Ankyrin repeat-containing domain protein

Overview
NameAnkyrin repeat-containing domain protein
Smed IDSMED30010188
Length (bp)1595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat-containing domain protein (SMED30010188) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat-containing domain protein (SMED30010188) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat-containing domain protein (SMED30010188) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat-containing domain protein (SMED30010188) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010188

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010188SMESG000011193.1 SmedASXL_009620SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010188SMESG000011193.1 dd_Smed_v4_13251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010188SMESG000011193.1 dd_Smed_v6_13251_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010188SMESG000011193.1 OX_Smed_1.0.19242ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010188SMESG000011193.1 dd_Smed_v4_13251_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 120.168 bits (300), Expect = 8.447e-28
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  252 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 529          

HSP 2 Score: 113.235 bits (282), Expect = 1.401e-25
Identity = 89/302 (29.47%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  259 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 557          

HSP 3 Score: 110.538 bits (275), Expect = 1.086e-24
Identity = 82/279 (29.39%), Postives = 129/279 (46.24%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+  +  K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  548 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 821          

HSP 4 Score: 108.997 bits (271), Expect = 4.107e-24
Identity = 77/275 (28.00%), Postives = 123/275 (44.73%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +I   +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG+
Sbjct:  483 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGN 755          

HSP 5 Score: 102.834 bits (255), Expect = 3.692e-22
Identity = 83/309 (26.86%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN + V   L   G +     RDGL  LH A + GH  +V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    +     K G      A +YG
Sbjct:  284 PLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYG 589          

HSP 6 Score: 101.679 bits (252), Expect = 9.443e-22
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N+    G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  549 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA-AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 829          

HSP 7 Score: 101.293 bits (251), Expect = 1.060e-21
Identity = 73/268 (27.24%), Postives = 125/268 (46.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQ--------CDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A   G   +VK L K GA+   +   N   PL+ A    +ID+V++++        + + +G TP  + + +G  + + IL   D     K K  +  +H A++++  K    L   + N +VQ         ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   ++ L+  G  ID +   G TP H A+  G  + +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:  116 LHIASLAGQAEVVKVLVKEGANINAQS-QNGFTPLYMAAQENHIDVVKYLLENGANQSTATE-DGFTPLAVALQQGHNQAVAILLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 377          

HSP 8 Score: 95.5153 bits (236), Expect = 6.835e-20
Identity = 69/275 (25.09%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  417 LHIACKKNRIKVMELLVKYGASIQAITESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGH 689          

HSP 9 Score: 93.2041 bits (230), Expect = 4.607e-19
Identity = 80/321 (24.92%), Postives = 130/321 (40.50%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            +GN+D V  YLK   ++    Q +GL  LH+A K GH+ +V+EL   G+                                    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L     +
Sbjct:   56 AGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSS-----------------------------------VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL 340          

HSP 10 Score: 84.3445 bits (207), Expect = 2.640e-16
Identity = 79/311 (25.40%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D V   L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  317 PLHCAARSGH-DQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA----LHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 621          

HSP 11 Score: 63.929 bits (154), Expect = 6.500e-10
Identity = 45/170 (26.47%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  631 LKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            +K   A+    D N    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   34 MKPEAANIEKSDSNA-SFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 201          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 120.168 bits (300), Expect = 8.535e-28
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  216 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 493          

HSP 2 Score: 113.235 bits (282), Expect = 1.320e-25
Identity = 106/418 (25.36%), Postives = 171/418 (40.91%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEID---RKNIETINIG------KISSQKVKKSSTPHRIEEGGYREL 1527
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    +     NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G   +     +A    S+      K+ +  LH                       Y ++  D  K+  +R+   D   +  +  +++       K++   ++K ++PH   + GY  L
Sbjct:  223 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLLARTK-NGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLA----TKKGFTPLHVA-------------------AKYGSL--DVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPL 612          

HSP 3 Score: 110.923 bits (276), Expect = 9.710e-25
Identity = 82/279 (29.39%), Postives = 129/279 (46.24%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+  +  K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  512 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 785          

HSP 4 Score: 108.612 bits (270), Expect = 4.673e-24
Identity = 77/274 (28.10%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +I   +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG
Sbjct:  447 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYG 718          

HSP 5 Score: 102.449 bits (254), Expect = 3.919e-22
Identity = 83/309 (26.86%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN + V   L   G +     RDGL  LH A + GH  +V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    +     K G      A +YG
Sbjct:  248 PLHVASKRGNTNMVKLLLDRGGQID-AKTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYG 553          

HSP 6 Score: 101.679 bits (252), Expect = 8.701e-22
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N+    G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  513 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 793          

HSP 7 Score: 100.523 bits (249), Expect = 1.617e-21
Identity = 80/325 (24.62%), Postives = 141/325 (43.38%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYD-------------------------------------LEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GN+D V  YLK   ++    Q +GL  LH+A K GH+ +V+EL   G+             LH A   G  ++V+ +V +    I++   NG TP ++   E  ++ +K L    A+ +   ++G   +  A ++ H++ +  L +                                      ++ +N   ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   ++ L+  G  ID +   G TP H A+  G  + +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:   20 AGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN-TALHIASLAGQAEVVKVLVKEGAN-INAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 341          

HSP 8 Score: 95.1301 bits (235), Expect = 8.904e-20
Identity = 69/275 (25.09%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++       D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  381 LHIACKKNRIKVMELLVKYGASIQAITESG-LTPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGH 653          

HSP 9 Score: 84.7297 bits (208), Expect = 2.135e-16
Identity = 79/311 (25.40%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D V   L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  281 PLHCAARSGH-DQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 585          

HSP 10 Score: 62.7734 bits (151), Expect = 1.412e-9
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:    7 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 165          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 119.783 bits (299), Expect = 1.395e-27
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  252 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 529          

HSP 2 Score: 112.849 bits (281), Expect = 1.963e-25
Identity = 89/302 (29.47%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  259 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 557          

HSP 3 Score: 110.923 bits (276), Expect = 8.660e-25
Identity = 82/279 (29.39%), Postives = 129/279 (46.24%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+  +  K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  548 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 821          

HSP 4 Score: 108.612 bits (270), Expect = 4.677e-24
Identity = 77/274 (28.10%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +I   +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG
Sbjct:  483 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYG 754          

HSP 5 Score: 102.449 bits (254), Expect = 4.428e-22
Identity = 83/309 (26.86%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN + V   L   G +     RDGL  LH A + GH  +V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    +     K G      A +YG
Sbjct:  284 PLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYG 589          

HSP 6 Score: 101.293 bits (251), Expect = 1.163e-21
Identity = 73/268 (27.24%), Postives = 125/268 (46.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQ--------CDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A   G   +VK L K GA+   +   N   PL+ A    +ID+V++++        + + +G TP  + + +G  + + IL   D     K K  +  +H A++++  K    L   + N +VQ         ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   ++ L+  G  ID +   G TP H A+  G  + +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:  116 LHIASLAGQAEVVKVLVKEGANINAQS-QNGFTPLYMAAQENHIDVVKYLLENGANQSTATE-DGFTPLAVALQQGHNQAVAILLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 377          

HSP 7 Score: 101.293 bits (251), Expect = 1.237e-21
Identity = 73/283 (25.80%), Postives = 121/283 (42.76%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA            PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N+    G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  549 LHISAREGQVDVASVLLEAGAAHSLATKKG-FTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 829          

HSP 8 Score: 95.1301 bits (235), Expect = 9.250e-20
Identity = 69/275 (25.09%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  417 LHIACKKNRIKVMELLVKYGASIQAITESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGH 689          

HSP 9 Score: 92.8189 bits (229), Expect = 4.957e-19
Identity = 80/321 (24.92%), Postives = 130/321 (40.50%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            +GN+D V  YLK   ++    Q +GL  LH+A K GH+ +V+EL   G+                                    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L     +
Sbjct:   56 AGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSS-----------------------------------VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL 340          

HSP 10 Score: 83.9593 bits (206), Expect = 3.343e-16
Identity = 79/311 (25.40%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D V   L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  317 PLHCAARSGH-DQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA----LHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 621          

HSP 11 Score: 63.5438 bits (153), Expect = 8.979e-10
Identity = 45/170 (26.47%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  631 LKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            +K   A+    D N    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   34 MKPEAANIEKSDSNA-SFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 201          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 119.783 bits (299), Expect = 1.420e-27
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  252 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 529          

HSP 2 Score: 112.849 bits (281), Expect = 2.016e-25
Identity = 89/302 (29.47%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  259 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 557          

HSP 3 Score: 110.923 bits (276), Expect = 9.385e-25
Identity = 82/279 (29.39%), Postives = 129/279 (46.24%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+  +  K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  548 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 821          

HSP 4 Score: 108.612 bits (270), Expect = 5.205e-24
Identity = 77/274 (28.10%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +I   +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG
Sbjct:  483 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYG 754          

HSP 5 Score: 102.449 bits (254), Expect = 4.588e-22
Identity = 83/309 (26.86%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN + V   L   G +     RDGL  LH A + GH  +V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    +     K G      A +YG
Sbjct:  284 PLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYG 589          

HSP 6 Score: 101.293 bits (251), Expect = 1.259e-21
Identity = 73/268 (27.24%), Postives = 125/268 (46.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQ--------CDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A   G   +VK L K GA+   +   N   PL+ A    +ID+V++++        + + +G TP  + + +G  + + IL   D     K K  +  +H A++++  K    L   + N +VQ         ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   ++ L+  G  ID +   G TP H A+  G  + +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:  116 LHIASLAGQAEVVKVLVKEGANINAQS-QNGFTPLYMAAQENHIDVVKYLLENGANQSTATE-DGFTPLAVALQQGHNQAVAILLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 377          

HSP 7 Score: 100.908 bits (250), Expect = 1.351e-21
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N+    G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  549 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 829          

HSP 8 Score: 95.1301 bits (235), Expect = 1.037e-19
Identity = 69/275 (25.09%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  417 LHIACKKNRIKVMELLVKYGASIQAITESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGH 689          

HSP 9 Score: 92.8189 bits (229), Expect = 5.179e-19
Identity = 80/321 (24.92%), Postives = 130/321 (40.50%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            +GN+D V  YLK   ++    Q +GL  LH+A K GH+ +V+EL   G+                                    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L     +
Sbjct:   56 AGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSS-----------------------------------VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL 340          

HSP 10 Score: 83.9593 bits (206), Expect = 3.315e-16
Identity = 79/311 (25.40%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D V   L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  317 PLHCAARSGH-DQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA----LHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 621          

HSP 11 Score: 62.7734 bits (151), Expect = 1.428e-9
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   43 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 201          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 119.398 bits (298), Expect = 1.437e-27
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  216 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 493          

HSP 2 Score: 112.849 bits (281), Expect = 2.212e-25
Identity = 89/302 (29.47%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  223 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 521          

HSP 3 Score: 108.612 bits (270), Expect = 5.461e-24
Identity = 68/243 (27.98%), Postives = 121/243 (49.79%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NG TP HI   + +++    L NY A+  +  K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  513 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 752          

HSP 4 Score: 102.449 bits (254), Expect = 4.857e-22
Identity = 83/309 (26.86%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN + V   L   G +     RDGL  LH A + GH  +V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    +     K G      A +YG
Sbjct:  248 PLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYG 553          

HSP 5 Score: 100.908 bits (250), Expect = 1.333e-21
Identity = 73/268 (27.24%), Postives = 125/268 (46.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQ--------CDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A   G   +VK L K GA+   +   N   PL+ A    +ID+V++++        + + +G TP  + + +G  + + IL   D     K K  +  +H A++++  K    L   + N +VQ         ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   ++ L+  G  ID +   G TP H A+  G  + +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:   80 LHIASLAGQAEVVKVLVKEGANINAQS-QNGFTPLYMAAQENHIDVVKYLLENGANQSTATE-DGFTPLAVALQQGHNQAVAILLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 341          

HSP 6 Score: 100.523 bits (249), Expect = 1.723e-21
Identity = 80/316 (25.32%), Postives = 128/316 (40.51%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGE---------------------------------LECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+                                 L+  K+L    A      KNG   +H A+K+N  +I   L +     N+    G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  447 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 760          

HSP 7 Score: 94.3597 bits (233), Expect = 1.720e-19
Identity = 77/276 (27.90%), Postives = 120/276 (43.48%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            +HVA   GHLNIV  L + GA       +N R    LH A   G +++V  ++ ++   +D+      TP HI    G+ E +++L  + A       NG   +H +++     +   L +     ++    G T LH AA   S    ++L++  A        G +PLH+AAK N ++    L++ G   +I   +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG
Sbjct:  414 IHVAAFMGHLNIVLLLLQNGASPDV---TNIRGETALHMAARAGQVEVVRCLL-RNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYG 685          

HSP 8 Score: 92.8189 bits (229), Expect = 5.731e-19
Identity = 80/321 (24.92%), Postives = 130/321 (40.50%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            +GN+D V  YLK   ++    Q +GL  LH+A K GH+ +V+EL   G+                                    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L     +
Sbjct:   20 AGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSS-----------------------------------VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL 304          

HSP 9 Score: 92.0485 bits (227), Expect = 9.287e-19
Identity = 70/275 (25.45%), Postives = 116/275 (42.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH  + K L    A+   +   N   PLH AC    I ++E +V K    I +I  +GLTP H+    G L  + +L    A   V +  G   +H A++    +++R L      ++ +    +T LH A+       +Q+L++  A        G +PLH++A+   ++    L+  G    +   +G TP H+A+  G  +    LL   A   +    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  348 LHVAAHCGHYRVTKLLLDKRANPNARA-LNGFTPLHIACKKNRIKVMELLV-KYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGH 620          

HSP 10 Score: 83.1889 bits (204), Expect = 6.406e-16
Identity = 77/301 (25.58%), Postives = 129/301 (42.86%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            P+     SG+ D V   L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G
Sbjct:  281 PLHCAARSGH-DQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA----LHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG 575          

HSP 11 Score: 62.7734 bits (151), Expect = 1.368e-9
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:    7 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 165          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 5.703e-28
Identity = 82/278 (29.50%), Postives = 127/278 (45.68%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRF----IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH A + GH  +V  L   GA    K   N   PLH A    ++D      A++L +    +D +  + LTP H+    G +   K+L +  AD   +  NG   +H A K+N  K++  L      I    ++G T LH AA   + + +  L++  A+  +E   G +PLHLAA+ N  + +R L+  G  +D +    +TP HIAS  G  + +  LL  GA+  A   +  +  H A + G  E     L+HN     + K G      A +YG
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVD-----AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG 568          

HSP 2 Score: 112.464 bits (280), Expect = 1.097e-25
Identity = 73/260 (28.08%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  355 KFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCF 1128
            K ++ + G   LH+A KYG+L +V+ L + G     +   NQ  PLH A  + N D V  ++ ++     +   NG TP HI   + ++E    L  + AD   K + G   +H +++  H +I   L +   ++  + + G TA+H  A  +     Q+L    A+I+ + N G +PLH+A     L  +++LV  G  +  +     TP H A+ QG + C+ +LL+NGA        G T    A R G+   +   
Sbjct:  550 KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 106.686 bits (265), Expect = 7.205e-24
Identity = 73/281 (25.98%), Postives = 130/281 (46.26%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A +    ++V+ L + GA    +    Q  PLH A   GN D+V  ++ ++    ++   +  +P HI   EG+ E   IL +++AD T+  K G   +H ASK  + +++R L +    ++++     T LH AA  N+     +L++  A        G +PLH+AAK N +E    L+      + +   G TP H+++ +G  E    L++NG+D+ A  + G T  H   +  H        N+   ++     G      A  +G 
Sbjct:  456 VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIV-ILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ 734          

HSP 4 Score: 103.99 bits (258), Expect = 5.321e-23
Identity = 80/320 (25.00%), Postives = 139/320 (43.44%), Query Frame = 1
Query:  265 VKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
             + L+ P+      GN D V   L++  N     + +   LH+A K G   +   L  + AD           PLH A  +GN+++V  ++ +    +D    N +TP H+       +   +L    A      KNG   +H A+K+N  +I   L   + + N +   G T LH +A         +L++  +D+  + N G + +HL A+ + +   + L + G  I+ + N G TP H+A   G    + +L++NGAD+        T  H A + GH   +   L +  S +E    G+     A+R G+  + E
Sbjct:  488 ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL-LTKKGFTPLHLASKYGNLEVVRLLLERGTP-VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 102.834 bits (255), Expect = 1.280e-22
Identity = 79/308 (25.65%), Postives = 127/308 (41.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKC---------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH+ + K L    AD   +   N   PLH AC    I +VE ++ K    I++   +GLTP H+    G +  +  L    A+  V+   G   +H A++ N   ++R L      ++ Q    +T LH A+   +   + +L++                                  NAD ++   +G +PLHLA+K+ +LE +R L+  G P+DI      TP H+A+     +    LL+NGA   A    G T  H A +    E     L      +  ++ G      + + GH
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 6 Score: 96.6709 bits (239), Expect = 1.121e-20
Identity = 80/306 (26.14%), Postives = 140/306 (45.75%), Query Frame = 1
Query:  250 IYNFFVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            I +   K L  P+     SG+ D V   L  +G       ++GL  LH+A +  H++  + L  + A   D    Y      PLH A   G++ + + ++ +S    +S   NG TP HI   +  ++ +++L  Y A      ++G+  +H A+      I+ YL     N +V+   G+T LH AA  N    +++L++  A +  +  E  +PLH+A++  + + +  L+  G   +       +P HIA+ +G  E    LLD+ AD   +  +G T  H A + G+ E +   L     VD
Sbjct:  285 IIDSRTKDLLTPLHCAARSGH-DQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----LTPLHVAAHCGHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD 584          

HSP 7 Score: 85.5001 bits (210), Expect = 4.596e-17
Identity = 74/289 (25.61%), Postives = 116/289 (40.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDL-----------------------------EININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A K GH  +V+EL K  A             LH A   G   +V  +V      ++    NG TP ++   E   E +K L  + A+  +  ++G   +  A ++ HD+++  L +                              E N +V   +G T LH AA     +  Q+L++  A+++ +     SPLH+A K         L+S G  ID R     TP H A+  G  + +  L+  GA I A    G    H A +G H +     L H   VD++ 
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAAT-RKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVT 356          

