGSEKHLVKGRKKMKWSQVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEATNAALDEPLIESQYL--SVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFSRATD---------DNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIA--NH---PEWKHSVNTSFPLNVMYPPKMLVNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDTVLLECEADGEPSKANM-IHW----------YKNGE----ILAAQHRGHKKAI----LRLNAT-------------------EQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKV--YAVPTVEFVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLS-IPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKY 970          

HSP 2 Score: 60.8474 bits (146), Expect = 8.192e-9
Identity = 57/252 (22.62%), Postives = 100/252 (39.68%), Query Frame = 3
Query: 1227 IISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHA-TTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSI 1979
            II+  EN  +N+ C   +      + W      ++DG     +++S  +K       N T   + +  ++  R  +   I C A   E  I +   T  +V +      +    +   +  GD + + C   GGNP P + WY  N  +     + T  +E  +  +Y      N      E ++ N +    K   + + V +PP  +E+   + I     AN      C+S  SNP S ITW ++N  S+
Sbjct:  139 IIAVKENTPLNITCVVPNVKPEPEVLW------YMDG-----KVMSRDVKQASTPHLNKTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKE--IKNIYSFIASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFGESNIRYGSSAN----IQCKSLPSNPASQITW-IINGRSV 372          
BLAST of NPHS1-3 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 101.293 bits (251), Expect = 2.169e-21
Identity = 110/522 (21.07%), Postives = 218/522 (41.76%), Query Frame = 3
Query: 1728 RVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSW--------YFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS---INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII------FSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            RV +  N Q++ CEA +  +    ++S +L  +V +PP  + I   +    +++  ++   +C + SSNP + I+W+    +           + V  G +S N   + NG+  ++ L+     + +  ++ C +  +H   PE    +  +  L V+YPP  ++N   ++ + EG +      +  NP  + + W        +   R  +    L  K +   D+G Y     N +GS   + ++ V+YS ++   S   I    D+    CEA   P  +N  + W          Y++      IL+  +  +  +     +R+N+                    E   G Y C   NGIG+       L +   P  L +++Y+K    +   +   C    +  P++ ++     ++I      +S   T+I  ST+   L +  +  + Y  + KC A+N  G+  L+ + ++P   PD P +  +     N I ++W    DGGS+Q F++++
Sbjct:   25 RVDRTMNTQRLKCEATNAALDEPLIESQYL--SVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFSRATD---------DNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIA--NH---PEWKHSVNTSFPLNVMYPPKMLVNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDTVLLECEADGEPSKANM-IHW----------YKNGE----ILAAQHRGHKKAI----LRLNAT-------------------EQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKV--YAVPTVEFVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLS-IPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKY 489          
BLAST of NPHS1-3 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0087413)

HSP 1 Score: 194.512 bits (493), Expect = 7.585e-50
Identity = 237/1105 (21.45%), Postives = 412/1105 (37.29%), Query Frame = 3
Query:  147 IQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRF---------------EAKVTVIMFVRSGNPLIQNSNQ--IVDENNDMEFTCSMKPTGHPKSKLKWSMN--------ITAGFRMENLIK--IKYNENQDELI---TNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYV-FEGSTVNLQYQISANPKATHFSWYFQN-----------RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSIN---IFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWL-----VPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEI 3311
            +Q F   P  D  +L      + C V+N+ GKVQW      LG+   +PG PR  ++ D  +  +NL+I  A  ED  +Y+CQV P   +P +R  + L +   PS   I       +         V  ++ L L C++E   P     WF    EV       + +    P +                       +T  L+ R +  Y+ F                A+V + +    G P  +  +Q   +    +++  C  +  G+P ++L W  N         T+G   EN+ K      +N   L+    NLL     R    + V    +  +++ ++   Q  V  + Q LS VT      NP  + S+                   IN     +S Y T +       G +V  S +++ I S   +   +++  H + T +TQ +    T+N                       V Y     +++GY     +  G I+ L C S GGNP PTL+WYKN+ ++    ++   K    L  L  V   DN     C+ ++  + +    +  L   V FPP  ++IS    +P  ++     + +C+SSSSNP + I+W                    ++G    N PG + G  +  ++ + +    +  +  CQS   +++L    + + + I L +LYPP      ++ +V  EG+  +++   S NP    ++W               R IS    L I  +  ND+G Y     N  G+A    ++ V+Y+P +   S     +  + A   C     P+ +   V W             SRD   + +   S   N                      + L I+  + SD G + C+  N  G    +N+ L +   P       +++    +   + L C  L+   PS  W      +       F +   ++    F   L +       +GQY+C  +N  G +        P+ +PD P   ++  +    + L+W  G DGG +  F+LR    KQ    +Y+ V      + + +
Sbjct:   38 VQKFHLTP-HDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI-------EGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQG--EVPVSTAPIVTVNQTAPKR-------------------FTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSR-GGNPPAQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN---QAKVGDSVQ-LSCVT---APSNPQARISW------------------SINGRPLDNSTYKTTSSS----DGGWVSSSNISLTIDS---QSRTFIAVCHALNTELTQNVVGSHTVN-----------------------VLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELSLL--VNASDNNAIYKCKVQNAAIDIPLFATKTL--GVHFPPETVKIS---VVPKNLVPGIRAKLICDSSSSNPPAKISWWK--------------DGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSH--NEVL---QRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAH-VRW-------------SRDGYDLATRTISSFENGT--------------------ALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPS-RPDAPLQLRVGNVSDTGVDLNWTPGFDGGMQTYFRLRL---KQHGEDKYKYVDAKPGHQNISL 993          
BLAST of NPHS1-3 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0087414)

HSP 1 Score: 194.126 bits (492), Expect = 1.021e-49
Identity = 237/1105 (21.45%), Postives = 412/1105 (37.29%), Query Frame = 3
Query:  147 IQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRF---------------EAKVTVIMFVRSGNPLIQNSNQ--IVDENNDMEFTCSMKPTGHPKSKLKWSMN--------ITAGFRMENLIK--IKYNENQDELI---TNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYV-FEGSTVNLQYQISANPKATHFSWYFQN-----------RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSIN---IFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWL-----VPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEI 3311
            +Q F   P  D  +L      + C V+N+ GKVQW      LG+   +PG PR  ++ D  +  +NL+I  A  ED  +Y+CQV P   +P +R  + L +   PS   I       +         V  ++ L L C++E   P     WF    EV       + +    P +                       +T  L+ R +  Y+ F                A+V + +    G P  +  +Q   +    +++  C  +  G+P ++L W  N         T+G   EN+ K      +N   L+    NLL     R    + V    +  +++ ++   Q  V  + Q LS VT      NP  + S+                   IN     +S Y T +       G +V  S +++ I S   +   +++  H + T +TQ +    T+N                       V Y     +++GY     +  G I+ L C S GGNP PTL+WYKN+ ++    ++   K    L  L  V   DN     C+ ++  + +    +  L   V FPP  ++IS    +P  ++     + +C+SSSSNP + I+W                    ++G    N PG + G  +  ++ + +    +  +  CQS   +++L    + + + I L +LYPP      ++ +V  EG+  +++   S NP    ++W               R IS    L I  +  ND+G Y     N  G+A    ++ V+Y+P +   S     +  + A   C     P+ +   V W             SRD   + +   S   N                      + L I+  + SD G + C+  N  G    +N+ L +   P       +++    +   + L C  L+   PS  W      +       F +   ++    F   L +       +GQY+C  +N  G +        P+ +PD P   ++  +    + L+W  G DGG +  F+LR    KQ    +Y+ V      + + +
Sbjct:   38 VQKFHLTP-HDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI-------EGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQG--EVPVSTAPIVTVNQTAPKR-------------------FTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSR-GGNPPAQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN---QAKVGDSVQ-LSCVT---APSNPQARISW------------------SINGRPLDNSTYKTTSSS----DGGWVSSSNISLTIDS---QSRTFIAVCHALNTELTQNVVGSHTVN-----------------------VLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELSLL--VNASDNNAIYKCKVQNAAIDIPLFATKTL--GVHFPPETVKIS---VVPKNLVPGIRAKLICDSSSSNPPAKISWWK--------------DGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSH--NEVL---QRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAH-VRW-------------SRDGYDLATRTISSFENGT--------------------ALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPS-RPDAPLQLRVGNVSDTGVDLNWTPGFDGGMQTYFRLRL---KQHGEDKYKYVDAKPGHQNISL 993          
BLAST of NPHS1-3 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0345419)

HSP 1 Score: 194.126 bits (492), Expect = 1.021e-49
Identity = 237/1105 (21.45%), Postives = 412/1105 (37.29%), Query Frame = 3
Query:  147 IQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRF---------------EAKVTVIMFVRSGNPLIQNSNQ--IVDENNDMEFTCSMKPTGHPKSKLKWSMN--------ITAGFRMENLIK--IKYNENQDELI---TNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYV-FEGSTVNLQYQISANPKATHFSWYFQN-----------RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSIN---IFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWL-----VPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEI 3311
            +Q F   P  D  +L      + C V+N+ GKVQW      LG+   +PG PR  ++ D  +  +NL+I  A  ED  +Y+CQV P   +P +R  + L +   PS   I       +         V  ++ L L C++E   P     WF    EV       + +    P +                       +T  L+ R +  Y+ F                A+V + +    G P  +  +Q   +    +++  C  +  G+P ++L W  N         T+G   EN+ K      +N   L+    NLL     R    + V    +  +++ ++   Q  V  + Q LS VT      NP  + S+                   IN     +S Y T +       G +V  S +++ I S   +   +++  H + T +TQ +    T+N                       V Y     +++GY     +  G I+ L C S GGNP PTL+WYKN+ ++    ++   K    L  L  V   DN     C+ ++  + +    +  L   V FPP  ++IS    +P  ++     + +C+SSSSNP + I+W                    ++G    N PG + G  +  ++ + +    +  +  CQS   +++L    + + + I L +LYPP      ++ +V  EG+  +++   S NP    ++W               R IS    L I  +  ND+G Y     N  G+A    ++ V+Y+P +   S     +  + A   C     P+ +   V W             SRD   + +   S   N                      + L I+  + SD G + C+  N  G    +N+ L +   P       +++    +   + L C  L+   PS  W      +       F +   ++    F   L +       +GQY+C  +N  G +        P+ +PD P   ++  +    + L+W  G DGG +  F+LR    KQ    +Y+ V      + + +
Sbjct:   38 VQKFHLTP-HDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI-------EGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQG--EVPVSTAPIVTVNQTAPKR-------------------FTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSR-GGNPPAQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN---QAKVGDSVQ-LSCVT---APSNPQARISW------------------SINGRPLDNSTYKTTSSS----DGGWVSSSNISLTIDS---QSRTFIAVCHALNTELTQNVVGSHTVN-----------------------VLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELSLL--VNASDNNAIYKCKVQNAAIDIPLFATKTL--GVHFPPETVKIS---VVPKNLVPGIRAKLICDSSSSNPPAKISWWK--------------DGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSH--NEVL---QRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAH-VRW-------------SRDGYDLATRTISSFENGT--------------------ALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPS-RPDAPLQLRVGNVSDTGVDLNWTPGFDGGMQTYFRLRL---KQHGEDKYKYVDAKPGHQNISL 993          
BLAST of NPHS1-3 vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0088635)

HSP 1 Score: 174.481 bits (441), Expect = 1.718e-43
Identity = 235/1113 (21.11%), Postives = 408/1113 (36.66%), Query Frame = 3
Query:   27 EKKMYQIWI----VIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLP-SIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGH---QILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQN--SNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNP-NEKSSFPPFIQQNHLDIISGIE---NEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKL-KRTLNSGFIECHAT----TENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQS------RLSHKILPEKYKPIVKNIKLKVLY-PPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWY---------FQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWL-----VPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
             ++  Q WI    ++ L + I+  S+P+P    Q           Q F+  P  D  VL      + C V N  G VQW      LG+   +PG PR  ++GD  +G +NL+I+ A   D  DY+CQV P   +  +R  + L V   P SI    Y +          D        L+L C+     P     W+  + E   ++ E  +  +     ++ S             +  C  ++KA         S      A V + +    G P I+   + + +     +E  C  +  G+P ++L W       ++  + I++ Y                 RT  R     +SE+ +       F      N  +      N  S NP   +          H+ ++   E    + + + C T+       +KW++      + +  TI  +SP            T  + IT  ++  KR+L    + CH      TEN +        NV Y     +ISGY+    +  G +  L C S GGNP  TL WYKN+  +  +  I+   +  + +        DN  +  CEA +   ++   +S  L ++     V + I      P ++        +C+SSSSNP + ++W                    ++G  +T+ PG + G  +  +  + +  + N  +  CQS      R +H+            + L VLY P F+    ++    EG ++ +  Q  ANP    + W            +R  +   +L    +H +D+G Y     N  G AT +  + V+Y   +   S NI     + A   C     P+     V W      +R+ Y    D     S  ++  +                       S L I   +  D G ++C+  N +      ++ L +   P   K     +  +       L C       P   W      +P +    +     +I   T+   L +     + +G Y+C A+NE G + +  V L  T QPD P S  +  +  + + L+W  G DGG + ++++R+
Sbjct:   38 RRRCRQHWIKHLQLLRLLAVIVLASAPVPSHAQQ-----------QKFRTTP-HDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQCQVGPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQD--------LQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKAL--------SPDMPMRATVQLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSR-GGNPPAQLIW-------YKNGSQIRMAY-----------------RTSGR-----LSENIYT------FTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTI--VSP--------EGGWTTTSNITAVVEPNKRSL---VVICHGLNMQLTENVV---STHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKNDKRI--NSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIE-----PEELRPGMEATIICDSSSSNPPAKLSWWK--------------DGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEA-----------VSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVEGKPLTEEH-VKW------ERVGY----DMTVKTSTTFANGT-----------------------SYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEA-VETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRY 1003          
BLAST of NPHS1-3 vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0111043)