HSP 8 Score: 77.0258 bits (188), Expect = 1.849e-14
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  607 GELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            G+LE +  L     D    + NG+  +H ASK  H +++R L   +  ++     G TALH A++      + +LV+  A+++++   G +PL++AA+ N  E ++YL+  G    +    G TP  +A  QG    +  LL+N
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 9 Score: 72.4034 bits (176), Expect = 4.909e-13
Identity = 70/307 (22.80%), Postives = 114/307 (37.13%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV-----------------------------KCNADISIEDNE----GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  YGH N+ + L + GA+  Y+   N   PLH A  +G  ++   ++++    IDS   + LTP                                 +H A++  HD+++  L      I+ +   G   LH AA  +   A + L+                             K   D S + N     G +PLH+A K N ++ +  L+     I+     G TP H+A+F G    + +LL  GA+       G T  H A R    + +   + +   VD   +  +     A R G
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNIS-PLHVATKWGRTNMANLLLSRGA-IIDSRTKDLLTP---------------------------------LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG 502          

HSP 10 Score: 60.4622 bits (145), Expect = 2.838e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNG 1143
            L++A +  H  +VK L K+GA+       +   PL  A   G+  +V  ++       DS     L   HI   + +     +L   + +  V  K+G   +H A+   H+ + + L +   N+N Q     + LH A      +   +L+   A I     +  +PLH AA+    + +  LV  G PI  +   G  P H+A+ QG H +    LL + A +  V  +  T  H A   GH       L+ + 
Sbjct:  136 LYMAAQENHEEVVKYLLKHGANQALST-EDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAA-QGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSA 383          

HSP 11 Score: 52.7582 bits (125), Expect = 6.454e-7
Identity = 47/180 (26.11%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWDQLHA 1299
            G  +   AA       +  L++   DI+  +  G + LHLA+K    E +R L+     +D    +G T  HIAS  G    +  L++NGA++      G T  + A +  H E +   L H  +     + G      A + GH     V+ E   K +V   +  L I  +K D   A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV--RLPALHIAAKKDDTTAA 210          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 5.703e-28
Identity = 82/278 (29.50%), Postives = 127/278 (45.68%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRF----IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH A + GH  +V  L   GA    K   N   PLH A    ++D      A++L +    +D +  + LTP H+    G +   K+L +  AD   +  NG   +H A K+N  K++  L      I    ++G T LH AA   + + +  L++  A+  +E   G +PLHLAA+ N  + +R L+  G  +D +    +TP HIAS  G  + +  LL  GA+  A   +  +  H A + G  E     L+HN     + K G      A +YG
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVD-----AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG 568          

HSP 2 Score: 112.464 bits (280), Expect = 1.097e-25
Identity = 73/260 (28.08%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  355 KFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCF 1128
            K ++ + G   LH+A KYG+L +V+ L + G     +   NQ  PLH A  + N D V  ++ ++     +   NG TP HI   + ++E    L  + AD   K + G   +H +++  H +I   L +   ++  + + G TA+H  A  +     Q+L    A+I+ + N G +PLH+A     L  +++LV  G  +  +     TP H A+ QG + C+ +LL+NGA        G T    A R G+   +   
Sbjct:  550 KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 106.686 bits (265), Expect = 7.205e-24
Identity = 73/281 (25.98%), Postives = 130/281 (46.26%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A +    ++V+ L + GA    +    Q  PLH A   GN D+V  ++ ++    ++   +  +P HI   EG+ E   IL +++AD T+  K G   +H ASK  + +++R L +    ++++     T LH AA  N+     +L++  A        G +PLH+AAK N +E    L+      + +   G TP H+++ +G  E    L++NG+D+ A  + G T  H   +  H        N+   ++     G      A  +G 
Sbjct:  456 VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIV-ILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ 734          

HSP 4 Score: 103.99 bits (258), Expect = 5.321e-23
Identity = 80/320 (25.00%), Postives = 139/320 (43.44%), Query Frame = 1
Query:  265 VKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
             + L+ P+      GN D V   L++  N     + +   LH+A K G   +   L  + AD           PLH A  +GN+++V  ++ +    +D    N +TP H+       +   +L    A      KNG   +H A+K+N  +I   L   + + N +   G T LH +A         +L++  +D+  + N G + +HL A+ + +   + L + G  I+ + N G TP H+A   G    + +L++NGAD+        T  H A + GH   +   L +  S +E    G+     A+R G+  + E
Sbjct:  488 ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL-LTKKGFTPLHLASKYGNLEVVRLLLERGTP-VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 102.834 bits (255), Expect = 1.280e-22
Identity = 79/308 (25.65%), Postives = 127/308 (41.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKC---------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH+ + K L    AD   +   N   PLH AC    I +VE ++ K    I++   +GLTP H+    G +  +  L    A+  V+   G   +H A++ N   ++R L      ++ Q    +T LH A+   +   + +L++                                  NAD ++   +G +PLHLA+K+ +LE +R L+  G P+DI      TP H+A+     +    LL+NGA   A    G T  H A +    E     L      +  ++ G      + + GH
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 6 Score: 96.6709 bits (239), Expect = 1.121e-20
Identity = 80/306 (26.14%), Postives = 140/306 (45.75%), Query Frame = 1
Query:  250 IYNFFVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            I +   K L  P+     SG+ D V   L  +G       ++GL  LH+A +  H++  + L  + A   D    Y      PLH A   G++ + + ++ +S    +S   NG TP HI   +  ++ +++L  Y A      ++G+  +H A+      I+ YL     N +V+   G+T LH AA  N    +++L++  A +  +  E  +PLH+A++  + + +  L+  G   +       +P HIA+ +G  E    LLD+ AD   +  +G T  H A + G+ E +   L     VD
Sbjct:  285 IIDSRTKDLLTPLHCAARSGH-DQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----LTPLHVAAHCGHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD 584          

HSP 7 Score: 85.5001 bits (210), Expect = 4.596e-17
Identity = 74/289 (25.61%), Postives = 116/289 (40.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDL-----------------------------EININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A K GH  +V+EL K  A             LH A   G   +V  +V      ++    NG TP ++   E   E +K L  + A+  +  ++G   +  A ++ HD+++  L +                              E N +V   +G T LH AA     +  Q+L++  A+++ +     SPLH+A K         L+S G  ID R     TP H A+  G  + +  L+  GA I A    G    H A +G H +     L H   VD++ 
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAAT-RKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVT 356          

HSP 8 Score: 77.0258 bits (188), Expect = 1.849e-14
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  607 GELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            G+LE +  L     D    + NG+  +H ASK  H +++R L   +  ++     G TALH A++      + +LV+  A+++++   G +PL++AA+ N  E ++YL+  G    +    G TP  +A  QG    +  LL+N
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 9 Score: 72.4034 bits (176), Expect = 4.909e-13
Identity = 70/307 (22.80%), Postives = 114/307 (37.13%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV-----------------------------KCNADISIEDNE----GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  YGH N+ + L + GA+  Y+   N   PLH A  +G  ++   ++++    IDS   + LTP                                 +H A++  HD+++  L      I+ +   G   LH AA  +   A + L+                             K   D S + N     G +PLH+A K N ++ +  L+     I+     G TP H+A+F G    + +LL  GA+       G T  H A R    + +   + +   VD   +  +     A R G
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNIS-PLHVATKWGRTNMANLLLSRGA-IIDSRTKDLLTP---------------------------------LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG 502          

HSP 10 Score: 60.4622 bits (145), Expect = 2.838e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNG 1143
            L++A +  H  +VK L K+GA+       +   PL  A   G+  +V  ++       DS     L   HI   + +     +L   + +  V  K+G   +H A+   H+ + + L +   N+N Q     + LH A      +   +L+   A I     +  +PLH AA+    + +  LV  G PI  +   G  P H+A+ QG H +    LL + A +  V  +  T  H A   GH       L+ + 
Sbjct:  136 LYMAAQENHEEVVKYLLKHGANQALST-EDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAA-QGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSA 383          

HSP 11 Score: 52.7582 bits (125), Expect = 6.454e-7
Identity = 47/180 (26.11%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWDQLHA 1299
            G  +   AA       +  L++   DI+  +  G + LHLA+K    E +R L+     +D    +G T  HIAS  G    +  L++NGA++      G T  + A +  H E +   L H  +     + G      A + GH     V+ E   K +V   +  L I  +K D   A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV--RLPALHIAAKKDDTTAA 210          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 5.882e-28
Identity = 82/278 (29.50%), Postives = 127/278 (45.68%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRF----IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH A + GH  +V  L   GA    K   N   PLH A    ++D      A++L +    +D +  + LTP H+    G +   K+L +  AD   +  NG   +H A K+N  K++  L      I    ++G T LH AA   + + +  L++  A+  +E   G +PLHLAA+ N  + +R L+  G  +D +    +TP HIAS  G  + +  LL  GA+  A   +  +  H A + G  E     L+HN     + K G      A +YG
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVD-----AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG 568          

HSP 2 Score: 112.464 bits (280), Expect = 1.063e-25
Identity = 73/260 (28.08%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  355 KFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCF 1128
            K ++ + G   LH+A KYG+L +V+ L + G     +   NQ  PLH A  + N D V  ++ ++     +   NG TP HI   + ++E    L  + AD   K + G   +H +++  H +I   L +   ++  + + G TA+H  A  +     Q+L    A+I+ + N G +PLH+A     L  +++LV  G  +  +     TP H A+ QG + C+ +LL+NGA        G T    A R G+   +   
Sbjct:  550 KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 106.686 bits (265), Expect = 7.296e-24
Identity = 73/281 (25.98%), Postives = 130/281 (46.26%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A +    ++V+ L + GA    +    Q  PLH A   GN D+V  ++ ++    ++   +  +P HI   EG+ E   IL +++AD T+  K G   +H ASK  + +++R L +    ++++     T LH AA  N+     +L++  A        G +PLH+AAK N +E    L+      + +   G TP H+++ +G  E    L++NG+D+ A  + G T  H   +  H        N+   ++     G      A  +G 
Sbjct:  456 VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIV-ILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ 734          

HSP 4 Score: 103.99 bits (258), Expect = 5.888e-23
Identity = 80/320 (25.00%), Postives = 139/320 (43.44%), Query Frame = 1
Query:  265 VKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
             + L+ P+      GN D V   L++  N     + +   LH+A K G   +   L  + AD           PLH A  +GN+++V  ++ +    +D    N +TP H+       +   +L    A      KNG   +H A+K+N  +I   L   + + N +   G T LH +A         +L++  +D+  + N G + +HL A+ + +   + L + G  I+ + N G TP H+A   G    + +L++NGAD+        T  H A + GH   +   L +  S +E    G+     A+R G+  + E
Sbjct:  488 ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL-LTKKGFTPLHLASKYGNLEVVRLLLERGTP-VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 102.834 bits (255), Expect = 1.308e-22
Identity = 79/308 (25.65%), Postives = 127/308 (41.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKC---------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH+ + K L    AD   +   N   PLH AC    I +VE ++ K    I++   +GLTP H+    G +  +  L    A+  V+   G   +H A++ N   ++R L      ++ Q    +T LH A+   +   + +L++                                  NAD ++   +G +PLHLA+K+ +LE +R L+  G P+DI      TP H+A+     +    LL+NGA   A    G T  H A +    E     L      +  ++ G      + + GH
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 6 Score: 96.6709 bits (239), Expect = 1.330e-20
Identity = 80/306 (26.14%), Postives = 140/306 (45.75%), Query Frame = 1
Query:  250 IYNFFVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            I +   K L  P+     SG+ D V   L  +G       ++GL  LH+A +  H++  + L  + A   D    Y      PLH A   G++ + + ++ +S    +S   NG TP HI   +  ++ +++L  Y A      ++G+  +H A+      I+ YL     N +V+   G+T LH AA  N    +++L++  A +  +  E  +PLH+A++  + + +  L+  G   +       +P HIA+ +G  E    LLD+ AD   +  +G T  H A + G+ E +   L     VD
Sbjct:  285 IIDSRTKDLLTPLHCAARSGH-DQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----LTPLHVAAHCGHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD 584          

HSP 7 Score: 85.5001 bits (210), Expect = 4.857e-17
Identity = 74/289 (25.61%), Postives = 116/289 (40.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDL-----------------------------EININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A K GH  +V+EL K  A             LH A   G   +V  +V      ++    NG TP ++   E   E +K L  + A+  +  ++G   +  A ++ HD+++  L +                              E N +V   +G T LH AA     +  Q+L++  A+++ +     SPLH+A K         L+S G  ID R     TP H A+  G  + +  L+  GA I A    G    H A +G H +     L H   VD++ 
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAAT-RKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVT 356          

HSP 8 Score: 77.411 bits (189), Expect = 1.586e-14
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  607 GELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            G+LE +  L     D    + NG+  +H ASK  H +++R L   +  ++     G TALH A++      + +LV+  A+++++   G +PL++AA+ N  E ++YL+  G    +    G TP  +A  QG    +  LL+N
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 9 Score: 72.4034 bits (176), Expect = 5.366e-13
Identity = 70/307 (22.80%), Postives = 114/307 (37.13%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV-----------------------------KCNADISIEDNE----GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  YGH N+ + L + GA+  Y+   N   PLH A  +G  ++   ++++    IDS   + LTP                                 +H A++  HD+++  L      I+ +   G   LH AA  +   A + L+                             K   D S + N     G +PLH+A K N ++ +  L+     I+     G TP H+A+F G    + +LL  GA+       G T  H A R    + +   + +   VD   +  +     A R G
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNIS-PLHVATKWGRTNMANLLLSRGA-IIDSRTKDLLTP---------------------------------LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG 502          

HSP 10 Score: 60.077 bits (144), Expect = 3.234e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNG 1143
            L++A +  H  +VK L K+GA+       +   PL  A   G+  +V  ++       DS     L   HI   + +     +L   + +  V  K+G   +H A+   H+ + + L +   N+N Q     + LH A      +   +L+   A I     +  +PLH AA+    + +  LV  G PI  +   G  P H+A+ QG H +    LL + A +  V  +  T  H A   GH       L+ + 
Sbjct:  136 LYMAAQENHEEVVKYLLKHGANQALST-EDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAA-QGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSA 383          

HSP 11 Score: 52.7582 bits (125), Expect = 6.248e-7
Identity = 47/180 (26.11%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWDQLHA 1299
            G  +   AA       +  L++   DI+  +  G + LHLA+K    E +R L+     +D    +G T  HIAS  G    +  L++NGA++      G T  + A +  H E +   L H  +     + G      A + GH     V+ E   K +V   +  L I  +K D   A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV--RLPALHIAAKKDDTTAA 210          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 5.882e-28
Identity = 82/278 (29.50%), Postives = 127/278 (45.68%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRF----IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH A + GH  +V  L   GA    K   N   PLH A    ++D      A++L +    +D +  + LTP H+    G +   K+L +  AD   +  NG   +H A K+N  K++  L      I    ++G T LH AA   + + +  L++  A+  +E   G +PLHLAA+ N  + +R L+  G  +D +    +TP HIAS  G  + +  LL  GA+  A   +  +  H A + G  E     L+HN     + K G      A +YG
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVD-----AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG 568          

HSP 2 Score: 112.464 bits (280), Expect = 1.063e-25
Identity = 73/260 (28.08%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  355 KFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCF 1128
            K ++ + G   LH+A KYG+L +V+ L + G     +   NQ  PLH A  + N D V  ++ ++     +   NG TP HI   + ++E    L  + AD   K + G   +H +++  H +I   L +   ++  + + G TA+H  A  +     Q+L    A+I+ + N G +PLH+A     L  +++LV  G  +  +     TP H A+ QG + C+ +LL+NGA        G T    A R G+   +   
Sbjct:  550 KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 106.686 bits (265), Expect = 7.296e-24
Identity = 73/281 (25.98%), Postives = 130/281 (46.26%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A +    ++V+ L + GA    +    Q  PLH A   GN D+V  ++ ++    ++   +  +P HI   EG+ E   IL +++AD T+  K G   +H ASK  + +++R L +    ++++     T LH AA  N+     +L++  A        G +PLH+AAK N +E    L+      + +   G TP H+++ +G  E    L++NG+D+ A  + G T  H   +  H        N+   ++     G      A  +G 
Sbjct:  456 VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIV-ILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ 734          

HSP 4 Score: 103.99 bits (258), Expect = 5.888e-23
Identity = 80/320 (25.00%), Postives = 139/320 (43.44%), Query Frame = 1
Query:  265 VKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
             + L+ P+      GN D V   L++  N     + +   LH+A K G   +   L  + AD           PLH A  +GN+++V  ++ +    +D    N +TP H+       +   +L    A      KNG   +H A+K+N  +I   L   + + N +   G T LH +A         +L++  +D+  + N G + +HL A+ + +   + L + G  I+ + N G TP H+A   G    + +L++NGAD+        T  H A + GH   +   L +  S +E    G+     A+R G+  + E
Sbjct:  488 ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL-LTKKGFTPLHLASKYGNLEVVRLLLERGTP-VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 102.834 bits (255), Expect = 1.308e-22
Identity = 79/308 (25.65%), Postives = 127/308 (41.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKC---------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH+ + K L    AD   +   N   PLH AC    I +VE ++ K    I++   +GLTP H+    G +  +  L    A+  V+   G   +H A++ N   ++R L      ++ Q    +T LH A+   +   + +L++                                  NAD ++   +G +PLHLA+K+ +LE +R L+  G P+DI      TP H+A+     +    LL+NGA   A    G T  H A +    E     L      +  ++ G      + + GH
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 6 Score: 96.6709 bits (239), Expect = 1.330e-20
Identity = 80/306 (26.14%), Postives = 140/306 (45.75%), Query Frame = 1
Query:  250 IYNFFVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            I +   K L  P+     SG+ D V   L  +G       ++GL  LH+A +  H++  + L  + A   D    Y      PLH A   G++ + + ++ +S    +S   NG TP HI   +  ++ +++L  Y A      ++G+  +H A+      I+ YL     N +V+   G+T LH AA  N    +++L++  A +  +  E  +PLH+A++  + + +  L+  G   +       +P HIA+ +G  E    LLD+ AD   +  +G T  H A + G+ E +   L     VD
Sbjct:  285 IIDSRTKDLLTPLHCAARSGH-DQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----LTPLHVAAHCGHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD 584          