HSP 1 Score: 174.096 bits (440), Expect = 2.299e-43
Identity = 235/1113 (21.11%), Postives = 408/1113 (36.66%), Query Frame = 3
Query:   27 EKKMYQIWI----VIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLP-SIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGH---QILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQN--SNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNP-NEKSSFPPFIQQNHLDIISGIE---NEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKL-KRTLNSGFIECHAT----TENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQS------RLSHKILPEKYKPIVKNIKLKVLY-PPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWY---------FQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWL-----VPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
             ++  Q WI    ++ L + I+  S+P+P    Q           Q F+  P  D  VL      + C V N  G VQW      LG+   +PG PR  ++GD  +G +NL+I+ A   D  DY+CQV P   +  +R  + L V   P SI    Y +          D        L+L C+     P     W+  + E   ++ E  +  +     ++ S             +  C  ++KA         S      A V + +    G P I+   + + +     +E  C  +  G+P ++L W       ++  + I++ Y                 RT  R     +SE+ +       F      N  +      N  S NP   +          H+ ++   E    + + + C T+       +KW++      + +  TI  +SP            T  + IT  ++  KR+L    + CH      TEN +        NV Y     +ISGY+    +  G +  L C S GGNP  TL WYKN+  +  +  I+   +  + +        DN  +  CEA +   ++   +S  L ++     V + I      P ++        +C+SSSSNP + ++W                    ++G  +T+ PG + G  +  +  + +  + N  +  CQS      R +H+            + L VLY P F+    ++    EG ++ +  Q  ANP    + W            +R  +   +L    +H +D+G Y     N  G AT +  + V+Y   +   S NI     + A   C     P+     V W      +R+ Y    D     S  ++  +                       S L I   +  D G ++C+  N +      ++ L +   P   K     +  +       L C       P   W      +P +    +     +I   T+   L +     + +G Y+C A+NE G + +  V L  T QPD P S  +  +  + + L+W  G DGG + ++++R+
Sbjct:   38 RRRCRQHWIKHLQLLRLLAVIVLASAPVPSHAQQ-----------QKFRTTP-HDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQCQVGPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQD--------LQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKAL--------SPDMPMRATVQLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSR-GGNPPAQLIW-------YKNGSQIRMAY-----------------RTSGR-----LSENIYT------FTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTI--VSP--------EGGWTTTSNITAVVEPNKRSL---VVICHGLNMQLTENVV---STHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKNDKRI--NSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIE-----PEELRPGMEATIICDSSSSNPPAKLSWWK--------------DGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEA-----------VSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVEGKPLTEEH-VKW------ERVGY----DMTVKTSTTFANGT-----------------------SYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEA-VETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRY 1003          
BLAST of NPHS1-3 vs. Ensembl Zebrafish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 186.808 bits (473), Expect = 2.324e-47
Identity = 243/1060 (22.92%), Postives = 404/1060 (38.11%), Query Frame = 3
Query:  150 QCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQV-QPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIIN--IQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQN-SNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRV----NVSCISESPF-ITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLK-QKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNI-KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQN---------RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSN-FSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGT--DISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            Q FK  P  +  V    +  + C V    G VQW    L+LG  RS+PG PR  + GD  KG+++L+I     ED G YECQV +   + P++ R   L+V    S PY  ++ E  +       + V+        C++    P      F +  E+   E   +      +Q   + +++         ++ C  KN A+           +  E  +T+ ++     P+I    N+ V   + ++  C M   G+P + L W+ N   G  +     + +   +   +  + +K  +   H V    +++ ++ SP  +T++     + V   P ++++                        L     +E E+IN+ C TSS    ++++W L    F + ++  +               N  + T      K+ R  N   ++C A  +       +  +  V+Y  +   +        +H G  + L C S GGNP+  L W KNN +VL + +  + +   + + L  +   DN     C++ ++  KV+  ++ F    V+FP V ++I        ++   +T +  C + SSNP + I+W L                 +++G        ++ G    SKL+L L        + CQ+     +L E     V N   L VL+PP F     + + V E  T  L  ++SANP      W FQ          R+  S   L I N+   D G Y     N  GS      +DV+YSP V   S  +F    D+A+  C A  NPI S+ FS  W      D +      D   +L+I Y    +                                   G YQC   NGI   G     L +   P   K  Q+ K  +  D S+ + + C           W     P          TTE   +     L +  V     +  + C A N  G   L  + LL T  PD P   KL  + + ++ L W+ G DGG  Q F++R+
Sbjct:   27 QAFKTEP-RNVTVRAGATALLKCEVLRASGAVQWVKDGLLLGPLRSLPGYPRYSMTGDQKKGQYHLQILDVTLEDDGPYECQVGRSESSRPIVSRTVWLNVQIPSSQPY--FQLESEEPWVEGEQYTVT--------CIAPDAKPPAEITMFRDGEELLESESYTMSGSQDKLQNTHAEVTIRARSSDDTRRLTCRAKNPASP----------RALETGMTMKVYFPPQAPMIMGLENEEVKAGSFLKVVC-MSYGGNPLATLHWTKN---GEVLSTSWDVDFVSRRASSVLKMEVKPEDN--HAVLQCQSINQVTRSPMSLTRT-----LTVLFEPAEVTL------------------------LGSFEAVEGEEINLSCSTSSSNPPVHIRWWL---GFKELNRTEVTFAE---------GDNGGMMTVSNLTHKVSREDNGLSLQCEAFNKGTRFSSVRAAELIVYYPPQKVWLDAPPPNVFLHSGSTLRLVCFSSGGNPTGQLTWLKNNKVVLTASKQVSSERGVSRELLLILHPSDNLATYRCDSSNKAKKVLSTQTKF---RVLFPAVSVKIVAKQ---KELRRGQTLDLDCLAGSSNPTANISWSL--------------GPVILKGVDQAPKRAEFGGMSRTSKLSLTLESHHWRKRITCQA--FSNVLSEG----VNNFYSLDVLFPPEFSDEQPDEVQVIEDETATLPAKVSANPDEITCEWIFQGEKLVKERDPRYTFSDWTLEIVNVSRRDGGDYIIECSNAEGSNRTKLRLDVQYSPTVRMKSDPVFVNIGDTADLLCVADANPITSSMFSWKWMGEGERDELGEESEDDGTGVLTI-YEVTRDRA---------------------------------GVYQCTADNGISPTGSVEGQLIVRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDLGNPRYEETTESTGTIHTSILTVINVSAALDYAIFTCTAHNSMGEDSLD-IQLLSTNHPDPPSDLKLLRVDQTSVTLEWMPGFDGGLTQIFRVRY 957          
BLAST of NPHS1-3 vs. Ensembl Zebrafish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 186.808 bits (473), Expect = 2.804e-47
Identity = 243/1060 (22.92%), Postives = 404/1060 (38.11%), Query Frame = 3
Query:  150 QCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQV-QPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIIN--IQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQN-SNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRV----NVSCISESPF-ITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLK-QKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNI-KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQN---------RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSN-FSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGT--DISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            Q FK  P  +  V    +  + C V    G VQW    L+LG  RS+PG PR  + GD  KG+++L+I     ED G YECQV +   + P++ R   L+V    S PY  ++ E  +       + V+        C++    P      F +  E+   E   +      +Q   + +++         ++ C  KN A+           +  E  +T+ ++     P+I    N+ V   + ++  C M   G+P + L W+ N   G  +     + +   +   +  + +K  +   H V    +++ ++ SP  +T++     + V   P ++++                        L     +E E+IN+ C TSS    ++++W L    F + ++  +               N  + T      K+ R  N   ++C A  +       +  +  V+Y  +   +        +H G  + L C S GGNP+  L W KNN +VL + +  + +   + + L  +   DN     C++ ++  KV+  ++ F    V+FP V ++I        ++   +T +  C + SSNP + I+W L                 +++G        ++ G    SKL+L L        + CQ+     +L E     V N   L VL+PP F     + + V E  T  L  ++SANP      W FQ          R+  S   L I N+   D G Y     N  GS      +DV+YSP V   S  +F    D+A+  C A  NPI S+ FS  W      D +      D   +L+I Y    +                                   G YQC   NGI   G     L +   P   K  Q+ K  +  D S+ + + C           W     P          TTE   +     L +  V     +  + C A N  G   L  + LL T  PD P   KL  + + ++ L W+ G DGG  Q F++R+
Sbjct:   72 QAFKTEP-RNVTVRAGATALLKCEVLRASGAVQWVKDGLLLGPLRSLPGYPRYSMTGDQKKGQYHLQILDVTLEDDGPYECQVGRSESSRPIVSRTVWLNVQIPSSQPY--FQLESEEPWVEGEQYTVT--------CIAPDAKPPAEITMFRDGEELLESESYTMSGSQDKLQNTHAEVTIRARSSDDTRRLTCRAKNPASP----------RALETGMTMKVYFPPQAPMIMGLENEEVKAGSFLKVVC-MSYGGNPLATLHWTKN---GEVLSTSWDVDFVSRRASSVLKMEVKPEDN--HAVLQCQSINQVTRSPMSLTRT-----LTVLFEPAEVTL------------------------LGSFEAVEGEEINLSCSTSSSNPPVHIRWWL---GFKELNRTEVTFAE---------GDNGGMMTVSNLTHKVSREDNGLSLQCEAFNKGTRFSSVRAAELIVYYPPQKVWLDAPPPNVFLHSGSTLRLVCFSSGGNPTGQLTWLKNNKVVLTASKQVSSERGVSRELLLILHPSDNLATYRCDSSNKAKKVLSTQTKF---RVLFPAVSVKIVAKQ---KELRRGQTLDLDCLAGSSNPTANISWSL--------------GPVILKGVDQAPKRAEFGGMSRTSKLSLTLESHHWRKRITCQA--FSNVLSEG----VNNFYSLDVLFPPEFSDEQPDEVQVIEDETATLPAKVSANPDEITCEWIFQGEKLVKERDPRYTFSDWTLEIVNVSRRDGGDYIIECSNAEGSNRTKLRLDVQYSPTVRMKSDPVFVNIGDTADLLCVADANPITSSMFSWKWMGEGERDELGEESEDDGTGVLTI-YEVTRDRA---------------------------------GVYQCTADNGISPTGSVEGQLIVRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDLGNPRYEETTESTGTIHTSILTVINVSAALDYAIFTCTAHNSMGEDSLD-IQLLSTNHPDPPSDLKLLRVDQTSVTLEWMPGFDGGLTQIFRVRY 1002          
BLAST of NPHS1-3 vs. Ensembl Zebrafish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 144.05 bits (362), Expect = 3.825e-34
Identity = 168/694 (24.21%), Postives = 262/694 (37.75%), Query Frame = 3
Query: 1221 LDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLK-QKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNI-KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQN---------RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSN-FSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGT--DISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            L     +E E+IN+ C TSS    ++++W L    F + ++  +               N  + T      K+ R  N   ++C A  +       +  +  V+Y  +   +        +H G  + L C S GGNP+  L W KNN +VL + +  + +   + + L  +   DN     C++ ++  KV+  ++ F    V+FP V ++I        ++   +T +  C + SSNP + I+W L                 +++G        ++ G    SKL+L L        + CQ+     +L E     V N   L VL+PP F     + + V E  T  L  ++SANP      W FQ          R+  S   L I N+   D G Y     N  GS      +DV+YSP V   S  +F    D+A+  C A  NPI S+ FS  W      D +      D   +L+I Y    +                                   G YQC   NGI   G     L +   P   K  Q+ K  +  D S+ + + C           W     P          TTE   +     L +  V     +  + C A N  G   L  + LL T  PD P   KL  + + ++ L W+ G DGG  Q F++R+
Sbjct:  210 LGSFEAVEGEEINLSCSTSSSNPPVHIRWWL---GFKELNRTEVTFAE---------GDNGGMMTVSNLTHKVSREDNGLSLQCEAFNKGTRFSSVRAAELIVYYPPQKVWLDAPPPNVFLHSGSTLRLVCFSSGGNPTGQLTWLKNNKVVLTASKQVSSERGVSRELLLILHPSDNLATYRCDSSNKAKKVLSTQTKF---RVLFPAVSVKIVAKQ---KELRRGQTLDLDCLAGSSNPTANISWSL--------------GPVILKGVDQAPKRAEFGGMSRTSKLSLTLESHHWRKRITCQA--FSNVLSEG----VNNFYSLDVLFPPEFSDEQPDEVQVIEDETATLPAKVSANPDEITCEWIFQGEKLVKERDPRYTFSDWTLEIVNVSRRDGGDYIIECSNAEGSNRTKLRLDVQYSPTVRMKSDPVFVNIGDTADLLCVADANPITSSMFSWKWMGEGERDELGEESEDDGTGVLTI-YEVTRDRA---------------------------------GVYQCTADNGISPTGSVEGQLIVRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDLGNPRYEETTESTGTIHTSILTVINVSAALDYAIFTCTAHNSMGEDSLD-IQLLSTNHPDPPSDLKLLRVDQTSVTLEWMPGFDGGLTQIFRVRY 830          
BLAST of NPHS1-3 vs. Ensembl Zebrafish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 68.9366 bits (167), Expect = 3.209e-11
Identity = 56/203 (27.59%), Postives = 79/203 (38.92%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWN---------SREVTTDEMEFIL--IINIQPNXXXXXXXXXXXXXGHQILCVIKNKATEL 752
            D  V+I + + +SCVV N  G VQW    L LG    +   PR +++  +  G++NL+IT A   D   YECQ        L  R++ L V   P  P I          E   +  ++      L CVS G  P    +W+ +         S EV +D         + IQP             +G    CV  N A  L
Sbjct:   33 DQSVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAA---LRSRRAKLTVLIPPDGPVI----------EGSPEILLTAGTSFNLTCVSRGAKPMSTIEWYKDGIIVEGAHTSTEVLSDRKRVTTKSFLEIQP---------MDTDTGRNFTCVASNLAAPL 213          
BLAST of NPHS1-3 vs. Ensembl Zebrafish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 68.9366 bits (167), Expect = 3.615e-11
Identity = 56/203 (27.59%), Postives = 79/203 (38.92%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWN---------SREVTTDEMEFIL--IINIQPNXXXXXXXXXXXXXGHQILCVIKNKATEL 752
            D  V+I + + +SCVV N  G VQW    L LG    +   PR +++  +  G++NL+IT A   D   YECQ        L  R++ L V   P  P I          E   +  ++      L CVS G  P    +W+ +         S EV +D         + IQP             +G    CV  N A  L
Sbjct:   33 DQSVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAA---LRSRRAKLTVLIPPDGPVI----------EGSPEILLTAGTSFNLTCVSRGAKPMSTIEWYKDGIIVEGAHTSTEVLSDRKRVTTKSFLEIQP---------MDTDTGRNFTCVASNLAAPL 213          
BLAST of NPHS1-3 vs. Ensembl Xenopus
Match: NPHS1 (NPHS1 nephrin [Source:NCBI gene;Acc:100494620])

HSP 1 Score: 74.7146 bits (182), Expect = 9.960e-13
Identity = 105/466 (22.53%), Postives = 177/466 (37.98%), Query Frame = 3
Query: 1233 SGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKT-KFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFL--CESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNR----------FISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKV---VKTSINIFNDSAEFFCEASMNPIYSNF----SVVWRRI 2567
            SG E  ++   CFT++    + ++W L   + V+    TI  +S  +        N T++          R  +   + C A  E  +  K  +   +V Y  +   I    +      G  + +TC S GGNP P L W K+   +    +I + K   T +        DN     C A   N+   P  +    + V FP +      +N I +     R +  +  C + SSNP S I+W       ++ G          +       P  Y G  + S++ L    K N   + C++  S  +L E         KL +L+PP F+ +    +   E     +  ++ ANP   +++W                +  +  L I N+   DSG Y     N  G  +    +DV+YSP +     T +++ +D AE  C A  NP   +      +VW R+
Sbjct:  335 SGPEKSNLTFSCFTAASNPPVQIRWWLGPKELVN----TIVTISDAVHGGKVTMSNLTMEAL--------REEHGMALTCEAFNEAILYTKSNSVTLSVQYPPQNVWIEAPPADKFFRAGTSVKMTCFSSGGNPPPRLTWIKDTKSLSGGSQIHSGK-IVTKEITIITVPSDNMATYRCNAS--NIGKTPALTASTKLKVQFPAID-----VNIISSAKEYRRGSTIILTCVTGSSNPASTISW-------VKDGEQLKAQDLGRK-------PSLYGGISSSSRVTLKAASKDNGRRVSCEAFSS--VLNEAVNTF---YKLNILFPPEFLDDQPAVVQAVEHGAALIPVRVRANPPQINYTWSLWGEKLIRDGAYRHHLRGEGALEIWNVSRADSGVYNVTCVNKEGKNSIVIRLDVQYSPTIRSLGDTEVDLGSD-AEIACTADANPATDSMFQWRWLVWIRL 760          

HSP 2 Score: 71.633 bits (174), Expect = 8.800e-12
Identity = 45/133 (33.83%), Postives = 68/133 (51.13%), Query Frame = 3
Query:   78 IYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAI-SCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAH-PLLRRKSTLHVTKLPSIP 470
            +Y S PL VT  Q           Q F+  P  D   ++  S A+ SC V +  G VQW    L+LG DR++PG  R  + GD  KGE+NL+I +++ +D  +Y CQV   +    ++ R + ++V   P  P
Sbjct:    6 LYVSLPLGVTAKQ-----------QVFRVQP--DNITVVQGSTALLSCEVEHGTGMVQWEKNGLLLGPDRNIPGFLRYSMTGDPHKGEYNLRIERSELDDDAEYHCQVGRSEVSLGIISRTALINVLIPPKAP 125          

HSP 3 Score: 56.9954 bits (136), Expect = 2.387e-7
Identity = 56/195 (28.72%), Postives = 92/195 (47.18%), Query Frame = 3
Query: 1392 SKNHTIQTFITQKIKLKRTLNSGFIECHATTEN-QILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLV---LFSDE-IKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKL 1961
            S++    T +  K+  + + N   + C A     Q  +      NV +     +I GY+    V  G+ + L C S  GNP  TL+W KN+ +V     +DE ++  +   TL+    +   DN   V CEA + +V    +K++ +I+NV+F P  + I   +  P K  +N T  F C +++SNP   I W L
Sbjct:  178 SRDKLENTAMVAKVIPQSSDNGKLLTCLALNPALQTPITVSFTMNVLFPPNAPIIEGYIGP-SVKAGETLKLICISLSGNPLATLQWSKNDDVVSTRWETDEVVRASRSHLTLN----IKPADNMAVVSCEAVN-HVTPETLKTS-IILNVVFLPTEVTILGSSSGPEK--SNLT--FSCFTAASNPPVQIRWWL 361          
BLAST of NPHS1-3 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 69.3218 bits (168), Expect = 2.775e-11
Identity = 43/136 (31.62%), Postives = 58/136 (42.65%), Query Frame = 3
Query:   63 LGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIP 470
             GS   Y + PL         A  L  +   F + P +D  ++   S+ + CVV    G VQW    L LG +R +PG  R  ++GD + GEHNL I   +  D   YECQ           R + L     P IP
Sbjct:    7 FGSLSSYPTWPLTHLVPFSICAFFLTGFGAHFSQQP-SDKVIVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRARLTVLLPPGDPMIP 141          
BLAST of NPHS1-3 vs. Ensembl Xenopus
Match: ptk7 (protein tyrosine kinase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-5846944])

HSP 1 Score: 68.5514 bits (166), Expect = 5.623e-11
Identity = 80/341 (23.46%), Postives = 143/341 (41.94%), Query Frame = 3
Query: 2178 KNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWY--FQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGIN-----KNNKIYSK-----LIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILF 3164
            K + + VLY P +   + S  + EGS   L   + ANP+  + +WY  ++     ++  L    I   DSGSY+   +N++GS + +   DV      V  S   F DS     ++ ++ + ++       +EP           F+   S+ +SCN NS         SN G++     KN K+ +      +II   +E   G Y C   N IG    + + +N+   P  ++++  ++  T+     L   C +   NP++     + +  +      EI   TF G       + +  G+Y C+A+N  G+     ++L   F   F E + L+  F
Sbjct:  334 KGVAINVLYAPTVTLKIPSREIREGSQYTLTCSVDANPQPVNITWYKDYEKILNKNRDTLTFPTIREQDSGSYRCKADNIIGSESSA---DVYGITCCVTVS---FRDSLVCRTDSLISDLNASLISFVFVVEPK-------KPSFVEGSSLRFSCNVNS---------SNPGVSQFTWYKNEKVMASERKNYIIIDTIKEEHHGNYMCKAGNKIGATSSQAVSINVLYPPKGVRVTPQAQIITEGDRIRL--ACSVDKSNPTVTEFRWYKDSALQPHRNKEI---TFPGI------KRTDSGKYTCEARNGIGNVTSQPITLNVQF---FMEKYSLWETF 638          
BLAST of NPHS1-3 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 67.781 bits (164), Expect = 8.478e-11
Identity = 36/105 (34.29%), Postives = 49/105 (46.67%), Query Frame = 3
Query:  156 FKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIP 470
            F + P +D  ++   S+ + CVV    G VQW    L LG +R +PG  R  ++GD + GEHNL I   +  D   YECQ           R + L     P IP
Sbjct:   30 FSQQP-SDKVIVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRARLTVLLPPGDPMIP 133          
BLAST of NPHS1-3 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 67.781 bits (164), Expect = 8.556e-11
Identity = 36/105 (34.29%), Postives = 49/105 (46.67%), Query Frame = 3
Query:  156 FKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIP 470
            F + P +D  ++   S+ + CVV    G VQW    L LG +R +PG  R  ++GD + GEHNL I   +  D   YECQ           R + L     P IP
Sbjct:   26 FSQQP-SDKVIVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRARLTVLLPPGDPMIP 129          
BLAST of NPHS1-3 vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 77.411 bits (189), Expect = 1.178e-13
Identity = 121/563 (21.49%), Postives = 197/563 (34.99%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQ-----------TLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQY---NGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNI-----KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLF 3155
            G  + L C + GGNP P+L W K++  V    + +  +  Q           + + +  +   DN  K  C+A   +       S  L++   FPP +L I                  L  SS+  PG  +    L C SI      N         LS +  G+       K QS         ++ F+        H++    +   ++       +L VLYPP F+   + ++ V E     L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A    ++DV Y+P +      T +N+   S +  C    NPI       W R+  ++     D  + +           +   T ++RI             +KL       S  G YQC+  NG+    R  + L +   P     +  +K     D +  + L C      N    W    VP   +    T     +       L +  V     +  +KC A N  GS     + L+   +PD P   K+ 
Sbjct:  472 GTRVRLVCLAIGGNPEPSLTWLKDSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKFSCKAGQLSA------STQLVVQ--FPPTNLTI------------------LANSSALRPGDALN---LTCVSISSNPPVN---------LSLDKEGERLDDVAAKPQSAPFKGSAASRSVFLRVSSRDHGHRVTCRAHSEALRETVSSFYRLNVLYPPEFLGEQVRAVTVVEQGQALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGFYQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNV-GGSVDIVCTVDANPILPEM-FSWERLGEDEEELNLDDMEKM-----------SKGSTGRLRIRQ-----------AKL-------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDLQDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDH-TNIQLVSISRPDPPLGLKVV 964          

HSP 2 Score: 54.6842 bits (130), Expect = 1.001e-6
Identity = 29/86 (33.72%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  186 VLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTL 443
            V+   ++ + C V      VQW    L+LG +  +PG PR  + GD  KGE +L I      D  +YECQV   +  P L   S +
Sbjct:   57 VVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVI 142          
BLAST of NPHS1-3 vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 77.0258 bits (188), Expect = 1.591e-13
Identity = 121/563 (21.49%), Postives = 197/563 (34.99%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQ-----------TLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQY---NGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNI-----KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLF 3155
            G  + L C + GGNP P+L W K++  V    + +  +  Q           + + +  +   DN  K  C+A   +       S  L++   FPP +L I                  L  SS+  PG  +    L C SI      N         LS +  G+       K QS         ++ F+        H++    +   ++       +L VLYPP F+   + ++ V E     L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A    ++DV Y+P +      T +N+   S +  C    NPI       W R+  ++     D  + +           +   T ++RI             +KL       S  G YQC+  NG+    R  + L +   P     +  +K     D +  + L C      N    W    VP   +    T     +       L +  V     +  +KC A N  GS     + L+   +PD P   K+ 
Sbjct:  458 GTRVRLVCLAIGGNPEPSLTWLKDSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKFSCKAGQLSA------STQLVVQ--FPPTNLTI------------------LANSSALRPGDALN---LTCVSISSNPPVN---------LSLDKEGERLDDVAAKPQSAPFKGSAASRSVFLRVSSRDHGHRVTCRAHSEALRETVSSFYRLNVLYPPEFLGEQVRAVTVVEQGQALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGFYQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNV-GGSVDIVCTVDANPILPEM-FSWERLGEDEEELNLDDMEKM-----------SKGSTGRLRIRQ-----------AKL-------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDLQDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDH-TNIQLVSISRPDPPLGLKVV 950          

HSP 2 Score: 54.6842 bits (130), Expect = 1.096e-6
Identity = 29/86 (33.72%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  186 VLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTL 443
            V+   ++ + C V      VQW    L+LG +  +PG PR  + GD  KGE +L I      D  +YECQV   +  P L   S +
Sbjct:   43 VVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVI 128          
BLAST of NPHS1-3 vs. Ensembl Mouse
Match: Kirrel2 (kirre like nephrin family adhesion molecule 2 [Source:MGI Symbol;Acc:MGI:2442334])

HSP 1 Score: 69.707 bits (169), Expect = 1.908e-11
Identity = 62/242 (25.62%), Postives = 87/242 (35.95%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEG-GLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMK 899
            D  VL+ +   + C +    G VQW    L LG +R +PG  R  I G+   G+H+L I   + ED   YECQ        L  R + LHV   P  P +L               ++       L C S G   P P   WF +   +  D   F                       HQ    +K+KAT  +E+ L  T    +   T+I   RS         Q +    D   T S++
Sbjct:   29 DMVVLLGEEARLPCALGAYRGLVQWTKDGLALGGERDLPGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAG---LRSRPAQLHVMVPPEAPQVL----------GGPSVSLVAGVPGNLTCRSRGDSRPAPELLWFRDG--IRLDGSSF-----------------------HQT--TLKDKATGTVENTLFLTPSSHDDGATLICRARS---------QALPTGRDTAVTLSLQ 221          
BLAST of NPHS1-3 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 64.6994 bits (156), Expect = 9.193e-10
Identity = 85/405 (20.99%), Postives = 165/405 (40.74%), Query Frame = 3
Query: 2178 KNIKLKVLYPPFIM--NSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQN-------------LIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVV----KTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKP-WYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIR--QSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKG-ADGG-------------SEQTFQLRWWDEKQQSTFRYQTVKG 3284
            K+I++ V  PP +    S+ +     G +V L       P+ T  SW      I +++              L I+N+  ND   Y  + EN  G    S  + V   PK+     +T++ +  +     CEAS +PI    S+ WR    N  I+  +   +             ++P  Q  ++ +  +  + ++ S L +   Q +D G Y C   N IG +  ++++L +   P     ++ Y+ +G  ++    +TC   ++ + +I W      +++ S+N + I+   +    +L +    E+ FG Y C A N  G   L ++ L+    P  P S      + +   + + +  A GG              E+++  +W+D K+ +     T+ G
Sbjct:  160 KDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPT-MSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMEL-EEQVTLTCEASGDPIP---SITWRTSTRN--ISSEEKASW-------------TRPEKQETLDGHMVVRSHARV-SSLTLKSIQYTDAGEYICTASNTIG-QDSQSMYLEVQYAPKLQGPVAVYTWEGNQVN----ITCEVFAYPSATISWF--RDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFI-LVQADTPSSP-SIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMG 534          
BLAST of NPHS1-3 vs. Ensembl Mouse
Match: Ncam2 (neural cell adhesion molecule 2 [Source:MGI Symbol;Acc:MGI:97282])

HSP 1 Score: 62.7734 bits (151), Expect = 3.378e-9
Identity = 84/365 (23.01%), Postives = 134/365 (36.71%), Query Frame = 3
Query: 2178 KNIKLKVLYPPFIMNSLNSL--YVFEGSTVNLQYQISANPKATHFSWYFQNRFI---------SSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKV--VKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYL--KISQYSKQGTDISHHSLLTCCFLSHVNPSIFW-----LVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGS 3212
            ++I + V  PP IM    S       G  + L  + S +P  T  SW+   + I          S   L ++NI   D GSY     N  G   +   + V   P +  +K      N      CEA   P+     + W+R                 I  + +S    S P  ++ +    G        S L I   + SD G Y C   + IG   R ++HL+I   P ++  +   YS +G  I+    ++C   ++   SI W     L+P  N     T++   +       L +    ++ FG+Y C A N  G+    Y+  L    P  P   K+  L +    +S+ K    G 
Sbjct:  199 RDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKASGSPDPT-ISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVP---EITWKRA----------------IDGVMFSEGDKS-PDGRIEVKGQHG-------RSSLHIRDVKLSDSGRYDCEAASRIGGHQR-SMHLDIEYAPKFVSNQTMYYSWEGNPIN----ISCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKM-----ILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADV-PSSPHGVKIIELSQTTAKISFNKPESHGG 524          
BLAST of NPHS1-3 vs. UniProt/SwissProt
Match: sp|Q9U3P2|SYG2_CAEEL (Synaptogenesis protein syg-2 OS=Caenorhabditis elegans OX=6239 GN=syg-2 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.958e-20
Identity = 110/522 (21.07%), Postives = 218/522 (41.76%), Query Frame = 3
Query: 1728 RVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSW--------YFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS---INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII------FSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            RV +  N Q++ CEA +  +    ++S +L  +V +PP  + I   +    +++  ++   +C + SSNP + I+W+    +           + V  G +S N   + NG+  ++ L+     + +  ++ C +  +H   PE    +  +  L V+YPP  ++N   ++ + EG +      +  NP  + + W        +   R  +    L  K +   D+G Y     N +GS   + ++ V+YS ++   S   I    D+    CEA   P  +N  + W          Y++      IL+  +  +  +     +R+N+                    E   G Y C   NGIG+       L +   P  L +++Y+K    +   +   C    +  P++ ++     ++I      +S   T+I  ST+   L +  +  + Y  + KC A+N  G+  L+ + ++P   PD P +  +     N I ++W    DGGS+Q F++++
Sbjct:  546 RVDRTMNTQRLKCEATNAALDEPLIESQYL--SVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFSRATD---------DNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIA--NH---PEWKHSVNTSFPLNVMYPPKMLVNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDTVLLECEADGEPSKANM-IHW----------YKNGE----ILAAQHRGHKKAI----LRLNAT-------------------EQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKV--YAVPTVEFVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLS-IPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKY 1010          

HSP 2 Score: 60.077 bits (144), Expect = 1.511e-7
Identity = 57/252 (22.62%), Postives = 100/252 (39.68%), Query Frame = 3
Query: 1227 IISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHA-TTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSI 1979
            II+  EN  +N+ C   +      + W      ++DG     +++S  +K       N T   + +  ++  R  +   I C A   E  I +   T  +V +      +    +   +  GD + + C   GGNP P + WY  N  +     + T  +E  +  +Y      N      E ++ N +    K   + + V +PP  +E+   + I     AN      C+S  SNP S ITW ++N  S+
Sbjct:  139 IIAVKENTPLNITCVVPNVKPEPEVLW------YMDG-----KVMSRDVKQASTPHLNKTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRLQSHSTLDTRSKE--IKNIYSFIASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFGESNIRYGSSAN----IQCKSLPSNPASQITW-IINGRSV 372          
BLAST of NPHS1-3 vs. UniProt/SwissProt
Match: sp|Q9R044|NPHN_RAT (Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 6.520e-19
Identity = 136/592 (22.97%), Postives = 218/592 (36.82%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQ-----------TLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQ----SRLSHKILPEKYKPIVKNI-KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLH------MYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            G  + L C + GGNP P+L W+K++  V    + +  +  Q           + + +  +   DN  K  C+A   +       S  L++   FPP +L I                  L  SS+  PG  +    L C SI      N S       L      +    K QS         ++ F+         R++ +   E  +  V +  +  VLYPP F+   + ++ V E   V L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A    ++DV Y+P +      T +N+   S +  C    NPI       W R+         +  D    L+++     +   T ++RI             +KL       S  G YQC+  NG+    R  + L +   P   + +  +K     D +  + L C      N    W    VP     +     TE R     G +H        V     +  +KC A N  GS     + L+   +PD P   K+  +  +++ L W  G DGG  Q FQ+R+
Sbjct:  472 GTRVRLVCLAIGGNPDPSLIWFKDSRPVSEPRQPQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNRAKFSCKAGQLSA------STQLVVQ--FPPTNLTI------------------LANSSALRPGDALN---LTCVSISSNPPVNLSWDKEGERL------EDVAAKPQSAPFKGSAASRSVFLRVSSRDHGQRVTCRAHSEALRETVSSFYRFNVLYPPEFLGEQVRAVTVVEQGQVLLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGFYQLHCQNSEGTAEALLKLDVHYAPTIRALRDPTEVNV-GGSVDIVCTVDANPILPEM-FSWERL-------GEEEED----LNLDDMEKVSKGSTGRLRIRQ-----------AKL-------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDQPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLD---LQDPRYTEHRYHQ--GVVHSSLLTIANVSAAQDYALFKCTATNALGSDH-TNIQLVSISRPDPPLGLKVVSISPHSVGLEWKPGFDGGLPQRFQIRY 991          
BLAST of NPHS1-3 vs. UniProt/SwissProt
Match: sp|O60500|NPHN_HUMAN (Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 8.371e-19
Identity = 127/578 (21.97%), Postives = 215/578 (37.20%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLI----INVIFPPVHLEISCLNCIPNKIMANRTNEFL---CESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLY-PPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW 3236
            G  + L C + GGNP P+L WYK++  V  S  +  +     L  + +     + + V     S+N      K+  L     + V FPP ++ I           A R  + L   C S SSNP   ++W              +     ++G  +      + G      + L ++ + +   + C++  +     E  + +    +L VLY P F+   +  +   E     L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A     +DV Y+P +      T +N+   S +  C    NPI       W R+  ++     D  + +           +  PT ++RI+           ++KL       +  G YQC+  NG+    R  L L +   P     +  +K     D +  + L C      N    W    VP   +    T  T  +       L +  V     +  + C A N  GS +   + L+   +PD P   K+  L  +++ L W  G DGG  Q F +R+
Sbjct:  458 GTRVRLVCLAIGGNPEPSLMWYKDSRTVTES-RLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLAVQFPPTNVTILA------NASALRPGDALNLTCVSVSSNPPVNLSW--------------DKEGERLEGVAAPPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSA-----ELRETVSSFYRLNVLYRPEFLGEQVLVVTAVEQGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNV-GGSVDIVCTVDANPILPGM-FNWERLGEDEEDQSLDDMEKI-----------SRGPTGRLRIH-----------HAKL-------AQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQGGVHSSLLTIANVSAAQDYALFTCTATNALGSDQ-TNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRY 977          