HSP 7 Score: 85.5001 bits (210), Expect = 4.857e-17
Identity = 74/289 (25.61%), Postives = 116/289 (40.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDL-----------------------------EININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A K GH  +V+EL K  A             LH A   G   +V  +V      ++    NG TP ++   E   E +K L  + A+  +  ++G   +  A ++ HD+++  L +                              E N +V   +G T LH AA     +  Q+L++  A+++ +     SPLH+A K         L+S G  ID R     TP H A+  G  + +  L+  GA I A    G    H A +G H +     L H   VD++ 
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAAT-RKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVT 356          

HSP 8 Score: 77.411 bits (189), Expect = 1.586e-14
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  607 GELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            G+LE +  L     D    + NG+  +H ASK  H +++R L   +  ++     G TALH A++      + +LV+  A+++++   G +PL++AA+ N  E ++YL+  G    +    G TP  +A  QG    +  LL+N
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 9 Score: 72.4034 bits (176), Expect = 5.366e-13
Identity = 70/307 (22.80%), Postives = 114/307 (37.13%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV-----------------------------KCNADISIEDNE----GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  YGH N+ + L + GA+  Y+   N   PLH A  +G  ++   ++++    IDS   + LTP                                 +H A++  HD+++  L      I+ +   G   LH AA  +   A + L+                             K   D S + N     G +PLH+A K N ++ +  L+     I+     G TP H+A+F G    + +LL  GA+       G T  H A R    + +   + +   VD   +  +     A R G
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNIS-PLHVATKWGRTNMANLLLSRGA-IIDSRTKDLLTP---------------------------------LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG 502          

HSP 10 Score: 60.077 bits (144), Expect = 3.234e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNG 1143
            L++A +  H  +VK L K+GA+       +   PL  A   G+  +V  ++       DS     L   HI   + +     +L   + +  V  K+G   +H A+   H+ + + L +   N+N Q     + LH A      +   +L+   A I     +  +PLH AA+    + +  LV  G PI  +   G  P H+A+ QG H +    LL + A +  V  +  T  H A   GH       L+ + 
Sbjct:  136 LYMAAQENHEEVVKYLLKHGANQALST-EDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAA-QGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSA 383          

HSP 11 Score: 52.7582 bits (125), Expect = 6.248e-7
Identity = 47/180 (26.11%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWDQLHA 1299
            G  +   AA       +  L++   DI+  +  G + LHLA+K    E +R L+     +D    +G T  HIAS  G    +  L++NGA++      G T  + A +  H E +   L H  +     + G      A + GH     V+ E   K +V   +  L I  +K D   A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV--RLPALHIAAKKDDTTAA 210          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 119.398 bits (298), Expect = 6.519e-28
Identity = 82/278 (29.50%), Postives = 127/278 (45.68%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRF----IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH A + GH  +V  L   GA    K   N   PLH A    ++D      A++L +    +D +  + LTP H+    G +   K+L +  AD   +  NG   +H A K+N  K++  L      I    ++G T LH AA   + + +  L++  A+  +E   G +PLHLAA+ N  + +R L+  G  +D +    +TP HIAS  G  + +  LL  GA+  A   +  +  H A + G  E     L+HN     + K G      A +YG
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVD-----AARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG 568          

HSP 2 Score: 112.464 bits (280), Expect = 1.146e-25
Identity = 73/260 (28.08%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  355 KFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCF 1128
            K ++ + G   LH+A KYG+L +V+ L + G     +   NQ  PLH A  + N D V  ++ ++     +   NG TP HI   + ++E    L  + AD   K + G   +H +++  H +I   L +   ++  + + G TA+H  A  +     Q+L    A+I+ + N G +PLH+A     L  +++LV  G  +  +     TP H A+ QG + C+ +LL+NGA        G T    A R G+   +   
Sbjct:  550 KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 106.686 bits (265), Expect = 7.655e-24
Identity = 73/281 (25.98%), Postives = 130/281 (46.26%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A +    ++V+ L + GA    +    Q  PLH A   GN D+V  ++ ++    ++   +  +P HI   EG+ E   IL +++AD T+  K G   +H ASK  + +++R L +    ++++     T LH AA  N+     +L++  A        G +PLH+AAK N +E    L+      + +   G TP H+++ +G  E    L++NG+D+ A  + G T  H   +  H        N+   ++     G      A  +G 
Sbjct:  456 VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIV-ILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ 734          

HSP 4 Score: 103.99 bits (258), Expect = 6.631e-23
Identity = 80/320 (25.00%), Postives = 139/320 (43.44%), Query Frame = 1
Query:  265 VKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
             + L+ P+      GN D V   L++  N     + +   LH+A K G   +   L  + AD           PLH A  +GN+++V  ++ +    +D    N +TP H+       +   +L    A      KNG   +H A+K+N  +I   L   + + N +   G T LH +A         +L++  +D+  + N G + +HL A+ + +   + L + G  I+ + N G TP H+A   G    + +L++NGAD+        T  H A + GH   +   L +  S +E    G+     A+R G+  + E
Sbjct:  488 ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL-LTKKGFTPLHLASKYGNLEVVRLLLERGTP-VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVE 805          

HSP 5 Score: 102.834 bits (255), Expect = 1.447e-22
Identity = 79/308 (25.65%), Postives = 127/308 (41.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKC---------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH+ + K L    AD   +   N   PLH AC    I +VE ++ K    I++   +GLTP H+    G +  +  L    A+  V+   G   +H A++ N   ++R L      ++ Q    +T LH A+   +   + +L++                                  NAD ++   +G +PLHLA+K+ +LE +R L+  G P+DI      TP H+A+     +    LL+NGA   A    G T  H A +    E     L      +  ++ G      + + GH
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 6 Score: 96.6709 bits (239), Expect = 1.444e-20
Identity = 80/306 (26.14%), Postives = 140/306 (45.75%), Query Frame = 1
Query:  250 IYNFFVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            I +   K L  P+     SG+ D V   L  +G       ++GL  LH+A +  H++  + L  + A   D    Y      PLH A   G++ + + ++ +S    +S   NG TP HI   +  ++ +++L  Y A      ++G+  +H A+      I+ YL     N +V+   G+T LH AA  N    +++L++  A +  +  E  +PLH+A++  + + +  L+  G   +       +P HIA+ +G  E    LLD+ AD   +  +G T  H A + G+ E +   L     VD
Sbjct:  285 IIDSRTKDLLTPLHCAARSGH-DQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY----LTPLHVAAHCGHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD 584          

HSP 7 Score: 85.1149 bits (209), Expect = 5.089e-17
Identity = 74/289 (25.61%), Postives = 116/289 (40.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDL-----------------------------EININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            LH+A K GH  +V+EL K  A             LH A   G   +V  +V      ++    NG TP ++   E   E +K L  + A+  +  ++G   +  A ++ HD+++  L +                              E N +V   +G T LH AA     +  Q+L++  A+++ +     SPLH+A K         L+S G  ID R     TP H A+  G  + +  L+  GA I A    G    H A +G H +     L H   VD++ 
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAAT-RKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVT 356          

HSP 8 Score: 77.0258 bits (188), Expect = 1.811e-14
Identity = 42/144 (29.17%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  607 GELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            G+LE +  L     D    + NG+  +H ASK  H +++R L   +  ++     G TALH A++      + +LV+  A+++++   G +PL++AA+ N  E ++YL+  G    +    G TP  +A  QG    +  LL+N
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 9 Score: 72.4034 bits (176), Expect = 5.426e-13
Identity = 70/307 (22.80%), Postives = 114/307 (37.13%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV-----------------------------KCNADISIEDNE----GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  YGH N+ + L + GA+  Y+   N   PLH A  +G  ++   ++++    IDS   + LTP                                 +H A++  HD+++  L      I+ +   G   LH AA  +   A + L+                             K   D S + N     G +PLH+A K N ++ +  L+     I+     G TP H+A+F G    + +LL  GA+       G T  H A R    + +   + +   VD   +  +     A R G
Sbjct:  231 LHIAAHYGHENVGQLLLEKGANVNYQARHNIS-PLHVATKWGRTNMANLLLSRGA-IIDSRTKDLLTP---------------------------------LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG 502          

HSP 10 Score: 60.077 bits (144), Expect = 3.354e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNG 1143
            L++A +  H  +VK L K+GA+       +   PL  A   G+  +V  ++       DS     L   HI   + +     +L   + +  V  K+G   +H A+   H+ + + L +   N+N Q     + LH A      +   +L+   A I     +  +PLH AA+    + +  LV  G PI  +   G  P H+A+ QG H +    LL + A +  V  +  T  H A   GH       L+ + 
Sbjct:  136 LYMAAQENHEEVVKYLLKHGANQALST-EDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAA-QGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSA 383          

HSP 11 Score: 52.7582 bits (125), Expect = 7.427e-7
Identity = 47/180 (26.11%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWDQLHA 1299
            G  +   AA       +  L++   DI+  +  G + LHLA+K    E +R L+     +D    +G T  HIAS  G    +  L++NGA++      G T  + A +  H E +   L H  +     + G      A + GH     V+ E   K +V   +  L I  +K D   A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV--RLPALHIAAKKDDTTAA 210          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 127.872 bits (320), Expect = 1.266e-30
Identity = 94/315 (29.84%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  277 KHPISSL-VAS--GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            KH IS L VA+  G  + V+  L+  GN++    RDGL  LH A + GH  +V  L + GA    K   N   PLH A    ++D    ++      +D +  + LT  H+    G +   K+L + +AD   +  NG   +H A K+N  K++  L     +I+   ++G T LH AA     + +  L++ +A   +    G +PLHLAA+ N  + +R L+  G  +D R    +TP HIAS  G  + +  LL +GA + A   +  T  H A + G  E     + +  ++D   K G        +YGH
Sbjct:  236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAP-VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 2 Score: 100.138 bits (248), Expect = 1.405e-21
Identity = 79/315 (25.08%), Postives = 131/315 (41.59%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLD---------------------------------NGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG-ENLYQTARRYGH 1206
            V+ +  LH+A +    +I++ L + GA    +    Q+ PLH A   GN+D+V  ++    + +D+   +  T  HI   EG+ E   +L    A      K G   +H  +K  H K+ + L   E +++ Q   G T LH A   N+     +L++  A        G +PLH+AA+ N ++    L+  G   +     G TP H++S +G  E  + L++                                 NGA+I      G T  H A   G    +   L +  +VD    +G   L+QTA++ GH
Sbjct:  434 VRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQ-GH 745          

HSP 3 Score: 99.7525 bits (247), Expect = 1.783e-21
Identity = 79/311 (25.40%), Postives = 132/311 (42.44%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            GN+D V   L+    V    +     LH+A K G   +   L + GA  D   K       PLH    +G+I + + ++ K    +D+   NG+TP H+       +   +L    A      KNG   +H A+++N   I   L +     N +   G T LH ++         +L++  A ++     G +P+HL A+ +++     L   G  ID+    G TP H+AS  G    + +LL NGA++ A    G T  H   + GH   ++  L H  + +     G+     AR+ G+  + +  K
Sbjct:  480 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATK---KGFTPLHLTAKYGHIKVAQLLLQKEAD-VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK 786          

HSP 4 Score: 95.5153 bits (236), Expect = 4.074e-20
Identity = 80/319 (25.08%), Postives = 142/319 (44.51%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEI-----------------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GN++ V  +LK+  ++      +GL  LH+A K GH+++V EL + GA  D   K  +     LH A   G  ++V+ ++  +   ++    NG TP ++   E     +++L +  A+ ++  ++G   +  A ++ HDK++  L + +                              N +V   +G T LH A+   + +   +L++  AD++       SPLH+AAK      +  L+  G  I+ +   G TP H A+  G  + +  LL+ GA I A    G    H A +G H +     L H   VDE+ 
Sbjct:   21 AGNLERVLEHLKNNIDIN-TSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA---LHIASLAGQEEVVKLLLEHNAS-VNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVT 334          

HSP 5 Score: 88.5817 bits (218), Expect = 5.821e-18
Identity = 68/264 (25.76%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            LHVA   G +NIV  L ++  D     P+ +   PLH A      D++  ++    + +D+      TP HI    G ++ + +L  + A      K+    +H A+K   D++   L +    ++     G T LH  A        Q+L++  AD+  +   G +PLH+A  +N+ +    L+  G         G TP HIA+ +   +    LL+ GA   A    G T  H + + GH E  +  + H  +V+   K G
Sbjct:  407 LHVAAFMGCMNIVIYLLQH--DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG 667          

HSP 6 Score: 67.781 bits (164), Expect = 2.171e-11
Identity = 55/208 (26.44%), Postives = 94/208 (45.19%), Query Frame = 1
Query:  607 GELE-CLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIG-------HYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            G LE  L+ LKN + D    + NG+  +H ASK  H  ++  L      ++     G TALH A++      +++L++ NA ++++   G +PL++AA+ N    +R L+S G    +    G TP  +A  QG  + +  LL           E +T G       H A +    +     L+++ + D  +K G      A  YG+
Sbjct:   22 GNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL-----------ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN 217          

HSP 7 Score: 49.6766 bits (117), Expect = 6.851e-6
Identity = 37/145 (25.52%), Postives = 62/145 (42.76%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            G T+   AA   +   +   +K N DI+  +  G + LHLA+K   +  +  L+  G  +D    +G T  HIAS  G  E +  LL++ A +      G T  + A +  H   +   L++  +     + G      A + GH
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344222)

HSP 1 Score: 127.872 bits (320), Expect = 1.367e-30
Identity = 94/315 (29.84%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  277 KHPISSL-VAS--GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            KH IS L VA+  G  + V+  L+  GN++    RDGL  LH A + GH  +V  L + GA    K   N   PLH A    ++D    ++      +D +  + LT  H+    G +   K+L + +AD   +  NG   +H A K+N  K++  L     +I+   ++G T LH AA     + +  L++ +A   +    G +PLHLAA+ N  + +R L+  G  +D R    +TP HIAS  G  + +  LL +GA + A   +  T  H A + G  E     + +  ++D   K G        +YGH
Sbjct:  236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAP-VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 2 Score: 99.7525 bits (247), Expect = 1.608e-21
Identity = 79/315 (25.08%), Postives = 131/315 (41.59%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLD---------------------------------NGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG-ENLYQTARRYGH 1206
            V+ +  LH+A +    +I++ L + GA    +    Q+ PLH A   GN+D+V  ++    + +D+   +  T  HI   EG+ E   +L    A      K G   +H  +K  H K+ + L   E +++ Q   G T LH A   N+     +L++  A        G +PLH+AA+ N ++    L+  G   +     G TP H++S +G  E  + L++                                 NGA+I      G T  H A   G    +   L +  +VD    +G   L+QTA++ GH
Sbjct:  434 VRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQ-GH 745          

HSP 3 Score: 99.7525 bits (247), Expect = 1.868e-21
Identity = 79/311 (25.40%), Postives = 132/311 (42.44%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            GN+D V   L+    V    +     LH+A K G   +   L + GA  D   K       PLH    +G+I + + ++ K    +D+   NG+TP H+       +   +L    A      KNG   +H A+++N   I   L +     N +   G T LH ++         +L++  A ++     G +P+HL A+ +++     L   G  ID+    G TP H+AS  G    + +LL NGA++ A    G T  H   + GH   ++  L H  + +     G+     AR+ G+  + +  K
Sbjct:  480 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATK---KGFTPLHLTAKYGHIKVAQLLLQKEAD-VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK 786          

HSP 4 Score: 95.5153 bits (236), Expect = 4.191e-20
Identity = 80/319 (25.08%), Postives = 142/319 (44.51%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEI-----------------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GN++ V  +LK+  ++      +GL  LH+A K GH+++V EL + GA  D   K  +     LH A   G  ++V+ ++  +   ++    NG TP ++   E     +++L +  A+ ++  ++G   +  A ++ HDK++  L + +                              N +V   +G T LH A+   + +   +L++  AD++       SPLH+AAK      +  L+  G  I+ +   G TP H A+  G  + +  LL+ GA I A    G    H A +G H +     L H   VDE+ 
Sbjct:   21 AGNLERVLEHLKNNIDIN-TSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA---LHIASLAGQEEVVKLLLEHNAS-VNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVT 334          

HSP 5 Score: 88.5817 bits (218), Expect = 6.645e-18
Identity = 68/264 (25.76%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            LHVA   G +NIV  L ++  D     P+ +   PLH A      D++  ++    + +D+      TP HI    G ++ + +L  + A      K+    +H A+K   D++   L +    ++     G T LH  A        Q+L++  AD+  +   G +PLH+A  +N+ +    L+  G         G TP HIA+ +   +    LL+ GA   A    G T  H + + GH E  +  + H  +V+   K G
Sbjct:  407 LHVAAFMGCMNIVIYLLQH--DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG 667          

HSP 6 Score: 67.781 bits (164), Expect = 1.890e-11
Identity = 55/208 (26.44%), Postives = 94/208 (45.19%), Query Frame = 1
Query:  607 GELE-CLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIG-------HYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            G LE  L+ LKN + D    + NG+  +H ASK  H  ++  L      ++     G TALH A++      +++L++ NA ++++   G +PL++AA+ N    +R L+S G    +    G TP  +A  QG  + +  LL           E +T G       H A +    +     L+++ + D  +K G      A  YG+
Sbjct:   22 GNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL-----------ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN 217          

HSP 7 Score: 50.0618 bits (118), Expect = 6.487e-6
Identity = 37/145 (25.52%), Postives = 62/145 (42.76%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            G T+   AA   +   +   +K N DI+  +  G + LHLA+K   +  +  L+  G  +D    +G T  HIAS  G  E +  LL++ A +      G T  + A +  H   +   L++  +     + G      A + GH
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 127.872 bits (320), Expect = 1.414e-30
Identity = 94/315 (29.84%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  277 KHPISSL-VAS--GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            KH IS L VA+  G  + V+  L+  GN++    RDGL  LH A + GH  +V  L + GA    K   N   PLH A    ++D    ++      +D +  + LT  H+    G +   K+L + +AD   +  NG   +H A K+N  K++  L     +I+   ++G T LH AA     + +  L++ +A   +    G +PLHLAA+ N  + +R L+  G  +D R    +TP HIAS  G  + +  LL +GA + A   +  T  H A + G  E     + +  ++D   K G        +YGH
Sbjct:  236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAP-VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 2 Score: 100.138 bits (248), Expect = 1.508e-21
Identity = 79/315 (25.08%), Postives = 131/315 (41.59%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLD---------------------------------NGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG-ENLYQTARRYGH 1206
            V+ +  LH+A +    +I++ L + GA    +    Q+ PLH A   GN+D+V  ++    + +D+   +  T  HI   EG+ E   +L    A      K G   +H  +K  H K+ + L   E +++ Q   G T LH A   N+     +L++  A        G +PLH+AA+ N ++    L+  G   +     G TP H++S +G  E  + L++                                 NGA+I      G T  H A   G    +   L +  +VD    +G   L+QTA++ GH
Sbjct:  434 VRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQ-GH 745          

HSP 3 Score: 99.3673 bits (246), Expect = 2.204e-21
Identity = 79/311 (25.40%), Postives = 132/311 (42.44%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            GN+D V   L+    V    +     LH+A K G   +   L + GA  D   K       PLH    +G+I + + ++ K    +D+   NG+TP H+       +   +L    A      KNG   +H A+++N   I   L +     N +   G T LH ++         +L++  A ++     G +P+HL A+ +++     L   G  ID+    G TP H+AS  G    + +LL NGA++ A    G T  H   + GH   ++  L H  + +     G+     AR+ G+  + +  K
Sbjct:  480 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATK---KGFTPLHLTAKYGHIKVAQLLLQKEAD-VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK 786          

HSP 4 Score: 95.5153 bits (236), Expect = 4.109e-20
Identity = 80/319 (25.08%), Postives = 142/319 (44.51%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEI-----------------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GN++ V  +LK+  ++      +GL  LH+A K GH+++V EL + GA  D   K  +     LH A   G  ++V+ ++  +   ++    NG TP ++   E     +++L +  A+ ++  ++G   +  A ++ HDK++  L + +                              N +V   +G T LH A+   + +   +L++  AD++       SPLH+AAK      +  L+  G  I+ +   G TP H A+  G  + +  LL+ GA I A    G    H A +G H +     L H   VDE+ 
Sbjct:   21 AGNLERVLEHLKNNIDIN-TSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA---LHIASLAGQEEVVKLLLEHNAS-VNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVT 334          

HSP 5 Score: 88.5817 bits (218), Expect = 6.348e-18
Identity = 68/264 (25.76%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            LHVA   G +NIV  L ++  D     P+ +   PLH A      D++  ++    + +D+      TP HI    G ++ + +L  + A      K+    +H A+K   D++   L +    ++     G T LH  A        Q+L++  AD+  +   G +PLH+A  +N+ +    L+  G         G TP HIA+ +   +    LL+ GA   A    G T  H + + GH E  +  + H  +V+   K G
Sbjct:  407 LHVAAFMGCMNIVIYLLQH--DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG 667          

HSP 6 Score: 67.781 bits (164), Expect = 1.953e-11
Identity = 55/208 (26.44%), Postives = 94/208 (45.19%), Query Frame = 1
Query:  607 GELE-CLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIG-------HYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            G LE  L+ LKN + D    + NG+  +H ASK  H  ++  L      ++     G TALH A++      +++L++ NA ++++   G +PL++AA+ N    +R L+S G    +    G TP  +A  QG  + +  LL           E +T G       H A +    +     L+++ + D  +K G      A  YG+
Sbjct:   22 GNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL-----------ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN 217          

HSP 7 Score: 50.0618 bits (118), Expect = 6.648e-6
Identity = 37/145 (25.52%), Postives = 62/145 (42.76%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            G T+   AA   +   +   +K N DI+  +  G + LHLA+K   +  +  L+  G  +D    +G T  HIAS  G  E +  LL++ A +      G T  + A +  H   +   L++  +     + G      A + GH
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 126.716 bits (317), Expect = 2.432e-30
Identity = 94/315 (29.84%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  277 KHPISSL-VAS--GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            KH IS L VA+  G  + V+  L+  GN++    RDGL  LH A + GH  +V  L + GA    K   N   PLH A    ++D    ++      +D +  + LT  H+    G +   K+L + +AD   +  NG   +H A K+N  K++  L     +I+   ++G T LH AA     + +  L++ +A   +    G +PLHLAA+ N  + +R L+  G  +D R    +TP HIAS  G  + +  LL +GA + A   +  T  H A + G  E     + +  ++D   K G        +YGH
Sbjct:  236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAP-VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 2 Score: 100.523 bits (249), Expect = 7.914e-22
Identity = 79/311 (25.40%), Postives = 132/311 (42.44%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQ-RDGLLHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            GN+D V   L+    V    +     LH+A K G   +   L + GA  D   K       PLH    +G+I + + ++ K    +D+   NG+TP H+       +   +L    A      KNG   +H A+++N   I   L +     N +   G T LH ++         +L++  A ++     G +P+HL A+ +++     L   G  ID+    G TP H+AS  G    + +LL NGA++ A    G T  H   + GH   ++  L H  + +     G+     AR+ G+  + +  K
Sbjct:  480 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATK---KGFTPLHLTAKYGHIKVAQLLLQKEAD-VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK 786          

HSP 3 Score: 98.9821 bits (245), Expect = 2.479e-21
Identity = 79/315 (25.08%), Postives = 131/315 (41.59%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLD---------------------------------NGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG-ENLYQTARRYGH 1206
            V+ +  LH+A +    +I++ L + GA    +    Q+ PLH A   GN+D+V  ++    + +D+   +  T  HI   EG+ E   +L    A      K G   +H  +K  H K+ + L   E +++ Q   G T LH A   N+     +L++  A        G +PLH+AA+ N ++    L+  G   +     G TP H++S +G  E  + L++                                 NGA+I      G T  H A   G    +   L +  +VD    +G   L+QTA++ GH
Sbjct:  434 VRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQ-GH 745          

HSP 4 Score: 94.7449 bits (234), Expect = 5.262e-20
Identity = 81/319 (25.39%), Postives = 141/319 (44.20%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKII-----------------------------RYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GN++ V  +LK+  ++      +GL  LH+A K GH+++V EL + GA  D   K        LH A   G  ++V+ ++  +   ++    NG TP ++   E     +++L +  A+ ++  ++G   +  A ++ HDK++                               L D + N +V   +G T LH A+   + +   +L++  AD++       SPLH+AAK      +  L+  G  I+ +   G TP H A+  G  + +  LL+ GA I A    G    H A +G H +     L H   VDE+ 
Sbjct:   21 AGNLERVLEHLKNNIDIN-TSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATK---KGNTALHIASLAGQEEVVKLLLEHNAS-VNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVT 334          

HSP 5 Score: 88.5817 bits (218), Expect = 5.034e-18
Identity = 68/264 (25.76%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            LHVA   G +NIV  L ++  D     P+ +   PLH A      D++  ++    + +D+      TP HI    G ++ + +L  + A      K+    +H A+K   D++   L +    ++     G T LH  A        Q+L++  AD+  +   G +PLH+A  +N+ +    L+  G         G TP HIA+ +   +    LL+ GA   A    G T  H + + GH E  +  + H  +V+   K G
Sbjct:  407 LHVAAFMGCMNIVIYLLQH--DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG 667          

HSP 6 Score: 49.2914 bits (116), Expect = 8.141e-6
Identity = 44/176 (25.00%), Postives = 74/176 (42.05%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            G T+   AA   +   +   +K N DI+  +  G + LHLA+K   +  +  L+  G  +D    +G T  HIAS  G  E +  LL++ A +      G T  + A +  H   +   L++  +     + G      A + GH     V+ E   + +V   +  L I  +K D
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKV--RLPALHIAAKKDD 184          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 125.946 bits (315), Expect = 4.912e-30
Identity = 94/315 (29.84%), Postives = 148/315 (46.98%), Query Frame = 1
Query:  277 KHPISSL-VAS--GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            KH IS L VA+  G  + V+  L+  GN++    RDGL  LH A + GH  +V  L + GA    K   N   PLH A    ++D    ++      +D +  + LT  H+    G +   K+L + +AD   +  NG   +H A K+N  K++  L     +I+   ++G T LH AA     + +  L++ +A   +    G +PLHLAA+ N  + +R L+  G  +D R    +TP HIAS  G  + +  LL +GA + A   +  T  H A + G  E     + +  ++D   K G        +YGH
Sbjct:  386 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAP-VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 697          

HSP 2 Score: 100.908 bits (250), Expect = 6.441e-22
Identity = 99/422 (23.46%), Postives = 168/422 (39.81%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQ-RDGLLHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK----AKKAEVVCSICQLEINKR--KWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYG 1545
            GN+D V   L+    V    +     LH+A K G   +   L + GA  D   K       PLH    +G+I + + ++ K    +D+   NG+TP H+       +   +L    A      KNG   +H A+++N   I   L +     N +   G T LH ++         +L++  A ++     G +P+HL A+ +++     L   G  ID+    G TP H+AS  G    + +LL NGA++ A    G T  H   + GH   ++  L H  + +     G+     AR+ G+  + +      K+ E   +  Q E   R    + +H            + ++  +    Y TV  D  K  G+    ID    E ++  +++      S  P  I E       ++ YG
Sbjct:  630 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATK---KGFTPLHLTAKYGHIKVAQLLLQKEAD-VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEEEGGEDNMLSDQPYRYLTV--DEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGVPPTIGEEVISPHKTQVYG 1045          

HSP 3 Score: 98.5969 bits (244), Expect = 3.552e-21
Identity = 79/315 (25.08%), Postives = 131/315 (41.59%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLD---------------------------------NGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG-ENLYQTARRYGH 1206
            V+ +  LH+A +    +I++ L + GA    +    Q+ PLH A   GN+D+V  ++    + +D+   +  T  HI   EG+ E   +L    A      K G   +H  +K  H K+ + L   E +++ Q   G T LH A   N+     +L++  A        G +PLH+AA+ N ++    L+  G   +     G TP H++S +G  E  + L++                                 NGA+I      G T  H A   G    +   L +  +VD    +G   L+QTA++ GH
Sbjct:  584 VRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQ-GH 895          

HSP 4 Score: 94.7449 bits (234), Expect = 5.330e-20
Identity = 81/319 (25.39%), Postives = 141/319 (44.20%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKII-----------------------------RYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GN++ V  +LK+  ++      +GL  LH+A K GH+++V EL + GA  D   K        LH A   G  ++V+ ++  +   ++    NG TP ++   E     +++L +  A+ ++  ++G   +  A ++ HDK++                               L D + N +V   +G T LH A+   + +   +L++  AD++       SPLH+AAK      +  L+  G  I+ +   G TP H A+  G  + +  LL+ GA I A    G    H A +G H +     L H   VDE+ 
Sbjct:  171 AGNLERVLEHLKNNIDIN-TSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATK---KGNTALHIASLAGQEEVVKLLLEHNAS-VNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVT 484          

HSP 5 Score: 88.1965 bits (217), Expect = 7.473e-18
Identity = 68/264 (25.76%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            LHVA   G +NIV  L ++  D     P+ +   PLH A      D++  ++    + +D+      TP HI    G ++ + +L  + A      K+    +H A+K   D++   L +    ++     G T LH  A        Q+L++  AD+  +   G +PLH+A  +N+ +    L+  G         G TP HIA+ +   +    LL+ GA   A    G T  H + + GH E  +  + H  +V+   K G
Sbjct:  557 LHVAAFMGCMNIVIYLLQH--DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG 817          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 120.939 bits (302), Expect = 7.482e-29
Identity = 80/281 (28.47%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK 1224
            LH+A  YG++N+   L   GA   +K   N   PLH A   GN ++V  ++ +  R ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L   E+ ++   +   TALH AA        ++LV   A+ + +   G +PLH+A K N ++ +  L+  G  I      G TP H+A+F G    +  L ++GA    +   G T  H A R G    +   + +   VD   K  +     + R G P I ++
Sbjct:  210 LHIAAHYGNINVATLLLNRGAAVDFK-ARNDITPLHVASKRGNANMVRLLLERGAR-IDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQ 488          

HSP 2 Score: 112.079 bits (279), Expect = 7.793e-26
Identity = 85/305 (27.87%), Postives = 147/305 (48.20%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +GNI+    Y+K+  ++  I  ++GL  LH+A K GH+ +V EL K GA  D   K  +     LH A   G  D+V+ +V      I++   NG TP ++   E  L+ +K L +  +  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  IE   G +PLH+AA + ++     L++ G  +D +     TP H+AS +G    +  LL+ GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   22 AGNIEKALDYIKTGVDIN-ICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNT---ALHIASLAGQADVVKELVNNGAN-INAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDHNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDH 317          

HSP 3 Score: 103.605 bits (257), Expect = 5.504e-23
Identity = 82/301 (27.24%), Postives = 131/301 (43.52%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F  + D   LHVA K G+ N+V+ L + GA    +   +   PLH     G+  +VE ++ +    + S   NGL+P H+      L C+++L +++        + +  +H A+   H K+ + L D   N N +   G T LH A   N    +++L+K  A I      G +P+H+AA       +  L + G   +    RG T  H+A+  G    + +L+ NGAD+ A   +  T  H + R G  + +   L H    D     G      A R GH
Sbjct:  217 GNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDART-KDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGH 515          

HSP 4 Score: 94.3597 bits (233), Expect = 5.202e-20
Identity = 90/344 (26.16%), Postives = 135/344 (39.24%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQN---------------------------------RGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHP--VIFEKAKKAEV 1242
            V  +L   G+ + I   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A    K +N +  +H ASKR +  ++R L +    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N                                  G TP HIA  +   + +  LL +GA I AV + G T  H A   GH   +    NH  S + +N  GE     A R G    V F  A  A+V
Sbjct:  126 VVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQND-HNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADV 463          

HSP 5 Score: 78.1814 bits (191), Expect = 8.371e-15
Identity = 47/164 (28.66%), Postives = 83/164 (50.61%), Query Frame = 1
Query:  553 IDSIDTNG--LTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            ++S D+N   L  A    +E  L+ +K       D  + ++NG+  +H ASK  H +++  L  L   ++     G TALH A++      ++ LV   A+I+ +   G +PL++AA+ N L+ +++L+  G    I    G TP  +A  QG  + +  LL+N
Sbjct:    7 VESTDSNASYLRAARAGNIEKALDYIKT----GVDINICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN 166          

HSP 6 Score: 68.5514 bits (166), Expect = 9.329e-12
Identity = 49/192 (25.52%), Postives = 84/192 (43.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDI 957
            LHVA   GH  + K L    A+   K   N   PLH AC    I ++E ++ K    I ++  +GLTP H+    G    +  L N+ A     +  G   +H A++     ++++L     +++ +    +T LH ++       +Q L++  A        G +PLHLAA+    +    L+  G  + I
Sbjct:  342 LHVAAHCGHYKVAKVLVDKRANPNAK-ALNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASLGI 531          

HSP 7 Score: 58.151 bits (139), Expect = 1.620e-8
Identity = 45/156 (28.85%), Postives = 72/156 (46.15%), Query Frame = 1
Query:  832 VKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            +K   DI+I +  G + LHLA+K   +E +  L+  G  +D    +G T  HIAS  G  + +  L++NGA+I A    G T  + A +  H + +   L++  S     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   32 IKTGVDINICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV--RLPALHIAARKDD 185          

HSP 8 Score: 51.6026 bits (122), Expect = 1.653e-6
Identity = 32/102 (31.37%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDK 669
            V+ +  LH+A + G  N+VK L   GAD   K   +Q  PLH +   G  D+V+ ++       DS  T+G TP H+   +G  +   IL +  A   +  K
Sbjct:  435 VRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQ-TPLHISSRLGKPDIVQQLLQHG-ALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASLGITTK 534          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 121.324 bits (303), Expect = 8.064e-29
Identity = 80/281 (28.47%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK 1224
            LH+A  YG++N+   L   GA   +K   N   PLH A   GN ++V  ++ +  R ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L   E+ ++   +   TALH AA        ++LV   A+ + +   G +PLH+A K N ++ +  L+  G  I      G TP H+A+F G    +  L ++GA    +   G T  H A R G    +   + +   VD   K  +     + R G P I ++
Sbjct:  238 LHIAAHYGNINVATLLLNRGAAVDFKA-RNDITPLHVASKRGNANMVRLLLERGAR-IDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQ 516          

HSP 2 Score: 112.079 bits (279), Expect = 8.002e-26
Identity = 85/305 (27.87%), Postives = 147/305 (48.20%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +GNI+    Y+K+  ++  I  ++GL  LH+A K GH+ +V EL K GA  D   K  +     LH A   G  D+V+ +V      I++   NG TP ++   E  L+ +K L +  +  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  IE   G +PLH+AA + ++     L++ G  +D +     TP H+AS +G    +  LL+ GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   50 AGNIEKALDYIKTGVDIN-ICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNTA---LHIASLAGQADVVKELVNNGAN-INAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDHNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDH 345          

HSP 3 Score: 103.605 bits (257), Expect = 5.377e-23
Identity = 82/301 (27.24%), Postives = 131/301 (43.52%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F  + D   LHVA K G+ N+V+ L + GA    +   +   PLH     G+  +VE ++ +    + S   NGL+P H+      L C+++L +++        + +  +H A+   H K+ + L D   N N +   G T LH A   N    +++L+K  A I      G +P+H+AA       +  L + G   +    RG T  H+A+  G    + +L+ NGAD+ A   +  T  H + R G  + +   L H    D     G      A R GH
Sbjct:  245 GNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDART-KDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGH 543          

HSP 4 Score: 94.3597 bits (233), Expect = 6.083e-20
Identity = 90/344 (26.16%), Postives = 135/344 (39.24%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQN---------------------------------RGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHP--VIFEKAKKAEV 1242
            V  +L   G+ + I   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A    K +N +  +H ASKR +  ++R L +    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N                                  G TP HIA  +   + +  LL +GA I AV + G T  H A   GH   +    NH  S + +N  GE     A R G    V F  A  A+V
Sbjct:  154 VVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQND-HNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADV 491          

HSP 5 Score: 68.1662 bits (165), Expect = 1.155e-11
Identity = 49/192 (25.52%), Postives = 84/192 (43.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDI 957
            LHVA   GH  + K L    A+   K   N   PLH AC    I ++E ++ K    I ++  +GLTP H+    G    +  L N+ A     +  G   +H A++     ++++L     +++ +    +T LH ++       +Q L++  A        G +PLHLAA+    +    L+  G  + I
Sbjct:  370 LHVAAHCGHYKVAKVLVDKRANPNAKA-LNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASLGI 559          