HSP 2 Score: 59.3066 bits (142), Expect = 2.881e-7
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  201 SIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLL 425
            S+ + C V+     VQW    L+LG D  +PG PR ++ GD  +GE +L I      D  +YECQV   +  P L
Sbjct:   48 SVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL 122          
BLAST of NPHS1-3 vs. UniProt/SwissProt
Match: sp|Q9QZS7|NPHN_MOUSE (Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 8.238e-13
Identity = 121/563 (21.49%), Postives = 197/563 (34.99%), Query Frame = 3
Query: 1587 GDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQ-----------TLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQY---NGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNI-----KLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS----------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVK----TSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSK--QGTDISHHSLLTCCFLSHVNPSIFWL---VPFSNEIIFSTNTTEIRQSTFCGFLHMY-VKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLF 3155
            G  + L C + GGNP P+L W K++  V    + +  +  Q           + + +  +   DN  K  C+A   +       S  L++   FPP +L I                  L  SS+  PG  +    L C SI      N         LS +  G+       K QS         ++ F+        H++    +   ++       +L VLYPP F+   + ++ V E     L   +SANP    F+W F+   +S          S   L + N+   D G Y+   +N  G+A    ++DV Y+P +      T +N+   S +  C    NPI       W R+  ++     D  + +           +   T ++RI             +KL       S  G YQC+  NG+    R  + L +   P     +  +K     D +  + L C      N    W    VP   +    T     +       L +  V     +  +KC A N  GS     + L+   +PD P   K+ 
Sbjct:  472 GTRVRLVCLAIGGNPEPSLTWLKDSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKFSCKAGQLSA------STQLVVQ--FPPTNLTI------------------LANSSALRPGDALN---LTCVSISSNPPVN---------LSLDKEGERLDDVAAKPQSAPFKGSAASRSVFLRVSSRDHGHRVTCRAHSEALRETVSSFYRLNVLYPPEFLGEQVRAVTVVEQGQALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGFYQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNV-GGSVDIVCTVDANPILPEM-FSWERLGEDEEELNLDDMEKM-----------SKGSTGRLRIRQ-----------AKL-------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDLQDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDH-TNIQLVSISRPDPPLGLKVV 964          

HSP 2 Score: 54.6842 bits (130), Expect = 7.001e-6
Identity = 29/86 (33.72%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  186 VLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTL 443
            V+   ++ + C V      VQW    L+LG +  +PG PR  + GD  KGE +L I      D  +YECQV   +  P L   S +
Sbjct:   57 VVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVI 142          
BLAST of NPHS1-3 vs. UniProt/SwissProt
Match: sp|Q7TSU7|KIRR2_MOUSE (Kin of IRRE-like protein 2 OS=Mus musculus OX=10090 GN=Kirrel2 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.335e-10
Identity = 62/242 (25.62%), Postives = 87/242 (35.95%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEG-GLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMK 899
            D  VL+ +   + C +    G VQW    L LG +R +PG  R  I G+   G+H+L I   + ED   YECQ        L  R + LHV   P  P +L               ++       L C S G   P P   WF +   +  D   F                       HQ    +K+KAT  +E+ L  T    +   T+I   RS         Q +    D   T S++
Sbjct:   29 DMVVLLGEEARLPCALGAYRGLVQWTKDGLALGGERDLPGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAG---LRSRPAQLHVMVPPEAPQVL----------GGPSVSLVAGVPGNLTCRSRGDSRPAPELLWFRDG--IRLDGSSF-----------------------HQT--TLKDKATGTVENTLFLTPSSHDDGATLICRARS---------QALPTGRDTAVTLSLQ 221          
BLAST of NPHS1-3 vs. TrEMBL
Match: A0A0H3YJQ0 (NPHS1-3 OS=Schmidtea mediterranea OX=79327 GN=NPHS1-3 PE=2 SV=1)

HSP 1 Score: 2441.77 bits (6327), Expect = 0.000e+0
Identity = 1252/1252 (100.00%), Postives = 1252/1252 (100.00%), Query Frame = 3
Query:   36 MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVXXXXXXXXXXXXXXXXXXVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSEDIQMKLDPSSEPKELIIDQETIKF 3791
            MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVNLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSEDIQMKLDPSSEPKELIIDQETIKF
Sbjct:    1 MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVNLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSEDIQMKLDPSSEPKELIIDQETIKF 1252          
BLAST of NPHS1-3 vs. TrEMBL
Match: A0A0H3YFQ6 (NPHS1-6 OS=Schmidtea mediterranea OX=79327 GN=NPHS1-6 PE=2 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 3.678e-115
Identity = 331/1188 (27.86%), Postives = 559/1188 (47.05%), Query Frame = 3
Query:   87 SSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPV-DAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLK--LICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQ------IVDENNDMEFTCSMKPTGHPKSKLKWSMNITA-----GFRMENL----IKIKYNE---NQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHL--DIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKL---DHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSI--EIGN---STNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLN-SLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS---------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSI---NIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNS---------NSKP-------------TNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII-----FSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGS-SRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNF-SIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKND 3431
            SS   + QS +C+  E+ N IQCF+EIP   Y V    +  + C+V NQ+GKVQWRA  ++LGYDR++PG P  +++G V KGEH L+I+    +D+G YECQVQPV   HPLLRRK+ L V   P  P I YK   P  +++II+   S+K+ ++    CVS+ G P+  FQWF N+  +  +E    L+  +  ++S LSL  S  K G  I C + N+ATE+ +   + +      +V +++    G P I + N       +VD+N  M  TC   P+G P   L W             R EN     I  +Y +   +++++++ L +  L    H   + C++ +P I+  S   ++Y+ H P K+ I          ++ S     I ++ L  ++I G   E+  + C T  YY    +KW+     F     +    +SP+ K+   D    +N TI      KIK+ +  +  F++C A +  +  ++ + K ++ Y  +   I GY    PV       +TC + GGNP P L+W++++  +  S   +    ++TL  +     +DN  K FC+AKS ++K  P+ S+ + + V+FPP+ + +  L+    ++   +  +  C +  SNP +++ WKL  C  +  E+G     T C+  ++  + S    G++ G   QS   +  ++K +   + C+  + +    E+++ + K I++ V + P     +N + Y+ EG +  L  +  ANP    ++W+  +  +S         SK  LII+N    D  +Y  VV N  G +  +  +++ Y P ++        I   +AE  C    NP   + S  W ++ P        S D +P  +I   CN          N KP              +  +  S C +    ++ S LII     +D G Y+C+  NGI     + + L     P  L + ++SK   ++     L C   SH +P + W     N  +     +  N T  R   +   L +   + +  G Y C+A+N +GS SR   VS   T  PD P   ++    ++ I +SWI+G DGGS QTFQ+RW ++   S +RY+ V  + +K TL   I+   S  +Y I I   + ++   ++   I    +S  N+
Sbjct:   43 SSGAKIKQSIECTNEEIVNRIQCFQEIPKPVYEVAQGSAATLRCIVRNQYGKVQWRAVPVLLGYDRNIPGRPTYRVVGSVVKGEHFLEISNVTVKDAGIYECQVQPVGQEHPLLRRKTKLVVLVRPDQPQIFYKGFQPNGDQVIIN---SIKQDVRTEFTCVSDNGQPKVKFQWFLNNNLIQDNENS-ALLEELNYSRSRLSLKTSKFKDGDVIKCRVSNRATEVHQDPERRS---LSTEVFIVIHTPPGQPQIVDMNPHKTTPYVVDDNIIM--TCESSPSGKPAGSLLWRWKYPKVRELYNNRFENYTTKDISPQYYQQTISKNKMVSTLTIPALTSKEHGAQLFCVATNPVISYQSTAVKLYILHIPNKVVISV--------SDGSLSSRTIGKDGLNENVIYGEAGEEKTITCTTDPYYNEATIKWV-----FSPNPAINNDFISPVEKIWKEDESFRRNSTI------KIKINKQFDQSFLDCQAWSGIK-SVQSRVKLHITYSPEKPTIQGYNVGKPVKLNHNFEMTCSTIGGNPYPELQWFRDSKPIQSSFIAQQVGNQKTLKIIITPSINDNKVKYFCQAKSISLKSSPLNSDEVTLIVLFPPMTIGLKSLSGA--EVENGKLLKLQCTAGESNPPAVVRWKLNRCGQMMSELGRRPVQTTCNEELLSASSSNTINGKFGGSLIQSYFEIYPSWKDHLDYVDCE--VFNPDYGEEHQVLRKRIQINVTFSPQFEGIINYNFYIEEGQSQTLNLEPIANPPIKDYTWFRNSTKLSRKNVHSISTSKAKLIIRNAKPVDIDNYTLVVVNDRGESQITIYLNITYQPIIIGDKFERKEIIRQNAELECSVQSNPANPHMSYKWTKLVPGKGYNDISSSDLVPAFTI--GCNQSLPFSKEYKNEKPKPYSKAEWKGTPEKSNFKYFSKCMVKSQFEMTSLLIIYDVDRNDVGLYRCVVNNGIRGDVVKTIELTKEFTPQILSLPKFSKAAGNLGEEVSLFCYIRSHPSPKMTWFFGRYNTSVSANSKYRINITRFRTGFYVAQLKIVNLQRTDHGSYVCKAENGKGSDSRKIEVSGTST--PDVPLEIQVVNKSQSQIEISWIQGFDGGSIQTFQVRWKEKSPTSLYRYEDVASDDTKITLSFIITGLKSDTAYLISINSRNSKHGTSQFSKTIMTNTMSADNE 1193          
BLAST of NPHS1-3 vs. TrEMBL
Match: G7YEL7 (Nephrin OS=Clonorchis sinensis OX=79923 GN=CLF_106049 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 2.424e-110
Identity = 323/1239 (26.07%), Postives = 542/1239 (43.74%), Query Frame = 3
Query:   51 IVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDA--HPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTD----------------EMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVD--ENNDMEFTCSMKPTGHPKSKLKW--------------------------SMNITAGFR--------------------MENLIK-----IKYNENQ--DELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNC------SSIEIGNST--------------NCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKN-IKLKVLYPP--FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSG-----------------SYKFVVENLLGSATRSFEIDVKYSPKVVKTS----INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCN-SNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFS--------------TNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW-WDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSI 3368
            +V V+   ++  S    V QS  C+ +E ++ IQCF  +P   Y V + +++ + CVV NQHGKVQWRAK ++LGYDRS+PG PR +IIGDV +G+H L+I   Q ED+G+YECQV PV A  HPLLRRK+ L V   PS+P ILY +  P +N++II     + + + ++CV+ GG P P F W  N++E+ T                 +++ I+    +  +S LSL  + LK G Q+ C + N AT+L     Q   +    +V + +    G P I +     +  E  +++  C   P G+P   L W                           MN  +                       M +LI      + Y  N+  D+LI  L++ ++ R +H   + C +  P  +      +I+VK+ P     VT + E  +  E+      +      ++ G   E   ++C TS Y+   N+KWI Q  D   G     + L    K+         +Q      +K+    + G+++C   +E  + +  + + ++ Y   + VI+GY +  PV     + +TC + GGNP P L W+++   +  S+E+     + +L       + DNG    C A++     + + S  +++NV+FPP  + ++     P+ + + +     C++ SSNP +II W    C      S  +   +T               C S  ++GT     PG   G K QS+L L   +  +   ++C++       PE   P+  + ++L + + P    + +     + EG+TVNL     +NP  T  SW+ + R I  +          + SG                 +Y  V  N +  ++  F ++V +   +   +        +D     C+A+ NP  +  S  W R  P      +D  +    LS    CN S++ P+   +   +C  + +  + S+  I      D G Y C   NG+G   R+N+H      P  +++ +Y+K   +      LTC   +   P I WL   + +II                T    IR   +   L +   +++ FG Y+CQA N +G + L  VSL  T  PD P + +L     N++ ++W +G DGG  QTFQ+RW       + F+Y  V  N +   +E  I+    G+    + VNS+
Sbjct:   25 LVFVVTIGLLQVSDAARVIQSSACTPQERQDRIQCFDVLPQDQYSVPLGNTVNMQCVVLNQHGKVQWRAKKILLGYDRSLPGYPRYRIIGDVGRGQHTLQIMDVQLEDAGEYECQVTPVPANNHPLLRRKTELVVLVKPSVPRILYPDVPPPDNQLIISQPDPIVR-ITVLCVTVGGSPPPSFTWIINNQEIPTKPLQTSAGRHPDRGPWAKLDPIINTETEKQESRLSLLKAGLKDGDQLTCGVTNAATQLHHDIQQ---RNLTTQVMIRVHTPPGPPRIISPETKYEYLEGEELKAVCVASPPGNPFGGLFWRWLLQPAQVGDQKTGRIIGFGGRGGARMNEYSAVEAYLKTAEHLGSQSADEMSQGMSDLISEDVQPLHYTLNKEKDQLINTLVIPRITRRYHAAKLICETGHPVGSAHQTSIEIFVKYAPAN---VTISVEGGSVREE-----LVSGRRESVVYGQAGEIKTLICRTSPYFKQANIKWITQSSD--SGPMKPPRQLFGQTKIMRTPDGKSWLQESRV-DVKISDEDDRGYVDCRVWSEGDLRVDARVRMDIIYPPGVPVITGYRNLQPVKMAHSLEMTCVTSGGNPPPELAWFRDKQQLPNSEEVILLGRQSSLKLKLVPQRDDNGAHYHCAARNAATGNVGIASEAVVLNVVFPPQGVSVNFHG--PSVVPSGQPLVISCQADSSNPVAIINWWHFRCGPAHAFSQFKASKTTVDEVLYERRTPERAKCKSEKLEGTEENPVPGTAGGLKAQSRLWLRPTWHYHMDYIECRTE-----NPEYGPPVWHDRLQLNITFAPQFLGLQTRKEHVIREGTTVNLDLGPYSNPPVTSVSWFVEGRPIPPETAPAAARTGVHTSGRLGELLALHKISRTHMANYTVVARNDIAESSAIFFLNVTFPASLAGAAEENVTQTTSDQVTLVCQATANPSIAIQSFTWYRYVPPPGWP-QDVNEAEVQLSAPMPCNQSDAGPSVDDKYFIHCQRDDSVHMTSRFSIYRINRDDVGTYVCEINNGLGDPVRKNIHFVYHFAPGIVRLPRYTKAAGEQGSTVTLTCLVRTEPTPQIGWLK--AGQIIHDSQREGSGASTQKHQTQFLRIRPGLYKSTLTLTNLQKTDFGVYQCQAVNIKGEAMLE-VSLSGTSTPDVPLNLRLLNSTANSLRVAWTQGFDGGLTQTFQVRWRLATGSNNMFKYADVAANDNHHAVEYLITGLESGA-EYQVSVNSM 1236          
BLAST of NPHS1-3 vs. TrEMBL
Match: A0A4S2LBK4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008491 PE=4 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 4.122e-110
Identity = 315/1222 (25.78%), Postives = 537/1222 (43.94%), Query Frame = 3
Query:  102 VTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDA--HPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEF----------------ILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVD--ENNDMEFTCSMKPTGHPKSKL--KWSMNIT----------------AGFRM---------------------------------ENLIKIKY--NENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNC-------------SSIE-------IGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKN-IKLKVLYPP--FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSG-----------------SYKFVVENLLGSATRSFEIDVKYSPKVVKTS----INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCN-SNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFS--------------TNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW-WDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSI 3368
            V QS  C+ RE ++ IQCF  +P   Y V + +++ + CVV NQHGKVQWRAK ++LGYDRS+PG PR +IIGDV +G+H L+I   Q ED+G+YECQV PV A  HPLLRRK+ L V   PS+P ILY +  P +N++II     + + + ++C + GG P P F W  N++E+    ++                 I+    +  +S LSL  + LK G Q+ C + N AT+L     Q   +    +V + +    G P I +     +  E  +++  C   P G+P   L  +W +  +                 G RM                                 E++  + Y  N+ +D+LI  L++ ++ R +H   + C +  P  +      +I+VK+ P     VT + +  +  E+      +      ++ G   E   ++C TS Y+   N+KWI Q  D   G     + L    K+         +Q      +K+    + G+++C   +E  + +  + + ++ Y   + VI+GY S  PV     + +TC + GGNP P L W+++   +  ++E+     + +L       + DNG    C A++     + + S+ +++NV+FPP  + ++     P+ + + +     C++ SSNP + I W    C             ++IE             C S  ++GT     PG   G K QS+L L   +  +   ++C++       PE   P+  + ++L + + P    + +     + EG+TVNL     +NP  T  SW+ + R I  +          + SG                 +Y  V  N +  ++  F ++V +   +   +        +D     C+A+ NP  +  +  W R  P      +D  +    LS    CN S++ P+   +   +C  + +  + S+L I      D G Y C   NG+G   R+N+H      P  +++ +Y+K   +      LTC   +   P I WL   + ++I+               T    IR   +   L +   +++ FG Y+CQA N +G + L  VSL  T  PD P + +L     N++ ++W +G DGG  QTFQ+RW       + F+Y  V  N +   +E  I+    G+    + VNS+
Sbjct:   43 VIQSSACTPRERQDRIQCFDVLPQDQYSVPLGNTVNMQCVVLNQHGKVQWRAKKILLGYDRSLPGYPRYRIIGDVGRGQHTLQIMDVQLEDAGEYECQVTPVPANNHPLLRRKTELVVLVKPSVPRILYPDVPPPDNQLIISQPDPIVR-ITVLCATVGGSPAPSFTWIINNQEIPMKPLQASAGRHPDRGPWAKLDPIINTETEKQESRLSLLKAGLKDGDQLTCSVTNAATQLHHDIQQ---RNLTTQVVIRVHTPPGPPRIISPETKYEYLEGEELKAVCVASPPGNPFGGLFWRWLLQPSQVGDQKTGRIIGFGGRGGARMNEYSDVEAYLKTAEHLGSQSADEMSQGMSDLISEDVQPLHYTLNKEKDQLINTLVIPRITRRYHAAKLICETGHPVGSAHQTSIEIFVKYAPAN---VTISVDGGSVREE-----LVSGRRESVVYGQAGEIKTLICRTSPYFKQANIKWITQSSD--SGPMKPPRQLFGQTKIMRTPDGKSWLQESRV-DVKISEEDDRGYVDCRVWSEGDLRVDARVRMDIIYPPGVPVITGYRSLQPVKMAHSLEMTCVTSGGNPPPELAWFRDKQQLPNAEEVILLGRQSSLKLKLVPQRDDNGAHYHCAARNAATGNVGIASDAVVLNVVFPPQGVSVNFHG--PSVVPSGQPLVISCQADSSNPVATINWWHFRCGPAHAFSQFKASKTTIEEALYDRRTSERAKCKSEKLEGTEENPVPGTAGGLKAQSRLWLRPTWHYHMDYIECRTE-----NPEYGPPVWHDRLQLNITFAPQFLGLQTRKEQVIREGTTVNLDLGPYSNPPVTSVSWFVEGRPIPPETPPAAARTGVHTSGRLGELLALHKISRTHMANYTVVARNDIAESSAVFFLNVTFPASLAGAAEENVTQTTSDQVTLVCQATANPSIATQAFTWYRYVPPPGWP-QDVNEAEVQLSAPMPCNQSDASPSVDDKYFIHCQRDDSIHMTSRLSIYRINRDDVGTYVCEINNGLGDPVRKNIHFVYHFTPSIVRLPRYTKAAGEQGSTVTLTCLVRTEPTPQIGWLK--AGQMIYDSQREGSGALTQKHQTQFLRIRPGLYKSTLTLTNLQKTDFGVYQCQAVNIKGEAMLE-VSLSGTSTPDVPLNLRLLNSTANSLRVAWTQGFDGGLTQTFQVRWRLATGSNNMFKYADVAANDNHHAVEYLITGLESGA-EYQVSVNSM 1237          
BLAST of NPHS1-3 vs. TrEMBL
Match: A0A4S2LBR4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008491 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 4.398e-110
Identity = 315/1222 (25.78%), Postives = 538/1222 (44.03%), Query Frame = 3
Query:  102 VTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDA--HPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEF----------------ILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVD--ENNDMEFTCSMKPTGHPKSKL--KWSMNIT----------------AGFRM---------------------------------ENLIKIKY--NENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNC-------------SSIE-------IGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKN-IKLKVLYPP--FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSK-----------------QNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTS----INIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCN-SNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFS--------------TNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW-WDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSI 3368
            V QS  C+ RE ++ IQCF  +P   Y V + +++ + CVV NQHGKVQWRAK ++LGYDRS+PG PR +IIGDV +G+H L+I   Q ED+G+YECQV PV A  HPLLRRK+ L V   PS+P ILY +  P +N++II     + + + ++C + GG P P F W  N++E+    ++                 I+    +  +S LSL  + LK G Q+ C + N AT+L     Q   +    +V + +    G P I +     +  E  +++  C   P G+P   L  +W +  +                 G RM                                 E++  + Y  N+ +D+LI  L++ ++ R +H   + C +  P  +      +I+VK+ P     VT + +  +  E+      +      ++ G   E   ++C TS Y+   N+KWI Q  D   G     + L    K+         +Q      +K+    + G+++C   +E  + +  + + ++ Y   + VI+GY S  PV     + +TC + GGNP P L W+++   +  ++E+     + +L       + DNG    C A++     + + S+ +++NV+FPP  + ++     P+ + + +     C++ SSNP + I W    C             ++IE             C S  ++GT     PG   G K QS+L L   +  +   ++C++       PE   P+  + ++L + + P    + +     + EG+TVNL     +NP  T  SW+ + R I  +                 + L +  I      +Y  V  N +  ++  F ++V +   +   +        +D     C+A+ NP  +  +  W R  P      +D  +    LS    CN S++ P+   +   +C  + +  + S+L I      D G Y C   NG+G   R+N+H      P  +++ +Y+K   +      LTC   +   P I WL   + ++I+               T    IR   +   L +   +++ FG Y+CQA N +G + L  VSL  T  PD P + +L     N++ ++W +G DGG  QTFQ+RW       + F+Y  V  N +   +E  I+    G+    + VNS+
Sbjct:  118 VIQSSACTPRERQDRIQCFDVLPQDQYSVPLGNTVNMQCVVLNQHGKVQWRAKKILLGYDRSLPGYPRYRIIGDVGRGQHTLQIMDVQLEDAGEYECQVTPVPANNHPLLRRKTELVVLVKPSVPRILYPDVPPPDNQLIISQPDPIVR-ITVLCATVGGSPAPSFTWIINNQEIPMKPLQASAGRHPDRGPWAKLDPIINTETEKQESRLSLLKAGLKDGDQLTCSVTNAATQLHHDIQQ---RNLTTQVVIRVHTPPGPPRIISPETKYEYLEGEELKAVCVASPPGNPFGGLFWRWLLQPSQVGDQKTGRIIGFGGRGGARMNEYSDVEAYLKTAEHLGSQSADEMSQGMSDLISEDVQPLHYTLNKEKDQLINTLVIPRITRRYHAAKLICETGHPVGSAHQTSIEIFVKYAPAN---VTISVDGGSVREE-----LVSGRRESVVYGQAGEIKTLICRTSPYFKQANIKWITQSSD--SGPMKPPRQLFGQTKIMRTPDGKSWLQESRVD-VKISEEDDRGYVDCRVWSEGDLRVDARVRMDIIYPPGVPVITGYRSLQPVKMAHSLEMTCVTSGGNPPPELAWFRDKQQLPNAEEVILLGRQSSLKLKLVPQRDDNGAHYHCAARNAATGNVGIASDAVVLNVVFPPQGVSVNFHG--PSVVPSGQPLVISCQADSSNPVATINWWHFRCGPAHAFSQFKASKTTIEEALYDRRTSERAKCKSEKLEGTEENPVPGTAGGLKAQSRLWLRPTWHYHMDYIECRTE-----NPEYGPPVWHDRLQLNITFAPQFLGLQTRKEQVIREGTTVNLDLGPYSNPPVTSVSWFVEGRPIPPETPPAAARTGVHTSGRLGELLALHKISRTHMANYTVVARNDIAESSAVFFLNVTFPASLAGAAEENVTQTTSDQVTLVCQATANPSIATQAFTWYRYVPPPGWP-QDVNEAEVQLSAPMPCNQSDASPSVDDKYFIHCQRDDSIHMTSRLSIYRINRDDVGTYVCEINNGLGDPVRKNIHFVYHFTPSIVRLPRYTKAAGEQGSTVTLTCLVRTEPTPQIGWLK--AGQMIYDSQREGSGALTQKHQTQFLRIRPGLYKSTLTLTNLQKTDFGVYQCQAVNIKGEAMLE-VSLSGTSTPDVPLNLRLLNSTANSLRVAWTQGFDGGLTQTFQVRWRLATGSNNMFKYADVAANDNHHAVEYLITGLESGA-EYQVSVNSM 1312          
BLAST of NPHS1-3 vs. Ensembl Cavefish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 102.834 bits (255), Expect = 1.423e-21
Identity = 113/462 (24.46%), Postives = 186/462 (40.26%), Query Frame = 3
Query: 1221 LDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTK-FNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQN----------LIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSN-FSVVW 2558
            L     +E   + + C TSS    ++++W L    F + +  T+ I            +N  + T       + R  NS  + C A          K++  +V+Y  +   +        +  G  + L C S GGNP+  L W KNN  V    +    +   + +FL  +   DN     C+A +E  +   ++S  + + V FP V ++I        ++ A R+    C + SSNP + I+W L               ST + G        ++ G    SKL L L  + +   + CQ+  S  +L E          L VL+PP F  +  + + + E  T  L   +SANP+     W F    +   ++          L I N+   D+G+Y+    N  G  +   ++DV+YSP V   +  +F    D+A+  CEA  NPI    FS  W
Sbjct:  359 LGSFEAVEGNQVTLCCHTSSSNPPVHIRWWL---GFKELNNATVTISE---------GENGGMMTMSNLTYTVSREENSLPLTCEAFNRGTRYSSIKSQPLSVYYPPQKVWLDAPPEGTLLRSGTTVRLVCFSSGGNPTGRLTWMKNNKTVQVPSKHVESERGVSREFLLTLQPSDNLATYRCDATNEAKE---IRSAQIKLLVQFPAVSVKILVKQ---KELRAGRSLSLDCLAGSSNPKANISWSL--------------GSTRLNGVEQAPKRAEFGGLSVSSKLTLPLGSEHHGKRVSCQAFSS--LLSEGVNTF---YVLNVLFPPEFAEDQPSEVQIVEDDTATLPIMVSANPEDFTCEWLFHGEKVVKDRDHRYHFPEGWALEIWNVTRRDAGNYRVECSNAEGKRSSIIKLDVQYSPTVKMKTDPVFVNVGDTADLMCEADANPITPGMFSWKW 783          