HSP 6 Score: 55.8398 bits (133), Expect = 8.155e-8
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 1
Query:  685 IHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFL 1131
            +  A   N +K + Y+    ++IN+    G  ALH A+       +  L+K  A +     +G++ LH+A+     + ++ LV+ G  I+ +   G TP ++A+ +   + + +LLDNG+      ++G T    A + GH + +   L
Sbjct:   45 LRAARAGNIEKALDYIKT-GVDINICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLL 192          

HSP 7 Score: 51.6026 bits (122), Expect = 1.775e-6
Identity = 32/102 (31.37%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDK 669
            V+ +  LH+A + G  N+VK L   GAD   K   +Q  PLH +   G  D+V+ ++       DS  T+G TP H+   +G  +   IL +  A   +  K
Sbjct:  463 VRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQ-TPLHISSRLGKPDIVQQLLQHG-ALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASLGITTK 562          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 117.472 bits (293), Expect = 4.805e-27
Identity = 79/280 (28.21%), Postives = 127/280 (45.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V  ++ +  + ID+   +GLTP H     G    +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  L+  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  218 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVHLLLDRGAQ-IDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQ 495          

HSP 2 Score: 114.39 bits (285), Expect = 4.999e-26
Identity = 90/302 (29.80%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+V  L   GA    K   +   PLH A   G+   VE ++ +    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++L+K  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      A R GH
Sbjct:  225 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKT-RDGLTPLHCAARSGHDTAVELLLERGAPML-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGH 523          

HSP 3 Score: 107.842 bits (268), Expect = 6.170e-24
Identity = 76/274 (27.74%), Postives = 120/274 (43.80%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G + +V+ L + GA    +   +Q  PLH A   G  ++V+ ++ + +   D+   NG TP HI   EG L+   +L    A  ++  K G   +H ASK    ++ + L       +     G T LH AA  ++     +L+   A        G +PLH+AAK N +E    L+  G   +I+  +G  P H+AS +G  E    LL  GA +      G T  H A +          +    ++D+  KLG      A  YG
Sbjct:  449 LHMAARAGQMEVVRCLLRNGAMVDARAREDQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYG 720          

HSP 4 Score: 107.457 bits (267), Expect = 6.626e-24
Identity = 87/320 (27.19%), Postives = 144/320 (45.00%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKF-IVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEI-----------------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GNID V  YLK  G V      ++GL  LH+A K GH+++V+EL   G+  D   K        LH A   G  D+V+ I++K    I++   NG TP ++   E  L+ ++ L     + ++  ++G   +  A ++ H++++  L + +                              N +VQ  +G T LH AA   + +   +L+   A +      G +PLH+A+K  +   +  L+  G  ID +   G TP H A+  G    +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:   30 AGNIDKVLEYLK--GGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATK---KGNTALHIASLAGQGDVVK-ILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 343          

HSP 5 Score: 107.071 bits (266), Expect = 1.072e-23
Identity = 81/279 (29.03%), Postives = 130/279 (46.59%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G++D V + L   G    +  + G   LHVA KYG L + K L +  A  D   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + ++E    L  Y A+  ++ K G+  IH AS+  H ++   L      +NV   +G T+LH AA  +     ++LVK  A++  +   G +PL +A  + + + + +L+ +G  ++ +   G TP H A+ QG    ++ LL  GA   A+   GNT    A R G+
Sbjct:  514 PLHIAAREGHLD-VTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGK---NGLTPLHVAAHYDNQKVALLLLDKGAS-PHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGY 787          

HSP 6 Score: 102.834 bits (255), Expect = 2.158e-22
Identity = 79/280 (28.21%), Postives = 124/280 (44.29%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            RDGL  LH A + GH   V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L      I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H A R GH +     L    +     K G      A +YG
Sbjct:  278 RDGLTPLHCAARSGHDTAVELLLERGAPMLART-KNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYG 555          

HSP 7 Score: 101.293 bits (251), Expect = 8.004e-22
Identity = 72/275 (26.18%), Postives = 122/275 (44.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GHL++   L + GA            PLH A  +G++++ + ++ +     DS   NGLTP H+       +   +L +  A      KNG   +H A+K+N  +I   L       N+Q   G   +H A+         +L++  A +++    G + LHLAA+ + +     LV  G  +D +   G TP  +A   G  + +++LL +GA +      G T  H A + G+   I+  L +    + I   G      ARR G+
Sbjct:  515 LHIAAREGHLDVTTVLLEAGAAHSLATKKG-FTPLHVASKYGSLEVAKLLLQRRAP-PDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGY 787          

HSP 8 Score: 98.9821 bits (245), Expect = 4.108e-21
Identity = 83/304 (27.30%), Postives = 133/304 (43.75%), Query Frame = 1
Query:  325 NSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRI--PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGS---SPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            N   KS+ N  F+         A + G+++ V E  K G D G    SNQ     LH A   G++DLV+ ++ +    +DS    G T  HI  + G+ + +KIL    A+   + +NG   ++ AS+ NH  ++RYL +   N ++  + G T L  A        + +L++        D +G      LH+AA+ +  +S   L+      D++   G TP HIA+  G       LL+ GA +      G T  H A + G+   +H  L+    +D   + G      A R GH    E
Sbjct:   13 NQPPKSDSNTSFLR--------AARAGNIDKVLEYLKGGVDIGT---SNQNGLNALHLAAKEGHVDLVQELLGRG-SSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVE 297          

HSP 9 Score: 94.7449 bits (234), Expect = 9.300e-20
Identity = 72/275 (26.18%), Postives = 119/275 (43.27%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH AA         +L++  A  S+   +G +PLH+A+K+ SLE  + L+    P D     G TP H+A+     +    LLD GA   A    G T  H A +    E     L +    +   K G      A + GH
Sbjct:  383 LHIACKKNRVKVMELLIKYGAFIQAITESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGH 655          

HSP 10 Score: 82.4185 bits (202), Expect = 6.328e-16
Identity = 80/311 (25.72%), Postives = 129/311 (41.48%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D     L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HIA+ +G  +    LL+ GA       +G T  H A + G  E     L      D   K G      A  Y
Sbjct:  283 PLHCAARSGH-DTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHY 587          

HSP 11 Score: 51.6026 bits (122), Expect = 2.684e-6
Identity = 46/174 (26.44%), Postives = 74/174 (42.53%), Query Frame = 1
Query:  778 TALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            T+   AA   +   +   +K   DI   +  G + LHLAAK   ++ ++ L+  G  +D    +G T  HIAS  G  + +  L   GA+I A    G T  + A +  H + +   L + G+     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   22 TSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKV--RLPALHIAARKDD 193          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Zebrafish
Match: ank2a (ankyrin 2a, neuronal [Source:ZFIN;Acc:ZDB-GENE-111215-3])

HSP 1 Score: 116.316 bits (290), Expect = 1.346e-26
Identity = 78/280 (27.86%), Postives = 128/280 (45.71%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN +++  ++ +  + ID+   +GLTP H     G    ++IL    A    + KNG+  +H +++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+++F G    +  LL NGA        G T  H A R G  E + C L +   VD + +  +     A R G   I +
Sbjct:  245 LHIAAHYGNVNVATLLLNRGAAVDFT-ARNGITPLHVASKRGNTNMIALLLDRGSQ-IDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAFMGHLNIVLLLLQNGASPDVCNIRGETALHMAARAGQMEVVRCLLRNGALVDAMAREDQTPLHIASRLGQTEIVQ 522          

HSP 2 Score: 107.071 bits (266), Expect = 1.247e-23
Identity = 88/310 (28.39%), Postives = 136/310 (43.87%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+      GN++ V + L + G       R+G+  LHVA K G+ N++  L   G+    K   +   PLH A   G+   VE ++ K    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D + N N +   G T LH A   N    +++LVK  A I      G +P+H++A    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A+  E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  244 PLHIAAHYGNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAK-TRDGLTPLHCAARSGHDSAVEILLEKGAPIL-ARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAFMGHLNIVLLLLQNGASPDVCNIRGETALHMAARAGQMEVVRCLLRNGALVDAMAREDQTPLHIASRLGQTEIVQLLLQHMAHPDASTTNGYTPLHISAREGQ 550          

HSP 3 Score: 103.605 bits (257), Expect = 1.321e-22
Identity = 76/275 (27.64%), Postives = 123/275 (44.73%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + G + +V+ L + GA        +Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG++E   +L    A  ++  K G   +H A+K     + + L      ++     G T LH AA  ++     ML+   A        G +PLH+AAK N  +    L+  G   +    +G +P H+AS +G  E    LL+ GA + A    G T  H   +    +       H+ ++D+  KLG      A  YG+
Sbjct:  476 LHMAARAGQMEVVRCLLRNGALVDAMAREDQ-TPLHIASRLGQTEIVQLLL-QHMAHPDASTTNGYTPLHISAREGQVETAAVLLEAGASHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRALLDDAGKYGLTPLHVAAHYDNQQVALMLLDKGASPHATAKNGYTPLHIAAKKNQTQIASALLQYGAETNALTKQGVSPLHLASQEGHTEMAALLLERGAHVNAATKSGLTPLHLTAQEDRVQAAEILAKHDANIDQQTKLGYTPLIVACHYGN 748          

HSP 4 Score: 103.219 bits (256), Expect = 2.058e-22
Identity = 82/326 (25.15%), Postives = 144/326 (44.17%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEIN-------------------------------------INVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEI 1158
            +GNI+ V  +LKS  ++     ++GL  LH+A K GH+ +V+EL + GA  D   K        LH AC  G  ++ + +V K+   ++S   NG TP ++   E  L+ ++ L     + ++  ++G   +  A ++ H++++  L + +                                       +N   ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   +  L+  G  ID +   G TP H A+  G    +  LL+ GA ILA    G +  H + +G H E +   L H   VD++
Sbjct:   49 AGNIEKVLEFLKSGQDIS-TCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTK---KGNTALHIACLAGQKEVAKLLVKKTAD-VNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEHDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDV 369          

HSP 5 Score: 96.2857 bits (238), Expect = 3.437e-20
Identity = 72/244 (29.51%), Postives = 116/244 (47.54%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            LHVA KYG L++ K L +  A  D   KY      PLH A  + N  +   ++ K      +   NG TP HI   + + +    L  Y A+     K G+  +H AS+  H ++   L +   ++N    +G T LH  A  +   A ++L K +A+I  +   G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   AV   GNT    A R G+
Sbjct:  575 LHVAAKYGSLDVAKLLLQRRALLDDAGKYGLT---PLHVAAHYDNQQVALMLLDKGAS-PHATAKNGYTPLHIAAKKNQTQIASALLQYGAETNALTKQGVSPLHLASQEGHTEMAALLLERGAHVNAATKSGLTPLHLTAQEDRVQAAEILAKHDANIDQQTKLGYTPLIVACHYGNVKMVNFLLQNGANVNGKTKNGYTPLHQAAQQGNTHIVNVLLQHGAKPNAVTMNGNTALSIAKRLGY 814          

HSP 6 Score: 94.3597 bits (233), Expect = 1.262e-19
Identity = 77/280 (27.50%), Postives = 125/280 (44.64%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            RDGL  LH A + GH + V+ L + GA    +   N   PLH +    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H +A     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D      +TP HIAS  G  E +  LL + A   A    G T  H + R G  ET    L    S     K G      A +YG
Sbjct:  305 RDGLTPLHCAARSGHDSAVEILLEKGAPILAR-TKNGLSPLHMSAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAFMGHLNIVLLLLQNGASPDVCNIRGETALHMAARAGQMEVVRCLLRNGALVDAMAREDQTPLHIASRLGQTEIVQLLLQHMAHPDASTTNGYTPLHISAREGQVETAAVLLEAGASHSLATKKGFTPLHVAAKYG 582          

HSP 7 Score: 92.4337 bits (228), Expect = 5.223e-19
Identity = 67/283 (23.67%), Postives = 120/283 (42.40%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +     L + GA            PLH A  +G++D+ + ++ +    +D     GLTP H+       +   +L +  A      KNG   +H A+K+N  +I   L       N     G + LH A+         +L++  A ++     G +PLHL A+ + +++   L      ID +   G TP  +A   G  + +++LL NGA++      G T  H A + G+   ++  L H    + +   G      A+R G+  + +  K
Sbjct:  542 LHISAREGQVETAAVLLEAGASHSLA-TKKGFTPLHVAAKYGSLDVAKLLLQRR-ALLDDAGKYGLTPLHVAAHYDNQQVALMLLDKGASPHATAKNGYTPLHIAAKKNQTQIASALLQYGAETNALTKQGVSPLHLASQEGHTEMAALLLERGAHVNAATKSGLTPLHLTAQEDRVQAAEILAKHDANIDQQTKLGYTPLIVACHYGNVKMVNFLLQNGANVNGKTKNGYTPLHQAAQQGNTHIVNVLLQHGAKPNAVTMNGNTALSIAKRLGYISVVDTLK 822          

HSP 8 Score: 90.1225 bits (222), Expect = 2.502e-18
Identity = 68/275 (24.73%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H +   G++++V  ++       D  +  G T  H+    G++E ++ L    A      +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+     +D     G TP H+A+     +    LLD GA   A    G T  H A +    +     L +    + + K G +    A + GH
Sbjct:  410 LHIACKKNRVKVMELLVKYGASIQAITESGL-TPIHVSAFMGHLNIVLLLLQNGAS-PDVCNIRGETALHMAARAGQMEVVRCLLRNGALVDAMAREDQTPLHIASRLGQTEIVQLLLQHMAHPDASTTNGYTPLHISAREGQVETAAVLLEAGASHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRALLDDAGKYGLTPLHVAAHYDNQQVALMLLDKGASPHATAKNGYTPLHIAAKKNQTQIASALLQYGAETNALTKQGVSPLHLASQEGH 682          

HSP 9 Score: 89.7373 bits (221), Expect = 3.339e-18
Identity = 77/290 (26.55%), Postives = 124/290 (42.76%), Query Frame = 1
Query:  391 ACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            A + G++  V E  K G D       N    LH A   G+++LVE ++ +    +DS    G T  HI  + G+ E  K+L    AD   + +NG   ++ A++ NH  ++RYL +   N ++  + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G+ I A   +G T  H A R GH   +   L     +
Sbjct:   46 AARAGNIEKVLEFLKSGQDIS-TCNQNGLNALHLAAKEGHVELVEELLERGAA-VDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEHDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPI 333          

HSP 10 Score: 78.5666 bits (192), Expect = 1.385e-14
Identity = 77/311 (24.76%), Postives = 132/311 (42.44%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D     L  +G       ++GL  LH++ +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH ++   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  E    LL+ GA       +G T  H A + G  +     L     +D+  K G      A  Y
Sbjct:  310 PLHCAARSGH-DSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKKAN-PNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAFMGHLNIVLLLLQNGASPDVCNIRGETALHMAARAGQMEVVRCLLRNGALVDAMAREDQTPLHIASRLGQTEIVQLLLQHMAHPDASTTNGYTPLHISAREGQVETAAVLLEAGASHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRALLDDAGKYGLTPLHVAAHY 614          

HSP 11 Score: 73.9442 bits (180), Expect = 2.976e-13
Identity = 47/158 (29.75%), Postives = 81/158 (51.27%), Query Frame = 1
Query:  565 DTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            +T+ L  A    +E  LE LK       D +  ++NG+  +H A+K  H +++  L +    ++     G TALH A +       ++LVK  AD++ +   G +PL++AA+ N L+ +RYL+  G    +    G TP  IA  QG ++ +  LL++
Sbjct:   40 NTSFLRAARAGNIEKVLEFLK----SGQDISTCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEH 193          

HSP 12 Score: 56.225 bits (134), Expect = 9.408e-8
Identity = 41/168 (24.40%), Postives = 79/168 (47.02%), Query Frame = 1
Query:  637 NYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            NY+ D T+ D N    +  A   N +K++ +L   + +I+     G  ALH AA       ++ L++  A +     +G++ LH+A      E  + LV     ++ +   G TP ++A+ +   + + +LL+NG +     ++G T    A + GH + +   L H+
Sbjct:   30 NYETD-TMSDSN-TSFLRAARAGNIEKVLEFLKSGQ-DISTCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEHD 194          

HSP 13 Score: 53.9138 bits (128), Expect = 4.814e-7
Identity = 51/190 (26.84%), Postives = 78/190 (41.05%), Query Frame = 1
Query:  739 LEININVQCDT---GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            LE   N + DT     T+   AA   +   +   +K   DIS  +  G + LHLAAK   +E +  L+  G  +D    +G T  HIA   G  E    L+   AD+ +    G T  + A +  H + +   L + G+     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   25 LERYYNYETDTMSDSNTSFLRAARAGNIEKVLEFLKSGQDISTCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEHDTKGKV--RLPALHIAARKDD 212          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 115.161 bits (287), Expect = 2.276e-26
Identity = 77/282 (27.30%), Postives = 131/282 (46.45%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKA 1227
            LH A + GH  +VK L ++ A+      +    PLH AC +G +D+VE ++ +     ++   NGLTP H+ V    L+ +K+L +         +NG   +H A+K+N  ++   L     N N +   G T LH A+       + +L+   A++++ +  G +PLHL A+   +     LV  G  +      G TP H+A   G  + + +LL   A + +    G T  H A + GH + +   L H    +EI   G +    A+R G+  + + A
Sbjct:  522 LHCAARMGHKELVKLLMEHKANPDSAT-TKGFTPLHVACKYGKVDVVELLLERGAN-PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVA 801          

HSP 2 Score: 103.99 bits (258), Expect = 8.825e-23
Identity = 74/289 (25.61%), Postives = 127/289 (43.94%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYK--------------YPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GH  + + L +  A    K              Y  + + PLH A   G+ +LV+ ++       DS  T G TP H+    G+++ +++L    A+     KNG+  +H A   N+  +++ L     + +     G TALH AA  N       L++  A+ + E  +G +PLHLA++    + +  L+S    +++    G TP H+ + +G       L+  GA + A    G T  H AC  G+ + +   L     V+   +LG      A + GH
Sbjct:  474 LHMAARAGHCEVAQFLLQNNAQVDAKAKVCQTCKMFYLHLYAFDDQTPLHCAARMGHKELVKLLMEHKAN-PDSATTKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGH 761          

HSP 3 Score: 102.064 bits (253), Expect = 3.984e-22
Identity = 78/290 (26.90%), Postives = 133/290 (45.86%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDT-NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKA 1236
            LH+A   G   +V EL  YGA+   +       PL+ A    ++++V++++        S+ T +G TP  + + +G    + +L NY      K K  +  +H A++ +  +    L   + N +V   TG T LH AA   + S  Q+L+   A+++     G +PLH+A++  ++  +R L+  G  ID +     TP H A+  G    +  LLD GA + A    G +  H A +G H + +   L +N  +D+I          A   GH     V+ +K  KA
Sbjct:  112 LHIAALAGQEKVVAELINYGANVNAQSQKGFS-PLYMAAQENHLEVVKYLLEHGAN--QSLPTEDGFTPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKA 394          

HSP 4 Score: 92.4337 bits (228), Expect = 4.149e-19
Identity = 86/355 (24.23%), Postives = 146/355 (41.13%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPS--------NQRI--------------------PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQT----ARRYGHPVI--FEKAKKAEV-----VCSICQL 1263
            V  YL   G  + +   DG   L VA + GH N+V  L  YG     + P+        + R                     PLH A  + N+ + + ++ +    ++    NG+TP HI    G +  +++L +  A    K K+ +  +H A++  H +++  L D    +  +   G + +H AA  +    ++ L++ NA+I     +  +PLH+AA       ++ L+  G   + R   G TP HIA  +     +  LL + A + AV + G T  H A   GH   +   L    S +  N    +  +T    A R GH  +  F     A+V     VC  C++
Sbjct:  156 VVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGAN-VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNS-NIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKVCQTCKM 508          

HSP 5 Score: 71.633 bits (174), Expect = 1.601e-12
Identity = 66/294 (22.45%), Postives = 123/294 (41.84%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKIL--KNYDADFTVKDKNGMQL-IHWASKRNHDKIIRYLYDLEININVQ---CDTGK------------TALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHP 1209
            LHVA   GH  +VK L   GA    +   N   PLH AC   ++  ++ ++  S   ++++  +GLTP H+    G L  +K L  +    +  +   + ++  +H A++  H ++ ++L      ++ +   C T K            T LH AA       +++L++  A+      +G +PLH+A K+  ++ +  L+  G   +     G TP H+A      + +  L+  G    +    G T  H A +    E     L +  + +  +  G      A + G P
Sbjct:  372 LHVAAHCGHHRMVKVLLDKGAKANARA-LNGFTPLHIACKKNHMRSMDLLLKHSAS-LEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKVCQTCKMFYLHLYAFDDQTPLHCAARMGHKELVKLLMEHKANPDSATTKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQP 663          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Xenopus
Match: fbxo9 (F-box protein 9 [Source:Xenbase;Acc:XB-GENE-1002447])

HSP 1 Score: 117.087 bits (292), Expect = 8.416e-28
Identity = 89/320 (27.81%), Postives = 147/320 (45.94%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKK 1233
            K  +   V  G++D VN+ L     V     R   LLH A   G L +VK L + GA    +       PLH A   G+ +L ++++ +     D ++  G TP H+    G L C+KIL    A   +KD N    + W S  +   ++ YL  L  ++  +  TG T LH +A+  +   I  L+  N DI+++D  G + LHLAA++   + ++ L+  G  ++I      TP H A+ +G+ E +  LL   A +  ++ +  T  H+A   G  +T    L     +D  + LG+     A   GH  + +  K+
Sbjct:   61 KTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLR-DVRSYTPLHRAAWTGHAELTDYLL-QCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKTLKE 378          

HSP 2 Score: 93.2041 bits (230), Expect = 9.416e-20
Identity = 68/222 (30.63%), Postives = 109/222 (49.10%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGAD 1047
            LH+A   GHL  VK L +  A    K  +N+  PL        ID++E++V+     ++   T G+T  H+  + G L+ +  L N + D  VKD NG+  +H A++  H KII+ L      +N+      T LH AA       + +L+K  A ++  D +  +PLH AA     ++   L+  G  ID +   G+TP H+A  +G  + +  L + GAD
Sbjct:  163 LHLAAANGHLLCVKILIQNKASIDIK-DNNKWTPLQWCSINDQIDVLEYLVSLGAS-LEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKTLKEWGAD 382          

HSP 3 Score: 77.0258 bits (188), Expect = 1.843e-14
Identity = 60/231 (25.97%), Postives = 100/231 (43.29%), Query Frame = 1
Query:  571 NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQL 1263
            N  T  H  V  G+++ +  L N+      +D  G  L+H A+      +++YL     ++N++     T LH AA T        L++C A   I +  G +PLHLAA +  L  ++ L+     IDI+ N   TP    S     + L +L+  GA +      G T+ H +   G+ + I+  LN N  ++  +  G      A   GH  I +   K   + +I  +
Sbjct:   59 NKKTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDI 289          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 119.398 bits (298), Expect = 1.430e-27
Identity = 84/288 (29.17%), Postives = 134/288 (46.53%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAA--------ITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  Y +LN+ + L   GA+  +  P N    LH A   GN+ +V  ++ +  + ID+   + LTP H  V  G +   +IL ++ A    K KNG+  IH AS+ +H   +R L   + +I+       T LH AA             S +++L+K  A I     +  +PLH+AA+    +   +L+     ++ R    +TP H A+  G +E +  LL+NGA        G+T  H   RGGH +T    L++  +   + K G      A +YG   I E
Sbjct:  243 LHIAAHYENLNVAQLLLNRGANVNFT-PQNGISALHIASRRGNVIMVRLLLDRGAQ-IDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAE 528          

HSP 2 Score: 96.6709 bits (239), Expect = 2.840e-20
Identity = 71/275 (25.82%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH A + GH  +V+ L + GA       +    PLH     G+    E ++        S+   G TP H+    G+++  ++L   +A      K G+  +H A   NH  I+R L +   + +     G T LH A    S    + L++  A  + +  +G +PLHLAA+    + +  L+S    + +      TP H+AS +G       L+ + A + A    G    H AC  G+ + +   L H  +V+ + KLG      A + GH
Sbjct:  449 LHCAARSGHYEMVRLLLENGAHPDPPTTAGH-TPLHLTTRGGHTQTAELLLDNQAAHT-SMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGH 721          

HSP 3 Score: 93.9745 bits (232), Expect = 2.247e-19
Identity = 71/275 (25.82%), Postives = 114/275 (41.45%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+  + GH    + L    A            PLH A  +G I + E ++ +     +S    GLTP H+ V    L  +++L N  A      +NG   +H A K+      R L       N Q   G T LH AA       + +L+   A++ + +    +PLHLA++   L     LVS    +      G  P H+A   G  + + +LL + A++ AV   G T  H A + GH + +   L +    ++ +  G      A+R G+
Sbjct:  482 LHLTTRGGHTQTAELLLDNQA-AHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAH-PNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 754          

HSP 4 Score: 87.0409 bits (214), Expect = 3.039e-17
Identity = 77/302 (25.50%), Postives = 139/302 (46.03%), Query Frame = 1
Query:  310 NIDGVNS-YLKS-EGNVKFIVQR--------------DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            N +G+N+ +L S EG+VK + +               +  LH+A   G  ++V+EL  +GA+   +   +Q+   PL+ A    ++ +V+F++       +    +G TP  + + +G    +  L +Y     +K K  +  +H A++ +  +    L   + N +V   TG T LH AA   + +  Q+L+   A+++     G S LH+A++  ++  +R L+  G  ID       TP H A   G       LLD+GA I A    G +  H A +G H + +   L +   +D+I 
Sbjct:   75 NQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQ---SQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYG----MKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDIT 368          

HSP 5 Score: 86.2705 bits (212), Expect = 5.087e-17
Identity = 78/304 (25.66%), Postives = 137/304 (45.07%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +GN+D    +L++  ++    Q +GL  LH++ K GH+ +V EL     D   +  + +    LH A   G  D+V  +V      ++S    G TP ++   E  L  +K L    A+  +  ++G   +  A ++ H+ ++ YL    I+  ++      ALH AA  +      +L++ + +  +    G +PLH+AA + +L   + L++ G  ++     G +  HIAS +G    +  LLD GA I A   +  T  H A R GH       L+H   +    K G +    A +  H
Sbjct:   55 AGNLDKALDHLRNGVDINTCNQ-NGLNALHLSSKEGHVKMVTELLH--KDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGAN-VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL----ISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDH 350          

HSP 6 Score: 78.5666 bits (192), Expect = 1.431e-14
Identity = 64/247 (25.91%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            PLH A    + D+ +F++    + +++   +  TP H     G  E +++L    A        G   +H  ++  H +    L D +         G T LH AA        ++L++  A  +     G +PLH+A  HN L  +R L++ G         G TP H+A  Q   +    LL  GA   A   +G T  H A + GHG+ +   L+   +V   NK        A + GH  I E
Sbjct:  415 PLHMAARAAHTDVADFLIQNKAK-VNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAE 660          

HSP 7 Score: 68.1662 bits (165), Expect = 2.624e-11
Identity = 59/252 (23.41%), Postives = 99/252 (39.29%), Query Frame = 1
Query:  553 IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIP-----------------------------IDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            I++ + NGL   H+   EG ++ +  L + D       K G   +H A+    + ++R L +   N+N Q   G T L+ AA  N    ++ L++  A+ ++   +G +PL +A +      + YL+S G+                               D+    G TP HIA+          LL+ GA++      G +  H A R G+   +   L+    +D   K        A R GH  I E
Sbjct:   71 INTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISE 322          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 119.398 bits (298), Expect = 1.586e-27
Identity = 84/288 (29.17%), Postives = 134/288 (46.53%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAA--------ITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  Y +LN+ + L   GA+  +  P N    LH A   GN+ +V  ++ +  + ID+   + LTP H  V  G +   +IL ++ A    K KNG+  IH AS+ +H   +R L   + +I+       T LH AA             S +++L+K  A I     +  +PLH+AA+    +   +L+     ++ R    +TP H A+  G +E +  LL+NGA        G+T  H   RGGH +T    L++  +   + K G      A +YG   I E
Sbjct:  201 LHIAAHYENLNVAQLLLNRGANVNFT-PQNGISALHIASRRGNVIMVRLLLDRGAQ-IDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAE 486          

HSP 2 Score: 96.6709 bits (239), Expect = 2.804e-20
Identity = 71/275 (25.82%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH A + GH  +V+ L + GA       +    PLH     G+    E ++        S+   G TP H+    G+++  ++L   +A      K G+  +H A   NH  I+R L +   + +     G T LH A    S    + L++  A  + +  +G +PLHLAA+    + +  L+S    + +      TP H+AS +G       L+ + A + A    G    H AC  G+ + +   L H  +V+ + KLG      A + GH
Sbjct:  407 LHCAARSGHYEMVRLLLENGAHPDPPTTAGH-TPLHLTTRGGHTQTAELLLDNQAAHT-SMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGH 679          

HSP 3 Score: 93.9745 bits (232), Expect = 2.258e-19
Identity = 71/275 (25.82%), Postives = 114/275 (41.45%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+  + GH    + L    A            PLH A  +G I + E ++ +     +S    GLTP H+ V    L  +++L N  A      +NG   +H A K+      R L       N Q   G T LH AA       + +L+   A++ + +    +PLHLA++   L     LVS    +      G  P H+A   G  + + +LL + A++ AV   G T  H A + GH + +   L +    ++ +  G      A+R G+
Sbjct:  440 LHLTTRGGHTQTAELLLDNQA-AHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAH-PNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 712          

HSP 4 Score: 87.0409 bits (214), Expect = 2.950e-17
Identity = 77/302 (25.50%), Postives = 139/302 (46.03%), Query Frame = 1
Query:  310 NIDGVNS-YLKS-EGNVKFIVQR--------------DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            N +G+N+ +L S EG+VK + +               +  LH+A   G  ++V+EL  +GA+   +   +Q+   PL+ A    ++ +V+F++       +    +G TP  + + +G    +  L +Y     +K K  +  +H A++ +  +    L   + N +V   TG T LH AA   + +  Q+L+   A+++     G S LH+A++  ++  +R L+  G  ID       TP H A   G       LLD+GA I A    G +  H A +G H + +   L +   +D+I 
Sbjct:   33 NQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQ---SQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYG----MKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDIT 326          

HSP 5 Score: 86.2705 bits (212), Expect = 5.250e-17
Identity = 78/304 (25.66%), Postives = 137/304 (45.07%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQ-RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +GN+D    +L++  ++    Q +GL  LH++ K GH+ +V EL     D   +  + +    LH A   G  D+V  +V      ++S    G TP ++   E  L  +K L    A+  +  ++G   +  A ++ H+ ++ YL    I+  ++      ALH AA  +      +L++ + +  +    G +PLH+AA + +L   + L++ G  ++     G +  HIAS +G    +  LLD GA I A   +  T  H A R GH       L+H   +    K G +    A +  H
Sbjct:   13 AGNLDKALDHLRNGVDINTCNQ-NGLNALHLSSKEGHVKMVTELLH--KDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGAN-VNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL----ISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDH 308          

HSP 6 Score: 78.5666 bits (192), Expect = 1.529e-14
Identity = 64/247 (25.91%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            PLH A    + D+ +F++    + +++   +  TP H     G  E +++L    A        G   +H  ++  H +    L D +         G T LH AA        ++L++  A  +     G +PLH+A  HN L  +R L++ G         G TP H+A  Q   +    LL  GA   A   +G T  H A + GHG+ +   L+   +V   NK        A + GH  I E
Sbjct:  373 PLHMAARAAHTDVADFLIQNKAK-VNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAE 618          

HSP 7 Score: 68.1662 bits (165), Expect = 2.953e-11
Identity = 59/252 (23.41%), Postives = 99/252 (39.29%), Query Frame = 1
Query:  553 IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIP-----------------------------IDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            I++ + NGL   H+   EG ++ +  L + D       K G   +H A+    + ++R L +   N+N Q   G T L+ AA  N    ++ L++  A+ ++   +G +PL +A +      + YL+S G+                               D+    G TP HIA+          LL+ GA++      G +  H A R G+   +   L+    +D   K        A R GH  I E
Sbjct:   29 INTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISE 280          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 117.472 bits (293), Expect = 5.864e-27
Identity = 85/318 (26.73%), Postives = 147/318 (46.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK-KAEVVCSICQLEINKRKWDQLHAPPSVIRIINQS 1332
            LH++ + GH ++   L ++GA  G         PLH A  +G I++V+ ++ K+    D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N   I   L +   + N     G   +H AA       + +L+  +A++++ +  G +PLHLAA+ + +     L + G  ID       TP H+AS  G  + + +LL +G+ + A    G T  H A + GH   I+  L H  S +E+   G      ARR G+  + +  K   E   +  QL   K K   ++ P ++  +++ S
Sbjct:  519 LHLSSREGHDDVASVLLEHGASFGI-VTKKGFTPLHVAAKYGKIEVVKLLLQKNAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVTEKHK---MNVPETMNEVLDMS 831          

HSP 2 Score: 115.931 bits (289), Expect = 2.176e-26
Identity = 84/303 (27.72%), Postives = 143/303 (47.19%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            SGN++    YLK+  ++  I  ++GL  LH+A K GH+ IV EL + GAD            LH A   G  ++V  +V      +++   NG TP ++   E  LE +K L +  A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  +E   G +PLH+AA + ++     L++ G  +D       TP H+AS +G    +  LLD G+ I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   34 SGNLEKALDYLKNGVDIN-ICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGN-TALHIASLAGQTEVVRVLVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDH 329          

HSP 3 Score: 110.923 bits (276), Expect = 7.542e-25
Identity = 78/284 (27.46%), Postives = 129/284 (45.42%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKK 1233
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + + +L +  A    K KNG+  +H A++ +H   ++ L    + ++   +   TALH AA        ++L+   A+ + +   G +PLH+A K N L+ +  L+  G  I      G TP H+A+F G    +  L  +GA        G T  H A R G  E +   L +   V+   K  +     + R G   I ++  K
Sbjct:  222 LHIAAHYGNINVATLLLNRGAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGSK-IDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLK 503          

HSP 4 Score: 106.301 bits (264), Expect = 2.787e-23
Identity = 77/280 (27.50%), Postives = 125/280 (44.64%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            RDGL  LH   + GH  +V  L   GA    K   N   PLH A    +++ V+ ++  ++  +D +  + LT  H+    G  +  K+L +  A+   K  NG   +H A K+N  K++  L     +I    ++G T +H AA     + +  L    A  +  +  G + LH+AA+    E +R+L+  G  ++ +    +TP HI++  G  + +  LL  GA   A    G T  H + R GH +     L H  S   + K G      A +YG
Sbjct:  282 RDGLTPLHCGARSGHEQVVGMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYG 559          

HSP 5 Score: 103.99 bits (258), Expect = 1.429e-22
Identity = 81/301 (26.91%), Postives = 128/301 (42.52%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F  + D   LHVA K G+ N+VK L   G+    K   +   PLH     G+  +V  ++ +    + S   NGL+P H+      L C+++L  ++        + +  +H A+   H K+ + L D + N N +   G T LH A   N    +++L+K  A I      G +P+H+AA    +  +  L   G   +    RG T  H+A+  G  E + +LL NGA + A   +  T  H + R G  + +   L      D     G      + R GH
Sbjct:  229 GNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKT-RDGLTPLHCGARSGHEQVVGMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGH 527          

HSP 6 Score: 99.7525 bits (247), Expect = 3.492e-21
Identity = 71/281 (25.27%), Postives = 123/281 (43.77%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +V+ L + GA    K   +Q  PLH +   G  D+V+ ++ K   + D+  T+G TP H+   EG  +   +L  + A F +  K G   +H A+K    ++++ L     + +    +G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G  P H+A+ +G  + +  LL   A++      G T  H A +           N    +D   K+       A  YG+
Sbjct:  447 VRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQ-TPLHISARLGKADIVQQLL-KQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGN 725          

HSP 7 Score: 94.7449 bits (234), Expect = 1.415e-19
Identity = 73/279 (26.16%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++         ++    LH A   G+  + + ++ K     ++   NG TP HI   +  L+ +++L  + A      ++G+  IH A+   H  I+  L     + N     G+TALH AA       ++ L++  A +  +  +  +PLH++A+    + ++ L+  G   D     G TP H++S +G  +    LL++GA    V  +G T  H A + G  E +   L  N S D   K G      A  Y
Sbjct:  315 KNGLSPLHMATQGDHLNCVQLLLQHNVPVD-DVTNDYLTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHY 591          