HSP 2 Score: 68.9366 bits (167), Expect = 3.736e-11
Identity = 38/109 (34.86%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  150 QCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQV-QPVDAHPLLRRKSTLHVTKLPSIPY 473
            Q F+  P  +  V    +  + C V    G VQW    L+LG  RS+PG PR  + GD  +G+++L+I   + ED   YECQV +   + P++ R   L+V   P+ PY
Sbjct:   43 QAFRTEP-RNLTVRTGATALLKCEVLRASGSVQWVKDGLLLGPQRSLPGHPRYSMTGDQDRGQYHLQIEDVRLEDDSPYECQVGRSKTSRPIVSRTVWLNVQIPPAEPY 150          

HSP 3 Score: 58.151 bits (139), Expect = 6.183e-8
Identity = 50/161 (31.06%), Postives = 74/161 (45.96%), Query Frame = 3
Query: 1548 VISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITW----KLLNCSSIEIGNSTNCSSTVM 2018
            VI G  SQ  V  G  + L C SYGGNP  TL W KN  ++  + E+    ++ +     +V   DNG  + CE+ ++ V   P +S    + V+F P   E++ L      +  N+     C +SSSNP   I W    K LN +++ I    N     M
Sbjct:  259 VIEGLRSQ-EVKAGTSLRLVCLSYGGNPLATLHWTKNGEVLSTNWEVDVVSQKASSGLNMQVQPEDNGAVLCCESVNQ-VSRSP-QSITRTLTVLFEPA--EVTLLGSF-EAVEGNQVT-LCCHTSSSNPPVHIRWWLGFKELNNATVTISEGENGGMMTM 412          
BLAST of NPHS1-3 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 65.0846 bits (157), Expect = 4.116e-10
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYI 476
            D  V+   S+ + CV+    G VQW    L LG +R +PG  R  ++GD   GEH+L I  ++  D   YECQ        L   ++ L V   PS P +
Sbjct:   21 DQVVVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWTRYSLLGDPASGEHSLVIESSELADDAVYECQATQAG---LRSHRARLTVLVPPSDPVV 117          
BLAST of NPHS1-3 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 65.0846 bits (157), Expect = 4.232e-10
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYI 476
            D  V+   S+ + CV+    G VQW    L LG +R +PG  R  ++GD   GEH+L I  ++  D   YECQ        L   ++ L V   PS P +
Sbjct:   24 DQVVVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWTRYSLLGDPASGEHSLVIESSELADDAVYECQATQAG---LRSHRARLTVLVPPSDPVV 120          
BLAST of NPHS1-3 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 65.0846 bits (157), Expect = 4.718e-10
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYI 476
            D  V+   S+ + CV+    G VQW    L LG +R +PG  R  ++GD   GEH+L I  ++  D   YECQ        L   ++ L V   PS P +
Sbjct:   59 DQVVVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWTRYSLLGDPASGEHSLVIESSELADDAVYECQATQAG---LRSHRARLTVLVPPSDPVV 155          
BLAST of NPHS1-3 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 61.6178 bits (148), Expect = 5.561e-9
Identity = 67/257 (26.07%), Postives = 105/257 (40.86%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXX--XXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNS--NQIVDENNDMEFTCSMKPTGHPKSKLKWS 935
            D  V+    + + C +   HG V W    L LG +R + G PR  +IGD +KGE++L I + +  D G +EC  Q + A  +  R + L V   P  P I+               ++     L L C ++   P     W  N   +        L+ + Q   +  +L    S ++SG +I C   NKA               EA VT+ +      PL+  S   Q + E N ++F CS K    P +  +W+
Sbjct:   37 DVVVVAGQPVTLPCSITGFHGMVLW--DGLALGVNRDLSGYPRYDVIGDHSKGEYHLLIQRTELGDDGSFEC--QGIQAG-IRSRPARLTVLVPPDDPVIIGAPI----------VSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGQRESTVSTLYISASNIESGQRITCRASNKAAP----------NGKEATVTIDI---QHLPLVNLSVEPQPILEGNLVKFHCSAK-ANPPVTHYRWA 264          
BLAST of NPHS1-3 vs. Ensembl Sea Lamprey
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 57.3806 bits (137), Expect = 2.488e-8
Identity = 46/174 (26.44%), Postives = 75/174 (43.10%), Query Frame = 3
Query: 2346 NLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRE--NLHLNIPIKPWYLKIS 2852
            +L ++++ + D+G Y  +  N +G A+ +  +DV Y PK     +      N++    CE   NP     +V W             SRD  PI S N         TN + ++S  G       +S L I+P  +SDFG Y C+  N I  + +E   +   +P  P  +K +
Sbjct:  256 SLTLRDVQYTDAGEYMCIANNNVGQASAAMHLDVAYGPKFAGEKVTYHSWPNNAVNVTCEVLANP---KAAVSW-------------SRDGQPIPSANL--------TNVI-VHSFPG-------FSVLEITPESQSDFGSYNCVAVNNIASESKEFVLVEAALPSAPQSVKAT 397          

HSP 2 Score: 51.6026 bits (122), Expect = 1.450e-6
Identity = 51/235 (21.70%), Postives = 95/235 (40.43%), Query Frame = 3
Query: 2505 FFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSL------LTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGF--LHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLS 3185
              CE+   P+ +   + WRR+  +D+  +R  +  L                 ++ + S   +       S L +   Q +D G Y C+  N +G +    +HL++   P +         G  +++HS       +TC  L++   ++ W      + I S N T +   +F GF  L +  + +S FG Y C A N   S    +V L+    P  P+S K   ++  +  ++
Sbjct:  212 LTCESEGEPLPT---ITWRRV--SDQHVFRQGQQTL---------------EGRIEVRSYAKV-------SSLTLRDVQYTDAGEYMCIANNNVG-QASAAMHLDVAYGPKFA--------GEKVTYHSWPNNAVNVTCEVLANPKAAVSWS--RDGQPIPSANLTNVIVHSFPGFSVLEITPESQSDFGSYNCVAVNNIASESKEFV-LVEAALPSAPQSVKATAVYSTSAEIT 407          
BLAST of NPHS1-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 4.128e-6
Identity = 86/389 (22.11%), Postives = 144/389 (37.02%), Query Frame = 3
Query: 2172 IVKNIKLKVLYPPFIMNSLNS--------LYVFEGSTVNLQYQISANPKATHFSWYFQN-RFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVV---KTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFW------LVPFS--NEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQT-FQLRW------WDEKQQS 3257
            ++  +K   L  PF M ++          + V   S + + +     P         +   FISS   L+I N+    +G+Y  +  N   + +   ++ V+  P+ V   K    IF       C A   PI     ++W+  + N       +  F P+LS         +P                     L++   QE D G+Y C   NG+G    +++ LN+ I    L  SQ +        HS L C         I W      + P      ++++ +T +   ST    +   V+ +S F  + C A N  G  R   + L     PD PE  ++  +    I L W  G DG S  T F + +      W++KQ++
Sbjct:  422 LIVTVKEPPLIQPFEMPAVTQGQRVYVPCVIVSGDSPIRITWHKDGQPLPPRLGAQVETTEFISS---LLIPNVTQLHNGNYTCLARNEAATVSHGSQLIVRVPPRFVVQPKDQDGIFGKPVVLNCSADGYPIPK---IIWKYSKGNG------NPQFQPVLS----GGGRFQPLGN----------------GSLLLRQVQEEDGGFYLCQVSNGVGTDISKSMLLNVKIP--ALVTSQANVTLATRGQHSNLQCSARGERPIIIRWEKEETLIDPERMFRYVVYTQDTGDELLSTL--QILPTVRGDSGF--FTCHAINSYGEDR-GLIQLTVQEPPDPPE-VEVREVNARTITLRWTSGFDGNSPITAFDIEYKNRSDTWEQKQRT 770          
BLAST of NPHS1-3 vs. Ensembl Nematostella
Match: EDO45383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT26])

HSP 1 Score: 56.6102 bits (135), Expect = 4.241e-8
Identity = 78/309 (25.24%), Postives = 125/309 (40.45%), Query Frame = 3
Query: 2247 EGSTVNLQYQISANPKATHFSWY---------FQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFND-------SAEFFCEASMNPIYS-----NFSVVWRRIEPNDRIAYRDSRDFLPILSIN------YSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMK--GRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFW------LVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQA 3068
            EG  V  + Q + NP + + +W             RF S+   L+I N+   DSG+Y     N LG  +    +DV+Y P+ V    N+  D       S  F C    NP  +     N S +   ++P     +  +   L I ++N      Y CN++S            G   +    S L+IS    +D   Y C   N  G K  G  NL +N P  P +L+ S   ++  + + +  LTC        ++ W      L P S  II   ++ +  +ST    ++++  +E+Y   YKC A
Sbjct:   10 EGQVVKFECQTTGNP-SPNVTWLKSGSAVNTSVDPRFYSNDTILMITNVSRIDSGTYSCNASNELGIISAEAALDVRYGPEFV----NVPQDKTPNEGWSVTFECHTKGNPPPTVTWLKNGSALNTSVDPR----FYSNGTHLMITNVNRTDSGAYRCNASSI----------LGPENDGNETSFLMISNLNRTDEASYTCRAKNAAGEKTSGSVNLAVNYP--PKFLQ-SLKDEETLNETDNLTLTCKLEGKPLATVVWLKDNTELEPDSRLIITQPSSVDSGESTLT-IINVHRHDEAY---YKCLA 292          
BLAST of NPHS1-3 vs. Ensembl Medaka
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:NCBI gene;Acc:101155460])

HSP 1 Score: 167.548 bits (423), Expect = 1.626e-41
Identity = 232/1073 (21.62%), Postives = 385/1073 (35.88%), Query Frame = 3
Query:  150 QCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVD-AHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNP-NEKSSFPPFIQQNHLDI---ISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQK-TKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFL---CESSSSNPGSIITWKLLNCS-SIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKN-----IKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFI---SSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGT--DISHHSLLTC----------------CFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW-WDE 3245
            Q F+  P  +  V +  +  + C V    G VQW    L+LG  RS+PG PR  +IG   +G+++L+I  AQ ED   YECQ    D +  ++     L V   PS PY               D          + CV+    P+               E  F+ I       +S  +      +G  + C  KN A   L   + +T       VT+ ++     P I N ++       M     +  +G+P + L+WS N         ++   +  ++    +  +LK +                          I    N  +LS  +FN  S +P +       F     L +   +  IE +++ + CF +S    ++++W L + +  +    T+ I             N  + T      +  R  N   + C A  +     K K  K +V+Y  +   +       P++ G  + L C S GGNP+PTL W KN   V  + +  +       +    +   DN     C+A +   K I   +  L   V F  V ++I+    +       R  E L   C + SSNP + I W +      + +       +  +  TL  N   Q++                              ++ + Y P+++       +L VL+PP F       + V E     +   +SANP+     W  +   +       +L I+N    D+G Y    EN  G +  +  +DV Y+  V      +F     +A+  C A  NPI S+    W+ +E  +R+                                  G        S L I     +  G YQC   NGIG+ G  N+ L +  KP   K  Q+ K  +  D S  + L C                 FL   NP   +      E  F T+T  +          + V     +  + C A+N  G  ++  + L+ T  PD P  F+      +++ L WI G +GG +Q F++R+ WD+
Sbjct:   50 QAFRIEP-RNLTVRMGATAVLKCEVLRASGTVQWVKDGLLLGPQRSLPGFPRYSMIGK--RGQYHLRIENAQLEDDTFYECQAGQSDTSEGIISNAVWLDVLIPPSNPYFTMDMAAYWVAGESYD----------VTCVAPDAKPEA--------------EHFFVCIFTFGSCVTSERVTALSSDNGRLLACHAKNAA---LSKPVVTT-------VTMNVYYPPDAPFIVNLDRDEVRAGRMLMLECVSGSGNPLAALRWSKN-------GEIVSTTWEADEFARKSRSVLKMV--------------------------ITPADNQAELSCESFNAVSLSPLSITRKLDVFFDPEELTLSGSLEAIEGQEVVLSCFAASSNPPVDIRWWLGYKELNN----TVFIREE--------GDNGGMTTVSNVTYRFSREDNGLMLNCEAFNKGTRFSKIKDAKISVYYPPQKVWLDAPAQDVPLNAGTKVTLICHSTGGNPTPTLTWLKNGKAVAHAPKQTSSDMAAARELHLVLTPSDNMATYRCDATNNAKKTISAHAKLL---VYFTAVSMKITAHQEVL------RQGEVLTLECLAESSNPTANIFWSVGAVRFGVTLSTKHQSGAVTVNSTLLLNLTSQHH---------------------------KQNVICQAYNPVLEEGANTYYRLNVLHPPEFSSAQPTEIQVEEDEMATIPLLVSANPEGVSCVWLHRRETLVKGDPDGSLEIRNATRRDAGLYTIKCENEEGVSQTAITLDVLYACDVTAEKDPVFVNLGGTADLICVADANPIISDM-FSWKWLE-GERV--------------------------------EMGEETQEDESSLLTIRNVTRAHSGLYQCTANNGIGLSGSVNMQLVVQFKPELQKGPQWRKVASRGDGSTTAELVCRAEGIPRIDFSWEKKGVFLDLANPR--YEEKTVREGSFHTSTLRV----------VNVSAVMDYAVFSCYARNSLGEDKVD-IQLVSTNHPDPPSMFRHVSSTHDSVTLEWIPGFNGGLQQKFRIRYQWDQ 957          
BLAST of NPHS1-3 vs. Ensembl Medaka
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:NCBI gene;Acc:101155460])

HSP 1 Score: 160.229 bits (404), Expect = 2.370e-39
Identity = 250/1125 (22.22%), Postives = 413/1125 (36.71%), Query Frame = 3
Query:  150 QCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVD-AHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIIN--IQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNP-NEKSSFPPFIQQNHLDI---ISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQK-TKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFL---CESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHK--ILPEKYKPIVKN-----IKLKVLYPP-FIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNL----------IIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIF---NDSAEFFCEASMNPIYSN-FSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGT--DISHHSLLTC----------------CFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRW-WDEKQQSTFRYQ----------TVKGNQSKETLEITISNFSIGS 3338
            Q F+  P  +  V +  +  + C V    G VQW    L+LG  RS+PG PR  +IG   +G+++L+I  AQ ED   YECQ    D +  ++     L V   PS PY               D          + CV+    P+     + +  ++T  E   +      +    + +++      +G  + C  KN A   L   + +T       VT+ ++     P I N ++       M     +  +G+P + L+WS N         ++   +  ++               F R + S +              I    N  +LS  +FN  S +P +       F     L +   +  IE +++ + CF +S    ++++W L + +  +    T+ I             N  + T      +  R  N   + C A  +     K K  K +V+Y  +   +       P++ G  + L C S GGNP+PTL W KN   V  + +  +       +    +   DN     C+A +   K I   +  L   V F  V ++I+    +       R  E L   C + SSNP + I W +    ++    +    S    G ++ N                      +  +L   S+  HK  ++ + Y P+++       +L VL+PP F       + V E     +   +SANP+     W  +   +    NL           I+N    D+G Y    EN  G +  +  +DV Y+  V      +F     +A+  C A  NPI S+ FS  W   E    +      D   +L+I           N  R +S                        G YQC   NGIG+ G  N+ L +  KP   K  Q+ K  +  D S  + L C                 FL   NP   +      E  F T+T  +          + V     +  + C A+N  G  ++  + L+ T  PD P  F+      +++ L WI G +GG +Q F++R+ WD  Q  +F+Y           TV G Q      +T+ NFSI +
Sbjct:   27 QAFRIEP-RNLTVRMGATAVLKCEVLRASGTVQWVKDGLLLGPQRSLPGFPRYSMIGK--RGQYHLRIENAQLEDDTFYECQAGQSDTSEGIISNAVWLDVLIPPSNPYFTMDMAAYWVAGESYD----------VTCVAPDAKPEAEVILYKDGVKLTGVESSSVSGSKDKLLNTLAEVTVTALSSDNGRLLACHAKNAA---LSKPVVTT-------VTMNVYYPPDAPFIVNLDRDEVRAGRMLMLECVSGSGNPLAALRWSKN-------GEIVSTTWEADE---------------FARKSRSVLK-----------MVITPADNQAELSCESFNAVSLSPLSITRKLDVFFDPEELTLSGSLEAIEGQEVVLSCFAASSNPPVDIRWWLGYKELNN----TVFIREE--------GDNGGMTTVSNVTYRFSREDNGLMLNCEAFNKGTRFSKIKDAKISVYYPPQKVWLDAPAQDVPLNAGTKVTLICHSTGGNPTPTLTWLKNGKAVAHAPKQTSSDMAAARELHLVLTPSDNMATYRCDATNNAKKTISAHAKLL---VYFTAVSMKITAHQEVL------RQGEVLTLECLAESSNPTANIFWSV---GAVRFQKAEQTHSKDKSGAVTVN----------------------STLLLNLTSQ-HHKQNVICQAYNPVLEEGANTYYRLNVLHPPEFSSAQPTEIQVEEDEMATIPLLVSANPEGVSCVWLHRRETLVKGNNLHHYWLEDGSLEIRNATRRDAGLYTIKCENEEGVSQTAITLDVLYACDVTAEKDPVFVNLGGTADLICVADANPIISDMFSWKWLGEE-EVEMGEETQEDESSLLTIR----------NVTRAHS------------------------GLYQCTANNGIGLSGSVNMQLVVQFKPELQKGPQWRKVASRGDGSTTAELVCRAEGIPRIDFSWEKKGVFLDLANPR--YEEKTVREGSFHTSTLRV----------VNVSAVMDYAVFSCYARNSLGEDKVD-IQLVSTNHPDPPSMFRHVSSTHDSVTLEWIPGFNGGLQQKFRIRYQWD--QSVSFQYVDVFPPDATTFTVTGLQP-----VTVYNFSINA 993          
BLAST of NPHS1-3 vs. Ensembl Medaka
Match: ENSORLT00000046072.1 (pep primary_assembly:ASM223467v1:1:2157820:2166779:1 gene:ENSORLG00000025208.1 transcript:ENSORLT00000046072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 3.170e-10
Identity = 73/290 (25.17%), Postives = 117/290 (40.34%), Query Frame = 3
Query: 1578 VHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFI--SSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEI 2441
            + EG  + LTC S   NP+   RWYKNN  +L  D+            + R  +  + +K  C A++   K+    S+++ INV +PP   E S ++  P+  +   ++  L  SS +NP +  TW   N   +           V   ++ +   G Y+                      C+S   H        P++    L V YPP I +      + +GS+V L     ANP A +FSW+ ++     +S  N  I ++    SG Y    EN  GS   S  +
Sbjct:  144 IMEGSSVTLTC-SCDANPAAKFRWYKNNQTLLLEDQ----------SLILRSVQRSDSRKFHCVAEN---KLGEAASDYVFINVEYPP---ETSSVSVSPSAEVLEGSSVTLTCSSDANPAANYTWFKDNRPLLS-------EDKVHFSSIRSEHSGNYS----------------------CKSENKHG--QSSSTPLL----LDVQYPPRIPSVSVFGKISKGSSVTLTCSSDANP-AANFSWFKKDEDSPKASGPNWTISDLRAEHSGFYYCEAENRRGSLNSSLHL 380          

HSP 2 Score: 54.299 bits (129), Expect = 7.107e-7
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query: 2241 VFEGSTVNLQYQISANPKATHFSWYFQNR-FISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFE-IDVKYSPKVVKTSIN-----IFNDSAEFFCEASMNPIYSNFSVVW----RRIEPNDRIAYRDSRDFLPILSINYSCNSNSK 2654
            + EGS+V L     ANP A  F WY  N+  +   Q+LI++++  +DS  +  V EN LG A   +  I+V+Y P+    S++     +   S    C +  NP  +N++  W    R +   D++ +   R      S NYSC S +K
Sbjct:  144 IMEGSSVTLTCSCDANP-AAKFRWYKNNQTLLLEDQSLILRSVQRSDSRKFHCVAENKLGEAASDYVFINVEYPPETSSVSVSPSAEVLEGSSVTLTCSSDANPA-ANYT--WFKDNRPLLSEDKVHFSSIRS---EHSGNYSCKSENK 285          
BLAST of NPHS1-3 vs. Ensembl Medaka
Match: ENSORLT00000038190.1 (pep primary_assembly:ASM223467v1:1:2022690:2038485:-1 gene:ENSORLG00000030207.1 transcript:ENSORLT00000038190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.863e-10
Identity = 74/290 (25.52%), Postives = 115/290 (39.66%), Query Frame = 3
Query: 1578 VHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFI--SSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEI 2441
            + EG  + LTC S   NP+   RWYKNN  +L  D             + R  +  +  K  C A++E   +    S+++ INV +PP   E S ++  P+  +   ++  L  SS +NP +  TW   N   +           V   ++ +   G Y+                      C+S   H        P++    L V YPP I +      + +GS+V L     ANP A +FSWY ++     +S  N  I +     SG Y    EN  GS   S ++
Sbjct:  148 IMEGSSVTLTC-SCDANPADKFRWYKNNQPLLLEDP----------RLILRSVQRSDSGKFHCVAENE---LGEAASDYVFINVEYPP---ETSSVSVSPSAEVLEGSSVTLTCSSDANPAAKYTWFKDNRPLLS-------EDKVHFSSIRSEHSGNYS----------------------CKSENKHG--QSSSTPLL----LDVQYPPRIPSVSVFGKILKGSSVTLTCSSDANP-AANFSWYKKDEDSPKASGTNWTISDFRAEHSGFYYCEAENRRGSLNSSLQL 384          
BLAST of NPHS1-3 vs. Ensembl Medaka
Match: kirrel3l (kirre like nephrin family adhesion molecule 2 [Source:NCBI gene;Acc:101173407])