HSP 8 Score: 91.2781 bits (225), Expect = 1.514e-18
Identity = 76/297 (25.59%), Postives = 122/297 (41.08%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V  +L   G  + +   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A      +N +  +H ASKR +  +++ L D    I+ +   G T LH  A +     + ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    LLD  A+  A    G T  H AC+    + +   L H  S+  + + G      A   GH
Sbjct:  138 VVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQND-HNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 428          

HSP 9 Score: 87.8113 bits (216), Expect = 1.695e-17
Identity = 72/308 (23.38%), Postives = 117/308 (37.99%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNA---------------------------------DISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH  + K L    A+   K   N   PLH AC    + ++E ++ K    I ++  +GLTP H+    G +  +  L ++ A     +  G   +H A++    +++R+L      +  +    +T LH +A       +Q L+K  A                                    I   +G +PLH+AAK+  +E ++ L+      D     G TP H+A+     +    LLD GA        G T  H A +    +     L +    + I K G      A + GH
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACKKNRLKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGH 659          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 117.472 bits (293), Expect = 6.586e-27
Identity = 85/318 (26.73%), Postives = 147/318 (46.23%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK-KAEVVCSICQLEINKRKWDQLHAPPSVIRIINQS 1332
            LH++ + GH ++   L ++GA  G         PLH A  +G I++V+ ++ K+    D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N   I   L +   + N     G   +H AA       + +L+  +A++++ +  G +PLHLAA+ + +     L + G  ID       TP H+AS  G  + + +LL +G+ + A    G T  H A + GH   I+  L H  S +E+   G      ARR G+  + +  K   E   +  QL   K K   ++ P ++  +++ S
Sbjct:  521 LHLSSREGHDDVASVLLEHGASFGI-VTKKGFTPLHVAAKYGKIEVVKLLLQKNAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVTEKHK---MNVPETMNEVLDMS 833          

HSP 2 Score: 115.931 bits (289), Expect = 2.174e-26
Identity = 84/303 (27.72%), Postives = 143/303 (47.19%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            SGN++    YLK+  ++  I  ++GL  LH+A K GH+ IV EL + GAD            LH A   G  ++V  +V      +++   NG TP ++   E  LE +K L +  A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  +E   G +PLH+AA + ++     L++ G  +D       TP H+AS +G    +  LLD G+ I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   36 SGNLEKALDYLKNGVDIN-ICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTA-LHIASLAGQTEVVRVLVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDH 331          

HSP 3 Score: 110.923 bits (276), Expect = 7.602e-25
Identity = 78/284 (27.46%), Postives = 129/284 (45.42%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKK 1233
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + + +L +  A    K KNG+  +H A++ +H   ++ L    + ++   +   TALH AA        ++L+   A+ + +   G +PLH+A K N L+ +  L+  G  I      G TP H+A+F G    +  L  +GA        G T  H A R G  E +   L +   V+   K  +     + R G   I ++  K
Sbjct:  224 LHIAAHYGNINVATLLLNRGAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGSK-IDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLK 505          

HSP 4 Score: 106.301 bits (264), Expect = 2.808e-23
Identity = 77/280 (27.50%), Postives = 125/280 (44.64%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            RDGL  LH   + GH  +V  L   GA    K   N   PLH A    +++ V+ ++  ++  +D +  + LT  H+    G  +  K+L +  A+   K  NG   +H A K+N  K++  L     +I    ++G T +H AA     + +  L    A  +  +  G + LH+AA+    E +R+L+  G  ++ +    +TP HI++  G  + +  LL  GA   A    G T  H + R GH +     L H  S   + K G      A +YG
Sbjct:  284 RDGLTPLHCGARSGHEQVVGMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYG 561          

HSP 5 Score: 103.99 bits (258), Expect = 1.260e-22
Identity = 81/301 (26.91%), Postives = 128/301 (42.52%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F  + D   LHVA K G+ N+VK L   G+    K   +   PLH     G+  +V  ++ +    + S   NGL+P H+      L C+++L  ++        + +  +H A+   H K+ + L D + N N +   G T LH A   N    +++L+K  A I      G +P+H+AA    +  +  L   G   +    RG T  H+A+  G  E + +LL NGA + A   +  T  H + R G  + +   L      D     G      + R GH
Sbjct:  231 GNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKT-RDGLTPLHCGARSGHEQVVGMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGH 529          

HSP 6 Score: 99.3673 bits (246), Expect = 3.946e-21
Identity = 71/281 (25.27%), Postives = 123/281 (43.77%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +V+ L + GA    K   +Q  PLH +   G  D+V+ ++ K   + D+  T+G TP H+   EG  +   +L  + A F +  K G   +H A+K    ++++ L     + +    +G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G  P H+A+ +G  + +  LL   A++      G T  H A +           N    +D   K+       A  YG+
Sbjct:  449 VRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQ-TPLHISARLGKADIVQQLL-KQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGN 727          

HSP 7 Score: 94.7449 bits (234), Expect = 1.425e-19
Identity = 73/279 (26.16%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++         ++    LH A   G+  + + ++ K     ++   NG TP HI   +  L+ +++L  + A      ++G+  IH A+   H  I+  L     + N     G+TALH AA       ++ L++  A +  +  +  +PLH++A+    + ++ L+  G   D     G TP H++S +G  +    LL++GA    V  +G T  H A + G  E +   L  N S D   K G      A  Y
Sbjct:  317 KNGLSPLHMATQGDHLNCVQLLLQHNVPVD-DVTNDYLTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHY 593          

HSP 8 Score: 91.6633 bits (226), Expect = 1.268e-18
Identity = 76/297 (25.59%), Postives = 122/297 (41.08%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V  +L   G  + +   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A      +N +  +H ASKR +  +++ L D    I+ +   G T LH  A +     + ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    LLD  A+  A    G T  H AC+    + +   L H  S+  + + G      A   GH
Sbjct:  140 VVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQND-HNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 430          

HSP 9 Score: 87.8113 bits (216), Expect = 1.862e-17
Identity = 72/308 (23.38%), Postives = 117/308 (37.99%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNA---------------------------------DISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LHVA   GH  + K L    A+   K   N   PLH AC    + ++E ++ K    I ++  +GLTP H+    G +  +  L ++ A     +  G   +H A++    +++R+L      +  +    +T LH +A       +Q L+K  A                                    I   +G +PLH+AAK+  +E ++ L+      D     G TP H+A+     +    LLD GA        G T  H A +    +     L +    + I K G      A + GH
Sbjct:  356 LHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACKKNRLKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGH 661          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 120.553 bits (301), Expect = 4.556e-28
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  233 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 510          

HSP 2 Score: 115.161 bits (287), Expect = 2.566e-26
Identity = 107/418 (25.60%), Postives = 171/418 (40.91%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEID---RKNIETINIG------KISSQKVKKSSTPHRIEEGGYREL 1527
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    +     NGL+P H+      +EC+K L  Y A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G   +     +A    S+      K+ +  LH                       Y ++  D  K+  +R+   D   +  +  +++       K++   ++K ++PH   + GY  L
Sbjct:  240 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERKAPLLARTK-NGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLA----TKKGFTPLHVA-------------------AKYGSL--DVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPL 629          

HSP 3 Score: 108.997 bits (271), Expect = 2.533e-24
Identity = 82/279 (29.39%), Postives = 128/279 (45.88%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+     K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  529 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 802          

HSP 4 Score: 107.071 bits (266), Expect = 9.231e-24
Identity = 76/274 (27.74%), Postives = 121/274 (44.16%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +    +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG
Sbjct:  464 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYG 735          

HSP 5 Score: 99.3673 bits (246), Expect = 2.417e-21
Identity = 73/283 (25.80%), Postives = 120/283 (42.40%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA            PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N     G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  530 LHISAREGQVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRR-AAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 810          

HSP 6 Score: 98.5969 bits (244), Expect = 4.611e-21
Identity = 81/288 (28.12%), Postives = 137/288 (47.57%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFL 1131
            +GN+D V  YLK   ++    Q +GL  LH+A K GH+ +V+EL   G+  D   K        LH A   G  ++V+ +V +    I++   NG TP ++   E  ++ +K L    A+ +   ++G   +  A ++ H++ +  L + +    V+      ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L
Sbjct:   37 AGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSSVDSATK---KGNTALHIASLAGQAEVVKVLVKEGAN-INAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL 315          

HSP 7 Score: 95.5153 bits (236), Expect = 4.192e-20
Identity = 69/275 (25.09%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  398 LHIACKKNRIKVMELLVKYGASIQAITESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGH 670          

HSP 8 Score: 90.5077 bits (223), Expect = 2.010e-18
Identity = 86/350 (24.57%), Postives = 135/350 (38.57%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIV-------AKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPID---------------------------------IRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+       +ID V  YL   G  +     DG   L VA + GH   V  L +       + P+     LH A    +      ++        +S   ++    +G TP HI    G +    +L N  A      +NG+  +H ASKR +  +++ L D    I+ +   G T LH AA +     +++L++  A +      G SPLH+AA+ + +E +++L+    P+D                                  R   G TP HIA  +   + +  L+  GA I A+ + G T  H A   GH   +   L +  S D  N  GE     A R G 
Sbjct:  129 PLYMAAQENHID-VVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPA-----LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQ 472          

HSP 9 Score: 61.6178 bits (148), Expect = 1.876e-9
Identity = 41/153 (26.80%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  682 LIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
             +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   31 FLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 182          

HSP 10 Score: 51.2174 bits (121), Expect = 3.064e-6
Identity = 49/180 (27.22%), Postives = 77/180 (42.78%), Query Frame = 1
Query:  760 QCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            Q D+  + L  A   N    ++ L K   DI+  +  G + LHLAAK   +  ++ L+  G  +D    +G T  HIAS  G  E +  L+  GA+I A    G T  + A +  H + +   L +  +     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   24 QSDSNASFLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV--RLPALHIAARKDD 200          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 120.168 bits (300), Expect = 5.963e-28
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  216 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 493          

HSP 2 Score: 114.775 bits (286), Expect = 2.962e-26
Identity = 107/418 (25.60%), Postives = 172/418 (41.15%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEID---RKNIETINIG------KISSQKVKKSSTPHRIEEGGYREL 1527
            GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  Y A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G   +     +A    S+      K+ +  LH                       Y ++  D  K+  +R+   D   +  +  +++       K++   ++K ++PH   + GY  L
Sbjct:  223 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERKAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLA----TKKGFTPLHVA-------------------AKYGSL--DVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPL 612          

HSP 3 Score: 108.612 bits (270), Expect = 2.628e-24
Identity = 82/279 (29.39%), Postives = 128/279 (45.88%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+     K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  512 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 785          

HSP 4 Score: 106.686 bits (265), Expect = 1.145e-23
Identity = 76/274 (27.74%), Postives = 121/274 (44.16%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +    +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG
Sbjct:  447 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYG 718          

HSP 5 Score: 99.3673 bits (246), Expect = 2.449e-21
Identity = 73/284 (25.70%), Postives = 123/284 (43.31%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N     G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  513 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRR-AAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 793          

HSP 6 Score: 95.1301 bits (235), Expect = 6.211e-20
Identity = 69/275 (25.09%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  381 LHIACKKNRIKVMELLVKYGASIQAITESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGH 653          

HSP 7 Score: 92.0485 bits (227), Expect = 5.231e-19
Identity = 79/302 (26.16%), Postives = 129/302 (42.72%), Query Frame = 1
Query:  337 KSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFL 1131
            KS+ N  F+         A + G+L+ V E  K G D       N    LH A   G++ LV+ ++ +    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L
Sbjct:    7 KSDSNASFLR--------AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRG-SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL 298          

HSP 8 Score: 89.7373 bits (221), Expect = 3.004e-18
Identity = 86/350 (24.57%), Postives = 135/350 (38.57%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIV-------AKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPID---------------------------------IRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+       +ID V  YL   G  +     DG   L VA + GH   V  L +       + P+     LH A    +      ++        +S   ++    +G TP HI    G +    +L N  A      +NG+  +H ASKR +  +++ L D    I+ +   G T LH AA +     +++L++  A +      G SPLH+AA+ + +E +++L+    P+D                                  R   G TP HIA  +   + +  L+  GA I A+ + G T  H A   GH   +   L +  S D  N  GE     A R G 
Sbjct:  112 PLYMAAQENHID-VVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPA-----LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQ 455          

HSP 9 Score: 62.003 bits (149), Expect = 1.357e-9
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:    7 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 165          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 119.013 bits (297), Expect = 1.836e-27
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  237 LHIAAHYGNVNVATLLLNRGAAVDFT-ARNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 514          

HSP 2 Score: 112.079 bits (279), Expect = 2.707e-25
Identity = 91/310 (29.35%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+      GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  Y A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  236 PLHIAAHYGNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAK-TRDGLTPLHCAARSGHDQVVELLLERKAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 542          

HSP 3 Score: 107.842 bits (268), Expect = 6.417e-24
Identity = 82/279 (29.39%), Postives = 128/279 (45.88%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+     K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  533 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 806          

HSP 4 Score: 103.99 bits (258), Expect = 1.269e-22
Identity = 76/275 (27.64%), Postives = 122/275 (44.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +    +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG+
Sbjct:  468 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGN 740          

HSP 5 Score: 98.9821 bits (245), Expect = 4.931e-21
Identity = 73/284 (25.70%), Postives = 123/284 (43.31%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N     G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  534 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 814          

HSP 6 Score: 92.0485 bits (227), Expect = 6.539e-19
Identity = 69/275 (25.09%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++       D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  402 LHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGH 674          

HSP 7 Score: 92.0485 bits (227), Expect = 7.263e-19
Identity = 79/315 (25.08%), Postives = 129/315 (40.95%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFL 1131
            +GN+D V  YLK   ++     ++GL  LH+A K GH+ +V+EL   G+                                    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L
Sbjct:   41 AGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSS-----------------------------------VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL 319          

HSP 8 Score: 88.1965 bits (217), Expect = 1.312e-17
Identity = 79/317 (24.92%), Postives = 131/317 (41.32%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIV-------AKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+       +ID V  YL   G  +     DG   L VA + GH   V  L +       + P+     LH A    +      ++        +S   ++    +G TP HI    G +    +L N  A      +NG+  +H ASKR +  +++ L D    I+ +   G T LH AA +     +++L++  A +      G SPLH+AA+ + +E +++L+    P+D       T  H+A+  G +     LLD  A+  A    G T  H AC+    + +   + +  S+  I + G      A   GH
Sbjct:  133 PLYMAAQENHID-VVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPA-----LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGH 443          

HSP 9 Score: 82.4185 bits (202), Expect = 8.417e-16
Identity = 73/282 (25.89%), Postives = 122/282 (43.26%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  H+  VK L +Y A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  330 KNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 606          

HSP 10 Score: 63.1586 bits (152), Expect = 6.926e-10
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   28 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 186          

HSP 11 Score: 50.8322 bits (120), Expect = 5.341e-6
Identity = 48/180 (26.67%), Postives = 77/180 (42.78%), Query Frame = 1
Query:  760 QCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            + D+  + L  A   N    ++ L K   DI+  +  G + LHLAAK   +  ++ L+  G  +D    +G T  HIAS  G  E +  L+  GA+I A    G T  + A +  H + +   L +  +     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   28 KSDSNASFLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV--RLPALHIAARKDD 204          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 117.857 bits (294), Expect = 3.585e-27
Identity = 77/283 (27.21%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH+A + GH ++   L  +GA            PLH A  +G +++   ++ KS    D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N   I   L +   + N     G  ++H AA       + +L+  NA++++ +  G +PLHLAA+ + +     LV+ G  +D +   G TP H+    G  + +++LL + A + A    G T  H A + GH   I+  L +N S +E+   G      ARR G+  + +  K
Sbjct:  519 LHLAAREGHEDVAAFLLDHGASLSITT-KKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 113.62 bits (283), Expect = 7.785e-26
Identity = 90/333 (27.03%), Postives = 136/333 (40.84%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECL---------------------------------KILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            GNI+     L     V F  + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ +S   + S   NGL+P H+      L C+                                 K+L +  A    K  NG   +H A K+N  +++  L     +I    ++G T +H AA     + +  L+   A  +  +  G + LH+AA+    E +RYLV  G  ++ +    +TP HI++  G  + +  LL  GA   A    G T  H A R GH +     L+H  S+    K G      A +YG
Sbjct:  229 GNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT-RDGLTPLHCGARSGHEQVVEMLLDRSAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG 559          

HSP 3 Score: 109.768 bits (273), Expect = 1.475e-24
Identity = 77/293 (26.28%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQ 1260
            LH+A  YG++N+   L    A   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L    + ++   +   TALH AA        ++L+   A  + +   G +PLH+A K N +  +  L+  G  I      G TP H+A+F G    +  L+ +GA        G T  H A R G  E +   +     V+   K  +     + R G         KA++V  + Q
Sbjct:  222 LHIAAHYGNINVATLLLNRAAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAK-IDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG---------KADIVQQLLQ 503          

HSP 4 Score: 106.686 bits (265), Expect = 1.286e-23
Identity = 78/303 (25.74%), Postives = 143/303 (47.19%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +G+++    Y+K+  +V  I  ++GL  LH+A K GH+ +V EL +  A+            LH A   G  ++V+ +V      +++   NG TP ++   E  LE ++ L +  A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  +E   G +PLH+AA + ++     L++    +D       TP H+AS +G    +  LLD GA I A   +G T  H   R GH + +   L+ +  +    K G +    A +  H
Sbjct:   34 AGHLEKALDYIKNGVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGN-TALHIASLAGQAEVVKVLVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDH 329          

HSP 5 Score: 100.908 bits (250), Expect = 1.145e-21
Identity = 75/273 (27.47%), Postives = 126/273 (46.15%), Query Frame = 1
Query:  364 VQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            V   GL  +HVA   GH+NIV +L  +GA       +N R    LH A   G  ++V ++V    + +++   +  TP HI    G+ + ++ L    A       +G   +H A++  H+ +  +L D   ++++    G T LH AA         +L++ +A        G +PLH+AA +++ +    L+  G         G TP HIA+ +   +    LL+ GAD  AV  +G    H A + GH + +   L+ N +V+  NK G
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNT---TNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSG 680          