HSP 1 Score: 64.6994 bits (156), Expect = 5.015e-10
Identity = 35/100 (35.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  177 DYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYI 476
            D  V+   S+ + CV+    G VQW    L LG +R +PG  R  ++GD   GEH+L I  A+  D   YECQ        L   ++ L V   PS P +
Sbjct:   26 DQVVVSGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWTRYSLMGDPLSGEHSLLIDSAELADDAVYECQATQAG---LRSHRAKLTVLVPPSDPVV 122          
BLAST of NPHS1-3 vs. Planmine SMEST
Match: SMESG000070688.1 (SMESG000070688.1)

HSP 1 Score: 2426.74 bits (6288), Expect = 0.000e+0
Identity = 1245/1252 (99.44%), Postives = 1250/1252 (99.84%), Query Frame = 3
Query:   36 MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVXXXXXXXXXXXXXXXXXXVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSEDIQMKLDPSSEPKELIIDQETIKF 3791
            MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQK+FCEAKSENVKVIPVKSNFLIINVIFPP HLEISC+NCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEP DRIAYRDS+DFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLH+YVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVNLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSE+IQMKLDPSSEPKELIIDQETIKF
Sbjct:    1 MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKLFCEAKSENVKVIPVKSNFLIINVIFPPAHLEISCINCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPTDRIAYRDSKDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHIYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVNLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSENIQMKLDPSSEPKELIIDQETIKF 1252          

HSP 2 Score: 85.5001 bits (210), Expect = 2.105e-16
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 1
Query: 3829 PVLCQGLYGRFIMEKWQPCDCHLSMERDGFVLMT 3930
            PVLCQGLYGRFIMEKWQPCDCHLSMERDGFVLMT
Sbjct: 1299 PVLCQGLYGRFIMEKWQPCDCHLSMERDGFVLMT 1332          
BLAST of NPHS1-3 vs. Planmine SMEST
Match: SMESG000070688.1 (SMESG000070688.1)

HSP 1 Score: 2395.16 bits (6206), Expect = 0.000e+0
Identity = 1229/1236 (99.43%), Postives = 1234/1236 (99.84%), Query Frame = 3
Query:   84 DSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVXXXXXXXXXXXXXXXXXXVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSEDIQMKLDPSSEPKELIIDQETIKF 3791
            DSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQK+FCEAKSENVKVIPVKSNFLIINVIFPP HLEISC+NCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEP DRIAYRDS+DFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLH+YVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVNLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSE+IQMKLDPSSEPKELIIDQETIKF
Sbjct:   66 DSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKLFCEAKSENVKVIPVKSNFLIINVIFPPAHLEISCINCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPTDRIAYRDSKDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHIYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDVNLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKKSLAVDSLLKLPDTLNESKLMADQLDNSENIQMKLDPSSEPKELIIDQETIKF 1301          

HSP 2 Score: 85.5001 bits (210), Expect = 2.133e-16
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 1
Query: 3829 PVLCQGLYGRFIMEKWQPCDCHLSMERDGFVLMT 3930
            PVLCQGLYGRFIMEKWQPCDCHLSMERDGFVLMT
Sbjct: 1348 PVLCQGLYGRFIMEKWQPCDCHLSMERDGFVLMT 1381          
BLAST of NPHS1-3 vs. Planmine SMEST
Match: SMESG000070688.1 (SMESG000070688.1)

HSP 1 Score: 2127.44 bits (5511), Expect = 0.000e+0
Identity = 1073/1083 (99.08%), Postives = 1079/1083 (99.63%), Query Frame = 3
Query:   84 DSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSI 3332
            DSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQK+FCEAKSENVKVIPVKSNFLIINVIFPP HLEISC+NCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEP DRIAYRDS+DFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLH+YVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITIS+  +
Sbjct:   66 DSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYKNEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWSMNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKLFCEAKSENVKVIPVKSNFLIINVIFPPAHLEISCINCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEIGNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISANPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPTDRIAYRDSKDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHIYVKEESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISSIKL 1148          
BLAST of NPHS1-3 vs. Planmine SMEST
Match: SMESG000028689.1 (SMESG000028689.1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.353e-120
Identity = 330/1191 (27.71%), Postives = 568/1191 (47.69%), Query Frame = 3
Query:   24 IEKKMYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPV-DAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLK--LICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQ------IVDENNDMEFTCSMKPTGHPKSKLKWSMNITA-----GFRMENL----IKIKYNE---NQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHL--DIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKL---DHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSI--EIGN---STNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLN-SLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS---------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSI---NIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNS----NSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII-----FSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGS-SRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNF-SIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKND 3431
            ++K  + + + ++  S++   SS   + QS +C+  E+ N IQCF+EIP   Y V    +  + C+V NQ+GKVQWRA  ++LGYDR++PG P  +++G V KGEH L+I+    +D+G YECQVQPV   HPLLRRK+ L V   P  P I YK   P  +++II+   S+K+ ++    CVS+ G P+  FQWF N+  +  +E    L+  +  ++S LSL  S  K G  I C + N+ATE+ +   + +      +V +++    G P I + N       +VD+N  M  TC   P+G P   L W             R EN     I  +Y +   +++++++ L +  L    H   + C++ +P I+  S   ++Y+ H P K+ I          ++ S     I ++ L  ++I G   E+  + C T  YY    +KW+     F     +    +SP+ K+   D    +N TI      KIK+ +  +  F++C A +  +  ++ + K ++ Y  +   I GY    PV       +TC + GGNP P L+W++++  +  S   +    ++TL  +     +DN  K FC+AKS ++K  P+ S+ + + V+FPP+ + +  L+    ++   +  +  C +  SNP +++ WKL  C  +  E+G     T C+  ++  + S    G++ G   QS   +  ++K +   + C+  + +    E+++ + K I++ V + P     +N + Y+ EG +  L  +  ANP    ++W+  +  +S         SK  LII+N    D  +Y  VV N  G +  +  +++ Y P ++        I   +AE  C    NP   + S  W ++ P        S D +P  +I   CN      +   +  +  S C +    ++ S LII     +D G Y+C+  NGI     + + L     P  L + ++SK   ++     L C   SH +P + W     N  +     +  N T  R   +   L +   + +  G Y C+A+N +GS SR   VS   T  PD P   ++    ++ I +SWI+G DGGS QTFQ+RW ++   S +RY+ V  + +K TL   I+   S  +Y I I   + ++   ++   I    +S  N+
Sbjct:    1 MQKSHFLLVLCLIFDSEM---SSGAKIKQSIECTNEEIVNRIQCFQEIPKPVYEVAQGSAATLRCIVRNQYGKVQWRAVPVLLGYDRNIPGRPTYRVVGSVVKGEHFLEISNVTVKDAGIYECQVQPVGQEHPLLRRKTKLVVLVRPDQPQIFYKGFQPNGDQVIIN---SIKQDVRTEFTCVSDNGQPKVKFQWFLNNNLIQDNENS-ALLEELNYSRSRLSLKTSKFKDGDVIKCRVSNRATEVHQDPERRS---LSTEVFIVIHTPPGQPQIVDMNPHKTTPYVVDDNIIM--TCESSPSGKPAGSLLWRWKYPKVRELYNNRFENYTTKDISPQYYQQTISKNKMVSTLTIPALTSKEHGAQLFCVATNPVISYQSTAVKLYILHIPNKVVISV--------SDGSLSSRTIGKDGLNENVIYGEAGEEKTITCTTDPYYNEATIKWV-----FSPNPAINNDFISPVEKIWKEDESFRRNSTI------KIKINKQFDQSFLDCQAWSGIK-SVQSRVKLHITYSPEKPTIQGYNVGKPVKLNHNFEMTCSTIGGNPYPELQWFRDSKPIQSSFIAQQVGNQKTLKIIITPSINDNKVKYFCQAKSISLKSSPLNSDEVTLIVLFPPMTIGLKSLSGA--EVENGKLLKLQCTAGESNPPAVVRWKLNRCGQMMSELGRRPVQTTCNEELLSASSSNTINGKFGGSLIQSYFEIYPSWKDHLDYVDCE--VFNPDYGEEHQVLRKRIQINVTFSPQFEGIINYNFYIEEGQSQTLNLEPIANPPIKDYTWFRNSTKLSRKNVHSISTSKAKLIIRNAKPVDIDNYTLVVVNDRGESQITIYLNITYQPIIIGDKFERKEIIRQNAELECSVQSNPANPHMSYKWTKLVPGKGYNDISSSDLVPAFTI--GCNQAEWKGTPEKSNFKYFSKCMVKSQFEMTSLLIIYDVDRNDVGLYRCVVNNGIRGDVVKTIELTKEFTPQILSLPKFSKAAGNLGEEVSLFCYIRSHPSPKMTWFFGRYNTSVSANSKYRINITRFRTGFYVAQLKIVNLQRTDHGSYVCKAENGKGSDSRKIEVSGTST--PDVPLEIQVVNKSQSQIEISWIQGFDGGSIQTFQVRWKEKSPTSLYRYEDVASDDTKITLSFIITGLKSDTAYLISINSRNSKHGTSQFSKTIMTNTMSADNE 1151          
BLAST of NPHS1-3 vs. Planmine SMEST
Match: SMESG000028689.1 (SMESG000028689.1)

HSP 1 Score: 411.379 bits (1056), Expect = 3.474e-120
Identity = 328/1170 (28.03%), Postives = 557/1170 (47.61%), Query Frame = 3
Query:   87 SSPLPVTQSQKCSARELKNYIQCFKEIPLTDYYVLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKGEHNLKITKAQTEDSGDYECQVQPV-DAHPLLRRKSTLHVTKLPSIPYILYXXXXXXXXXXXXDFNVSVKKMLK--LICVSEGGLPQPIFQWFWNSREVTTDEMEFILIINIQPNXXXXXXXXXXXXXGHQILCVIKNKATELLESRLQSTYQRFEAKVTVIMFVRSGNPLIQNSNQ------IVDENNDMEFTCSMKPTGHPKSKLKWSMNITA-----GFRMENL----IKIKYNE---NQDELITNLLLKKLNRTFHRVNVSCISESPFITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHL--DIISGIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKL---DHYLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQAKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDEIKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIFPPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSI--EIGN---STNCSSTVMQGTLSTNFPGQYNGWKTQSXXXXXXXXXXXXFILQCQSRLSHKILPEKYKPIVKNIKLKVLYPPFIMNSLN-SLYVFEGSTVNLQYQISANPKATHFSWYFQNRFIS---------SKQNLIIKNIHFNDSGSYKFVVENLLGSATRSFEIDVKYSPKVVKTSI---NIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRIAYRDSRDFLPILSINYSCNS----NSKPTNQMRINSNCGINKNNKIYSKLIISPYQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISHHSLLTCCFLSHVNPSIFWLVPFSNEII-----FSTNTTEIRQSTFCGFLHMYVKEESYFGQYKCQAKNERGS-SRLAYVSLLPTFQPDFPESFKLFILFKNNIHLSWIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNF-SIGSYSIDIGVNSIRYPDFRYCCAISFVVLSDKND 3431
            SS   + QS +C+  E+ N IQCF+EIP   Y V    +  + C+V NQ+GKVQWRA  ++LGYDR++PG P  +++G V KGEH L+I+    +D+G YECQVQPV   HPLLRRK+ L V   P  P I YK   P  +++II+   S+K+ ++    CVS+ G P+  FQWF N+  +  +E    L+  +  ++S LSL  S  K G  I C + N+ATE+ +   + +      +V +++    G P I + N       +VD+N  M  TC   P+G P   L W             R EN     I  +Y +   +++++++ L +  L    H   + C++ +P I+  S   ++Y+ H P K+ I          ++ S     I ++ L  ++I G   E+  + C T  YY    +KW+     F     +    +SP+ K+   D    +N TI      KIK+ +  +  F++C A +  +  ++ + K ++ Y  +   I GY    PV       +TC + GGNP P L+W++++  +  S   +    ++TL  +     +DN  K FC+AKS ++K  P+ S+ + + V+FPP+ + +  L+    ++   +  +  C +  SNP +++ WKL  C  +  E+G     T C+  ++  + S    G++ G   QS   +  ++K +   + C+  + +    E+++ + K I++ V + P     +N + Y+ EG +  L  +  ANP    ++W+  +  +S         SK  LII+N    D  +Y  VV N  G +  +  +++ Y P ++        I   +AE  C    NP   + S  W ++ P        S D +P  +I   CN      +   +  +  S C +    ++ S LII     +D G Y+C+  NGI     + + L     P  L + ++SK   ++     L C   SH +P + W     N  +     +  N T  R   +   L +   + +  G Y C+A+N +GS SR   VS   T  PD P   ++    ++ I +SWI+G DGGS QTFQ+RW ++   S +RY+ V  + +K TL   I+   S  +Y I I   + ++   ++   I    +S  N+
Sbjct:   38 SSGAKIKQSIECTNEEIVNRIQCFQEIPKPVYEVAQGSAATLRCIVRNQYGKVQWRAVPVLLGYDRNIPGRPTYRVVGSVVKGEHFLEISNVTVKDAGIYECQVQPVGQEHPLLRRKTKLVVLVRPDQPQIFYKGFQPNGDQVIIN---SIKQDVRTEFTCVSDNGQPKVKFQWFLNNNLIQDNENS-ALLEELNYSRSRLSLKTSKFKDGDVIKCRVSNRATEVHQDPERRS---LSTEVFIVIHTPPGQPQIVDMNPHKTTPYVVDDNIIM--TCESSPSGKPAGSLLWRWKYPKVRELYNNRFENYTTKDISPQYYQQTISKNKMVSTLTIPALTSKEHGAQLFCVATNPVISYQSTAVKLYILHIPNKVVISV--------SDGSLSSRTIGKDGLNENVIYGEAGEEKTITCTTDPYYNEATIKWV-----FSPNPAINNDFISPVEKIWKEDESFRRNSTI------KIKINKQFDQSFLDCQAWSGIK-SVQSRVKLHITYSPEKPTIQGYNVGKPVKLNHNFEMTCSTIGGNPYPELQWFRDSKPIQSSFIAQQVGNQKTLKIIITPSINDNKVKYFCQAKSISLKSSPLNSDEVTLIVLFPPMTIGLKSLSGA--EVENGKLLKLQCTAGESNPPAVVRWKLNRCGQMMSELGRRPVQTTCNEELLSASSSNTINGKFGGSLIQSYFEIYPSWKDHLDYVDCE--VFNPDYGEEHQVLRKRIQINVTFSPQFEGIINYNFYIEEGQSQTLNLEPIANPPIKDYTWFRNSTKLSRKNVHSISTSKAKLIIRNAKPVDIDNYTLVVVNDRGESQITIYLNITYQPIIIGDKFERKEIIRQNAELECSVQSNPANPHMSYKWTKLVPGKGYNDISSSDLVPAFTI--GCNQAEWKGTPEKSNFKYFSKCMVKSQFEMTSLLIIYDVDRNDVGLYRCVVNNGIRGDVVKTIELTKEFTPQILSLPKFSKAAGNLGEEVSLFCYIRSHPSPKMTWFFGRYNTSVSANSKYRINITRFRTGFYVAQLKIVNLQRTDHGSYVCKAENGKGSDSRKIEVSGTST--PDVPLEIQVVNKSQSQIEISWIQGFDGGSIQTFQVRWKEKSPTSLYRYEDVASDDTKITLSFIITGLKSDTAYLISINSRNSKHGTSQFSKTIMTNTMSADNE 1170          
The following BLAST results are available for this feature:
BLAST of NPHS1-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHS11.471e-1921.97NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
NPHS11.743e-1921.97NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
KIRREL23.772e-1234.65kirre like nephrin family adhesion molecule 2 [Sou... [more]
KIRREL26.272e-1130.07kirre like nephrin family adhesion molecule 2 [Sou... [more]
KIRREL27.865e-1130.07kirre like nephrin family adhesion molecule 2 [Sou... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-23.411e-3022.26Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-24.631e-3022.26Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-21.292e-2821.70Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-21.479e-2821.70Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-22.169e-2121.07Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hbs7.585e-5021.45gene:FBgn0029082 transcript:FBtr0087413[more]
hbs1.021e-4921.45gene:FBgn0029082 transcript:FBtr0087414[more]
hbs1.021e-4921.45gene:FBgn0029082 transcript:FBtr0345419[more]
sns1.718e-4321.11gene:FBgn0024189 transcript:FBtr0088635[more]
sns2.299e-4321.11gene:FBgn0024189 transcript:FBtr0111043[more]
back to top
BLAST of NPHS1-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs12.324e-4722.92NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
nphs12.804e-4722.92NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
nphs13.825e-3424.21NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
kirrel1b3.209e-1127.59kirre like nephrin family adhesion molecule 1b [So... [more]
kirrel1b3.615e-1127.59kirre like nephrin family adhesion molecule 1b [So... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHS19.960e-1322.53NPHS1 nephrin [Source:NCBI gene;Acc:100494620][more]
eif4e2.775e-1131.62eukaryotic translation initiation factor 4E [Sourc... [more]
ptk75.623e-1123.46protein tyrosine kinase 7 (inactive) [Source:Xenba... [more]
eif4e8.478e-1134.29eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e8.556e-1134.29eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nphs11.178e-1321.49nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
Nphs11.591e-1321.49nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
Kirrel21.908e-1125.62kirre like nephrin family adhesion molecule 2 [Sou... [more]
Ncam19.193e-1020.99neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam23.378e-923.01neural cell adhesion molecule 2 [Source:MGI Symbol... [more]
back to top
BLAST of NPHS1-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U3P2|SYG2_CAEEL5.958e-2021.07Synaptogenesis protein syg-2 OS=Caenorhabditis ele... [more]
sp|Q9R044|NPHN_RAT6.520e-1922.97Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 PE=... [more]
sp|O60500|NPHN_HUMAN8.371e-1921.97Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1[more]
sp|Q9QZS7|NPHN_MOUSE8.238e-1321.49Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=... [more]
sp|Q7TSU7|KIRR2_MOUSE1.335e-1025.62Kin of IRRE-like protein 2 OS=Mus musculus OX=1009... [more]
back to top
BLAST of NPHS1-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJQ00.000e+0100.00NPHS1-3 OS=Schmidtea mediterranea OX=79327 GN=NPHS... [more]
A0A0H3YFQ63.678e-11527.86NPHS1-6 OS=Schmidtea mediterranea OX=79327 GN=NPHS... [more]
G7YEL72.424e-11026.07Nephrin OS=Clonorchis sinensis OX=79923 GN=CLF_106... [more]
A0A4S2LBK44.122e-11025.78Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LBR44.398e-11025.78Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs11.423e-2124.46NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
kirrel3l4.116e-1034.00kirre like nephrin family adhesion molecule 3, lik... [more]
kirrel3l4.232e-1034.00kirre like nephrin family adhesion molecule 3, lik... [more]
kirrel3l4.718e-1034.00kirre like nephrin family adhesion molecule 3, lik... [more]
kirrel3a5.561e-926.07kirre like nephrin family adhesion molecule 3a [So... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ncam1b2.488e-826.44neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
ENSPMAT00000008186.14.128e-622.11pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHS1-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453834.241e-825.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPHS1-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs11.626e-4121.62NPHS1 adhesion molecule, nephrin [Source:NCBI gene... [more]
nphs12.370e-3922.22NPHS1 adhesion molecule, nephrin [Source:NCBI gene... [more]
ENSORLT00000046072.13.170e-1025.17pep primary_assembly:ASM223467v1:1:2157820:2166779... [more]
ENSORLT00000038190.13.863e-1025.52pep primary_assembly:ASM223467v1:1:2022690:2038485... [more]
kirrel3l5.015e-1035.00kirre like nephrin family adhesion molecule 2 [Sou... [more]
back to top
BLAST of NPHS1-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070688.12.105e-1699.44SMESG000070688.1[more]
SMESG000070688.12.133e-1699.43SMESG000070688.1[more]
SMESG000070688.10.000e+099.08SMESG000070688.1[more]
SMESG000028689.12.353e-12027.71SMESG000028689.1[more]
SMESG000028689.13.474e-12028.03SMESG000028689.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010202
GenBankAKN21719.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010202 ID=SMED30010202|Name=NPHS1-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3930bp
GGAAAACATTTTAATCAAAATTTATAGAAAAGAAAATGTATCAAATTTGG
ATAGTTATTGTGCTGGGCTCAAAAATAATTTACGACTCATCTCCATTGCC
GGTGACTCAATCGCAGAAATGTTCGGCGCGTGAATTGAAAAATTACATTC
AGTGCTTCAAAGAAATCCCACTGACAGATTATTATGTTCTCATCAACGAT
TCGATAGCAATTTCTTGTGTTGTCAACAATCAGCACGGAAAGGTTCAATG
GAGAGCTAAAAATTTAGTTTTAGGATATGACAGATCAGTGCCAGGAATGC
CAAGGTTACAAATAATCGGCGATGTGACAAAGGGAGAACATAATTTAAAG
ATAACTAAAGCACAAACGGAAGATTCTGGTGATTATGAATGTCAGGTTCA
ACCTGTTGATGCTCACCCTTTACTAAGACGTAAAAGCACATTACATGTAA
CGAAATTACCATCTATACCATACATTTTATACAAAAATGAGATACCGAAA
AATAATGAAATTATTATAGACTTTAACGTTAGCGTTAAAAAAATGCTCAA
ACTTATTTGCGTCAGTGAAGGCGGTTTGCCCCAACCGATTTTCCAATGGT
TTTGGAATTCCAGAGAAGTCACAACAGACGAAATGGAATTCATTTTAATA
ATAAACATTCAACCAAATAAATCGTCATTAAGTTTGCCGTTATCTCTTTT
AAAATCGGGCCACCAAATTTTATGTGTTATTAAAAATAAAGCCACCGAAT
TGTTGGAATCCCGTTTGCAATCAACTTACCAAAGATTTGAAGCAAAAGTC
ACAGTAATTATGTTTGTCAGATCCGGAAATCCACTAATCCAAAACAGTAA
TCAGATTGTTGATGAGAACAATGACATGGAGTTTACATGTTCAATGAAAC
CCACCGGGCATCCGAAATCCAAGCTGAAATGGAGCATGAACATTACAGCG
GGTTTCAGAATGGAAAATTTAATAAAAATTAAGTATAATGAAAATCAAGA
TGAACTAATAACAAATTTGCTGTTGAAGAAGCTGAATCGGACTTTCCATC
GTGTTAATGTCTCTTGCATATCAGAAAGCCCATTTATCACAAAATCTTCA
CCACCCTTTCAAATATATGTTAAACATAATCCTCAAAAATTGTCTATCGT
CACATTTAATGAAGAATCAGATAATCCTAATGAAAAATCAAGTTTTCCCC
CATTCATTCAACAGAATCATCTGGATATAATTAGCGGCATTGAGAATGAA
GACATTAATGTTCTTTGCTTCACCAGTAGTTATTATGGAACTTTGAATAT
GAAATGGATTCTACAGCACGGTGATTTTGTTGACGGCTCAAAGCTGACAA
TACAGATTTTATCCCCCTTGTTGAAATTGGATCACTATTTATCGAAAAAT
CACACTATTCAGACTTTTATCACTCAAAAAATAAAACTTAAACGAACTTT
AAACTCAGGATTTATTGAGTGTCATGCAACAACTGAAAACCAAATCCTCC
TAAAACAGAAAACTAAATTTAATGTATTTTATCAAGCAAAAATATCTGTT
ATTTCTGGATATGTTTCACAATTTCCTGTTCATGAAGGTGATATAATTCA
TCTAACTTGTTGCTCGTATGGTGGCAACCCAAGTCCTACTCTCAGGTGGT
ATAAAAATAATTCGTTGGTCCTATTTTCTGATGAAATTAAAACTGACAAA
GAAGAGCAAACGTTGGATTTTTTGTACCGAGTGTTCAAACACGACAATGG
TCAAAAAGTATTCTGTGAAGCCAAAAGCGAAAATGTGAAGGTCATTCCAG
TTAAAAGCAATTTTCTGATAATCAACGTAATATTTCCACCAGTTCATTTA
GAGATTTCATGCCTAAATTGCATTCCCAACAAAATAATGGCCAACCGCAC
CAATGAATTCCTCTGCGAAAGCAGCAGCTCTAATCCAGGAAGTATTATTA
CCTGGAAGTTACTAAATTGTTCTTCGATAGAAATCGGGAATTCTACTAAT
TGTTCATCAACAGTTATGCAAGGAACTCTTTCGACAAACTTTCCCGGACA
ATATAATGGTTGGAAAACACAAAGCAAACTCAATCTACTTCTCAATTATA
AACAAAATAATTTCATTTTGCAATGTCAGTCAAGATTAAGTCACAAAATT
CTACCAGAAAAATACAAACCTATTGTTAAGAACATCAAACTCAAAGTACT
TTATCCTCCATTTATAATGAATTCTCTGAATTCATTATACGTATTTGAAG
GTTCAACTGTAAATTTGCAATATCAAATTTCTGCTAATCCGAAGGCAACG
CATTTCTCATGGTATTTTCAGAACAGATTTATTTCCAGCAAACAAAATCT
TATTATAAAAAACATTCATTTTAATGATTCTGGATCATACAAATTTGTCG
TTGAAAATTTACTCGGATCAGCCACGAGGTCTTTCGAAATTGATGTTAAA
TACTCTCCGAAAGTTGTGAAAACCTCAATAAACATTTTCAATGATTCAGC
CGAGTTCTTTTGTGAAGCTTCTATGAATCCTATTTACAGTAACTTTTCCG
TTGTTTGGAGAAGAATTGAACCAAACGATCGAATTGCTTATAGGGATTCC
AGAGATTTTCTACCAATTCTCTCAATTAATTATTCATGTAACAGTAACTC
AAAACCAACAAATCAAATGAGAATTAATTCTAATTGTGGAATAAATAAAA
ATAATAAAATATACTCAAAGCTGATCATTTCTCCATATCAAGAATCTGAT
TTCGGATGGTATCAATGTATGTTCTGCAACGGTATTGGCATGAAAGGCAG
AGAGAACCTGCATTTGAATATACCGATAAAGCCTTGGTATTTGAAAATAT
CTCAATATTCAAAACAGGGAACAGATATTTCTCATCATTCTCTATTGACA
TGCTGTTTCCTGTCTCACGTCAATCCGTCAATATTCTGGCTTGTTCCATT
TTCAAATGAAATTATTTTTTCAACAAATACAACTGAAATTCGTCAGAGTA
CATTTTGTGGATTTCTTCATATGTACGTTAAAGAAGAAAGTTATTTCGGA
CAATACAAATGTCAAGCAAAAAATGAAAGAGGTAGTTCAAGATTAGCATA
TGTCAGTCTTCTTCCAACATTCCAACCGGATTTTCCTGAAAGTTTTAAAC
TTTTTATTTTATTTAAAAATAATATCCATCTCTCCTGGATTAAAGGAGCT
GATGGAGGCAGCGAACAAACTTTCCAATTGAGATGGTGGGATGAAAAGCA
ACAGTCGACATTTCGCTATCAAACGGTGAAAGGAAACCAATCTAAAGAAA
CTTTAGAAATAACAATATCAAACTTCTCCATCGGAAGTTACTCGATTGAT
ATTGGAGTGAATAGTATTCGATATCCGGATTTTCGATATTGCTGTGCCAT
ATCTTTCGTAGTTTTATCGGACAAAAATGATACTTTTGATGGTACTAATA
CCAAATCACAAACTCATGTTGAGTATCCCGATGTTAATTTAGAAAACTTG
AATCTAAGCATTTATTACATAATAATTGCTTCGTCAATTGTTGTTTTTCT
ATCACTATTTTTTGCTTTATTTATCTTTGTCTGCATAATGAAACATCGCC
GGAAATCATCCGTTTCTCTTCAAAACCGAAAGAAATCCCTTGCTGTTGAT
TCATTGCTCAAATTACCAGATACCCTAAATGAAAGCAAGCTAATGGCTGA
TCAACTTGATAATAGTGAGGACATTCAAATGAAGCTGGATCCATCGTCAG
AACCGAAAGAATTAATCATTGATCAGGAAACAATTAAATTTTAGCATTTC
TCAAAGTGTATCAACAAGTTCTCAGAGTCCAGTACTATGTCAAGGATTGT
ACGGTCGATTTATCATGGAGAAATGGCAGCCTTGTGATTGTCATTTATCA
ATGGAACGAGATGGATTTGTTTTAATGACT
back to top

protein sequence of SMED30010202-orf-1

>SMED30010202-orf-1 ID=SMED30010202-orf-1|Name=SMED30010202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1253bp
MYQIWIVIVLGSKIIYDSSPLPVTQSQKCSARELKNYIQCFKEIPLTDYY
VLINDSIAISCVVNNQHGKVQWRAKNLVLGYDRSVPGMPRLQIIGDVTKG
EHNLKITKAQTEDSGDYECQVQPVDAHPLLRRKSTLHVTKLPSIPYILYK
NEIPKNNEIIIDFNVSVKKMLKLICVSEGGLPQPIFQWFWNSREVTTDEM
EFILIINIQPNKSSLSLPLSLLKSGHQILCVIKNKATELLESRLQSTYQR
FEAKVTVIMFVRSGNPLIQNSNQIVDENNDMEFTCSMKPTGHPKSKLKWS
MNITAGFRMENLIKIKYNENQDELITNLLLKKLNRTFHRVNVSCISESPF
ITKSSPPFQIYVKHNPQKLSIVTFNEESDNPNEKSSFPPFIQQNHLDIIS
GIENEDINVLCFTSSYYGTLNMKWILQHGDFVDGSKLTIQILSPLLKLDH
YLSKNHTIQTFITQKIKLKRTLNSGFIECHATTENQILLKQKTKFNVFYQ
AKISVISGYVSQFPVHEGDIIHLTCCSYGGNPSPTLRWYKNNSLVLFSDE
IKTDKEEQTLDFLYRVFKHDNGQKVFCEAKSENVKVIPVKSNFLIINVIF
PPVHLEISCLNCIPNKIMANRTNEFLCESSSSNPGSIITWKLLNCSSIEI
GNSTNCSSTVMQGTLSTNFPGQYNGWKTQSKLNLLLNYKQNNFILQCQSR
LSHKILPEKYKPIVKNIKLKVLYPPFIMNSLNSLYVFEGSTVNLQYQISA
NPKATHFSWYFQNRFISSKQNLIIKNIHFNDSGSYKFVVENLLGSATRSF
EIDVKYSPKVVKTSINIFNDSAEFFCEASMNPIYSNFSVVWRRIEPNDRI
AYRDSRDFLPILSINYSCNSNSKPTNQMRINSNCGINKNNKIYSKLIISP
YQESDFGWYQCMFCNGIGMKGRENLHLNIPIKPWYLKISQYSKQGTDISH
HSLLTCCFLSHVNPSIFWLVPFSNEIIFSTNTTEIRQSTFCGFLHMYVKE
ESYFGQYKCQAKNERGSSRLAYVSLLPTFQPDFPESFKLFILFKNNIHLS
WIKGADGGSEQTFQLRWWDEKQQSTFRYQTVKGNQSKETLEITISNFSIG
SYSIDIGVNSIRYPDFRYCCAISFVVLSDKNDTFDGTNTKSQTHVEYPDV
NLENLNLSIYYIIIASSIVVFLSLFFALFIFVCIMKHRRKSSVSLQNRKK
SLAVDSLLKLPDTLNESKLMADQLDNSEDIQMKLDPSSEPKELIIDQETI
KF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR013162CD80_C2-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 715..789
e-value: 1.7E-6
score: 37.6
coord: 792..914
e-value: 1.5
score: 17.8
coord: 254..347
e-value: 74.0
score: 3.9
coord: 30..123
e-value: 3.8E-8
score: 43.1
IPR013162CD80-like, immunoglobulin C2-setPFAMPF08205C2-set_2coord: 506..567
e-value: 1.2E-5
score: 25.3
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 711..788
e-value: 1.4E-6
score: 28.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 796..915
e-value: 8.6E-7
score: 31.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 709..795
e-value: 3.6E-12
score: 48.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 596..708
e-value: 2.8E-6
score: 29.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 145..241
e-value: 2.0E-5
score: 26.7
coord: 488..589
e-value: 4.2E-10
score: 41.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 23..127
e-value: 3.1E-18
score: 67.7
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 23..112
coord: 373..828
NoneNo IPR availablePANTHERPTHR11640:SF80NEPHRINcoord: 23..112
coord: 373..828
NoneNo IPR availableTMHMMTMhelixcoord: 1144..1166
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 792..895
score: 6.832
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 6..121
score: 8.92
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 485..571
score: 8.647
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 708..787
score: 8.139
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 917..1008
score: 6.796
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 126..231
score: 7.54
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 937..1018
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 803..917
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 147..221
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 28..131
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 705..794
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 498..586