HSP 6 Score: 95.5153 bits (236), Expect = 5.707e-20
Identity = 66/238 (27.73%), Postives = 103/238 (43.28%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYAC 1095
            LHVA   GH  + K L    A    K   N   PLH AC    I ++E ++ K    I ++  +GLTP H+    G +  +  L ++ A     +  G   +H A++    +++RYL      +  +    +T LH +A       +Q L++  A  +     G +PLHLAA+    +   +L+  G  + I   +G TP H+A+  G  E    LL   A   A    G T  H A 
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAA 589          

HSP 7 Score: 94.7449 bits (234), Expect = 1.011e-19
Identity = 71/279 (25.45%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++         ++    LH A   G+  + + ++ K     ++   NG TP HI   +  +  +++L  + A      ++G+  IH A+   H  I+  L     + N     G+TALH AA +     ++ LV+  A +  +  +  +PLH++A+    + ++ L+  G   +     G TP H+A+ +G  +   +LLD+GA +     +G T  H A + G  E     L  + S D   K G      A  Y
Sbjct:  315 KNGLSPLHMATQGDHLNCVQLLLQHNVPVD-DVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 591          

HSP 8 Score: 93.5893 bits (231), Expect = 1.989e-19
Identity = 75/294 (25.51%), Postives = 121/294 (41.16%), Query Frame = 1
Query:  331 YLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +L   G  + +   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A      +N +  +H ASKR +  +++ L D    I+ +   G T LH  A +     ++ML+  +A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    LLD  A   A    G T  H AC+      +   L H  S+  + + G      A   GH
Sbjct:  141 FLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQNDTN-ADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGH 428          

HSP 9 Score: 93.2041 bits (230), Expect = 2.500e-19
Identity = 69/275 (25.09%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L K+GA       S    P+H A   G++++V  ++       ++ +  G T  H+    G+ E ++ L    A    K K+    +H +++     I++ L     + N    +G T LH AA          L+   A +SI   +G +PLH+AAK+  LE    L+      D     G TP H+A+     +    LLD GA   A    G T  H A +    +     L +    + + + G      A + GH
Sbjct:  387 LHIACKKNRIRVMELLLKHGASIQAVTESG-LTPIHVAAFMGHVNIVSQLMHHGAS-PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGH 659          

HSP 10 Score: 92.8189 bits (229), Expect = 4.271e-19
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +V+ L + GA    K   +Q  PLH +   G  D+V+ ++ +     ++  T+G TP H+   EG  +    L ++ A  ++  K G   +H A+K    ++   L     + +    +G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G    H+A+ +G  + +  LL   A++      G T  H A +          +N    VD   K+G         YG+
Sbjct:  447 VRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ-TPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN 725          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 117.857 bits (294), Expect = 3.701e-27
Identity = 77/283 (27.21%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH+A + GH ++   L  +GA            PLH A  +G +++   ++ KS    D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N   I   L +   + N     G  ++H AA       + +L+  NA++++ +  G +PLHLAA+ + +     LV+ G  +D +   G TP H+    G  + +++LL + A + A    G T  H A + GH   I+  L +N S +E+   G      ARR G+  + +  K
Sbjct:  519 LHLAAREGHEDVAAFLLDHGASLSITT-KKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 113.62 bits (283), Expect = 9.111e-26
Identity = 90/333 (27.03%), Postives = 136/333 (40.84%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECL---------------------------------KILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            GNI+     L     V F  + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ +S   + S   NGL+P H+      L C+                                 K+L +  A    K  NG   +H A K+N  +++  L     +I    ++G T +H AA     + +  L+   A  +  +  G + LH+AA+    E +RYLV  G  ++ +    +TP HI++  G  + +  LL  GA   A    G T  H A R GH +     L+H  S+    K G      A +YG
Sbjct:  229 GNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT-RDGLTPLHCGARSGHEQVVEMLLDRSAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG 559          

HSP 3 Score: 109.768 bits (273), Expect = 1.606e-24
Identity = 77/293 (26.28%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQ 1260
            LH+A  YG++N+   L    A   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L    + ++   +   TALH AA        ++L+   A  + +   G +PLH+A K N +  +  L+  G  I      G TP H+A+F G    +  L+ +GA        G T  H A R G  E +   +     V+   K  +     + R G         KA++V  + Q
Sbjct:  222 LHIAAHYGNINVATLLLNRAAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAK-IDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG---------KADIVQQLLQ 503          

HSP 4 Score: 106.686 bits (265), Expect = 1.388e-23
Identity = 78/303 (25.74%), Postives = 143/303 (47.19%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +G+++    Y+K+  +V  I  ++GL  LH+A K GH+ +V EL +  A+            LH A   G  ++V+ +V      +++   NG TP ++   E  LE ++ L +  A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  +E   G +PLH+AA + ++     L++    +D       TP H+AS +G    +  LLD GA I A   +G T  H   R GH + +   L+ +  +    K G +    A +  H
Sbjct:   34 AGHLEKALDYIKNGVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGN-TALHIASLAGQAEVVKVLVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDH 329          

HSP 5 Score: 100.908 bits (250), Expect = 1.073e-21
Identity = 75/273 (27.47%), Postives = 126/273 (46.15%), Query Frame = 1
Query:  364 VQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            V   GL  +HVA   GH+NIV +L  +GA       +N R    LH A   G  ++V ++V    + +++   +  TP HI    G+ + ++ L    A       +G   +H A++  H+ +  +L D   ++++    G T LH AA         +L++ +A        G +PLH+AA +++ +    L+  G         G TP HIA+ +   +    LL+ GAD  AV  +G    H A + GH + +   L+ N +V+  NK G
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNT---TNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSG 680          

HSP 6 Score: 95.1301 bits (235), Expect = 6.216e-20
Identity = 66/238 (27.73%), Postives = 103/238 (43.28%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYAC 1095
            LHVA   GH  + K L    A    K   N   PLH AC    I ++E ++ K    I ++  +GLTP H+    G +  +  L ++ A     +  G   +H A++    +++RYL      +  +    +T LH +A       +Q L++  A  +     G +PLHLAA+    +   +L+  G  + I   +G TP H+A+  G  E    LL   A   A    G T  H A 
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAA 589          

HSP 7 Score: 94.7449 bits (234), Expect = 1.026e-19
Identity = 71/279 (25.45%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++         ++    LH A   G+  + + ++ K     ++   NG TP HI   +  +  +++L  + A      ++G+  IH A+   H  I+  L     + N     G+TALH AA +     ++ LV+  A +  +  +  +PLH++A+    + ++ L+  G   +     G TP H+A+ +G  +   +LLD+GA +     +G T  H A + G  E     L  + S D   K G      A  Y
Sbjct:  315 KNGLSPLHMATQGDHLNCVQLLLQHNVPVD-DVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 591          

HSP 8 Score: 93.5893 bits (231), Expect = 2.205e-19
Identity = 75/294 (25.51%), Postives = 121/294 (41.16%), Query Frame = 1
Query:  331 YLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +L   G  + +   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A      +N +  +H ASKR +  +++ L D    I+ +   G T LH  A +     ++ML+  +A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    LLD  A   A    G T  H AC+      +   L H  S+  + + G      A   GH
Sbjct:  141 FLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQNDTN-ADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGH 428          

HSP 9 Score: 93.2041 bits (230), Expect = 2.723e-19
Identity = 69/275 (25.09%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L K+GA       S    P+H A   G++++V  ++       ++ +  G T  H+    G+ E ++ L    A    K K+    +H +++     I++ L     + N    +G T LH AA          L+   A +SI   +G +PLH+AAK+  LE    L+      D     G TP H+A+     +    LLD GA   A    G T  H A +    +     L +    + + + G      A + GH
Sbjct:  387 LHIACKKNRIRVMELLLKHGASIQAVTESG-LTPIHVAAFMGHVNIVSQLMHHGAS-PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGH 659          

HSP 10 Score: 92.4337 bits (228), Expect = 4.491e-19
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +V+ L + GA    K   +Q  PLH +   G  D+V+ ++ +     ++  T+G TP H+   EG  +    L ++ A  ++  K G   +H A+K    ++   L     + +    +G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G    H+A+ +G  + +  LL   A++      G T  H A +          +N    VD   K+G         YG+
Sbjct:  447 VRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ-TPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN 725          
BLAST of Ankyrin repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.272e-26
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  237 LHIAAHYGNVNVATLLLNRGAAVDFT-ARNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 514          

HSP 2 Score: 112.464 bits (280), Expect = 1.809e-24
Identity = 91/310 (29.35%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+      GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  Y A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  236 PLHIAAHYGNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAK-TRDGLTPLHCAARSGHDQVVELLLERKAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 542          

HSP 3 Score: 107.842 bits (268), Expect = 4.566e-23
Identity = 82/279 (29.39%), Postives = 128/279 (45.88%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+     K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  533 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 806          

HSP 4 Score: 103.99 bits (258), Expect = 8.946e-22
Identity = 76/275 (27.64%), Postives = 122/275 (44.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +    +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG+
Sbjct:  468 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGN 740          

HSP 5 Score: 98.9821 bits (245), Expect = 3.447e-20
Identity = 73/284 (25.70%), Postives = 123/284 (43.31%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N     G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  534 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 814          

HSP 6 Score: 92.4337 bits (228), Expect = 4.452e-18
Identity = 69/275 (25.09%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++       D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  402 LHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGH 674          

HSP 7 Score: 92.0485 bits (227), Expect = 5.305e-18
Identity = 79/315 (25.08%), Postives = 129/315 (40.95%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKT-----------------------------ALHYAAITNSCSAIQMLVKC--NADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFL 1131
            +GN+D V  YLK   ++     ++GL  LH+A K GH+ +V+EL   G+                                    +DS    G T  HI  + G+ E +K+L    A+   + +NG   ++ A++ NH  +++YL +   N +   + G T                             ALH AA  +   +  +L++   NAD+  +         G +PLH+AA + ++     L++ G  +D     G TP H+AS +G    +  LLD G  I A   +G T  H A R GH + +   L
Sbjct:   41 AGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSS-----------------------------------VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL 319          

HSP 8 Score: 88.1965 bits (217), Expect = 9.254e-17
Identity = 79/317 (24.92%), Postives = 131/317 (41.32%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIV-------AKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+       +ID V  YL   G  +     DG   L VA + GH   V  L +       + P+     LH A    +      ++        +S   ++    +G TP HI    G +    +L N  A      +NG+  +H ASKR +  +++ L D    I+ +   G T LH AA +     +++L++  A +      G SPLH+AA+ + +E +++L+    P+D       T  H+A+  G +     LLD  A+  A    G T  H AC+    + +   + +  S+  I + G      A   GH
Sbjct:  133 PLYMAAQENHID-VVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPA-----LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGH 443          

HSP 9 Score: 82.4185 bits (202), Expect = 6.039e-15
Identity = 73/282 (25.89%), Postives = 122/282 (43.26%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  H+  VK L +Y A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  330 KNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 606          

HSP 10 Score: 63.1586 bits (152), Expect = 4.843e-9
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   28 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 186          
BLAST of Ankyrin repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.314e-26
Identity = 85/292 (29.11%), Postives = 147/292 (50.34%), Query Frame = 1
Query:  298 VASGNIDGVNSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGE 1173
            V SGN+D V+  + +  NV        +LH A K G+LN+V  L K  AD   K  S + I LH A   GN++LV +++ K+   I +   +G T  H     G L  +  L    AD   K  +G  ++H+A+K  +  ++ +L   + +I+ + ++G+T LH+AA + + + + +L+    DI+ + ++G + LH A +  +L  +  L+  GI ++ + N G T  H A   G  + +  L+  GAD+ A  D+G T  HYA    +   +   + +   V+  N  GE
Sbjct:  811 VESGNLDLVSLLIHNGANVN---NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETI-LHFAAESGNLNLVNWLI-KNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGE 1097          

HSP 2 Score: 115.546 bits (288), Expect = 1.325e-25
Identity = 84/303 (27.72%), Postives = 144/303 (47.52%), Query Frame = 1
Query:  298 VASGNIDGVNSYLKSEGNVKFIVQR-DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            V SGN+  V   ++++ N+       + +LH A  + + ++V  L  YGAD   K   N    LH A   GN+DLV  +++     +++   +G T  +  V  G  + + +L  Y AD   K  NG  ++H+A +  +  ++  L     N+N      KT LH+AA + + + +  L+K  ADI  + N G + LH AA+  +L  + +L+     I  + N G T  H A+  G    ++WL+ N ADI A  + G TI H+A + G+   ++  + +   +      GE +   A   G
Sbjct:  679 VKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAK-TDNGLTALHYAVYDGNLDLVSLLISHGAD-VNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN----NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESG 975          

HSP 3 Score: 113.235 bits (282), Expect = 6.663e-25
Identity = 83/303 (27.39%), Postives = 139/303 (45.87%), Query Frame = 1
Query:  298 VASGNIDGVNSYLKSEGNVKFIVQR-DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            V  GN+D V+  +    +V       + +L+ A  YG  ++V  L  YGAD   K  + + + LH A   GN+DLV  ++            N  T  H     G L  +  L    AD   K  +G  ++H+A++  +  ++ +L   + +I+ + ++G+T LH+AA + + + +  L+K  ADI  + N G + LH AAK  +L  + +L+     I  + N G T  H A+  G    +  L+ NG DI    D+G T  HYA   G+   +   ++    V+     GE +   A   G
Sbjct:  745 VYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETV-LHYAVESGNLDLVSLLIHNGANV-----NNAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLG 1041          

HSP 4 Score: 108.227 bits (269), Expect = 2.876e-23
Identity = 74/260 (28.46%), Postives = 134/260 (51.54%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQR-DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTI 1080
            SGN++ VN  +K++ ++       + +LH A K G+LN+V  L K  AD   K  S + I LH A   GN++LV +++ K+   I +   +G T  H     G L  + +L +   D   K  +G+  +H+A +  +  ++  L    I++N + ++G+T LH+A    S   + +L+   AD++ + ++G + LH A + ++L  +  L+  G  ++ + N G TP H A      + +  L+ NGADI    + G T+
Sbjct:  875 SGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETI-LHFAAKSGNLNLVNWLI-KNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETV 1132          

HSP 5 Score: 104.76 bits (260), Expect = 3.332e-22
Identity = 80/301 (26.58%), Postives = 144/301 (47.84%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQR-DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            SGN++ VN  +K++ ++       + +LH A + G+LN+V  L K  AD   K  S + I LH A   GN++LV +++ K+   I +   +G T  H     G L  +  L    AD   K  +G  ++H+A++  +  ++  L     +IN + D G TALHYA  + + + + +L+    D++ + N G + LH A    SL+ +  L+  G  ++ + + G T  H A        +  L+  GAD+ A  + G T  HYA      + +   +++   ++  N  GE +  +   + 
Sbjct:  842 SGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETI-LHFAAKSGNLNLVNWLI-KNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFN 1140          

HSP 6 Score: 99.3673 bits (246), Expect = 1.870e-20
Identity = 56/191 (29.32%), Postives = 100/191 (52.36%), Query Frame = 1
Query:  574 GLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGS 1146
            G+   H     G L+  K+L    AD   K  NG  ++H+A K  +  ++++L + + NI+ + D G+T LHYA   N+   + +L+   AD++ + + G + LH A    +L+ +  L+S G  ++ + N G T  + A   G  + ++ L+  GAD+ A  D G T+ HYA   G+ + +   + HNG+
Sbjct:  638 GVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLI-HNGA 827          

HSP 7 Score: 94.3597 bits (233), Expect = 8.180e-19
Identity = 64/242 (26.45%), Postives = 116/242 (47.93%), Query Frame = 1
Query:  478 IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            I LH A   GN+DL + ++AK+   +++   NG T  H  V  G L  +K L    A+   K  NG  ++H+A   N+  ++  L     ++N + D G TALHYA    +   + +L+   AD++ + N G + L+ A  + S + +  L++ G  ++ + + G T  H A   G  + +  L+ NGA++    +   TI H+A + G+   ++  + +   +      GE +   A   G
Sbjct:  640 ISLHCAAKNGNLDLAK-LLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANV----NNAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESG 876          

HSP 8 Score: 88.9669 bits (219), Expect = 3.365e-17
Identity = 60/220 (27.27%), Postives = 114/220 (51.82%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQR-DGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIR 960
            SGN++ VN  +K++ ++       + +LH A + G+LN+V  L   G D   K   +    LH A   GN++LV  ++ K +  +++   +G T  H  V  G L+ + +L    AD   K  +G+  +H+A + ++  ++  L     ++N + ++G+T LHYA I NS   + +L+   ADI+ ++N G + L+   + N+   L+  +  G  I++ 
Sbjct:  941 SGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTK-TDDGLTALHYAVESGNLNLVSLLIHKGID-VNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLE 1158          

HSP 9 Score: 70.4774 bits (171), Expect = 2.270e-11
Identity = 46/197 (23.35%), Postives = 97/197 (49.24%), Query Frame = 1
Query:  613 LECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            +E + +L  + A+    + +G+  +H A+K  +  + + L     ++N + D G+T LHYA  + +   ++ L++  A+I  + + G + LH A   N+ + +  L++ G  ++ + + G T  H A + G  + +  L+ +GAD+ A  + G TI + A   G  + ++  + +   V+     GE +   A   G
Sbjct:  618 VESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESG 814          

HSP 10 Score: 65.855 bits (159), Expect = 6.711e-10
Identity = 41/146 (28.08%), Postives = 70/146 (47.95%), Query Frame = 1
Query:  772 GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHP 1209
            G  +LH AA   +    ++L K  AD++ + + G + LH A K  +L  +++L+     I  + + G T  H A      + ++ L+  GAD+ A  D G T  HYA   G+ + +   ++H   V+     GE +  +A  YG P
Sbjct:  638 GVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSP 783          
BLAST of Ankyrin repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 117.857 bits (294), Expect = 2.710e-26
Identity = 80/280 (28.57%), Postives = 129/280 (46.07%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  237 LHIAAHYGNVNVATLLLNRGAAVDFT-ARNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQ 514          

HSP 2 Score: 110.153 bits (274), Expect = 9.119e-24
Identity = 90/310 (29.03%), Postives = 135/310 (43.55%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+      GN++ V + L + G       R+G+  LHVA K G+ N+VK L   G     K   +   PLH A   G+  +VE ++ +    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  236 PLHIAAHYGNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAK-TRDGLTPLHCAARSGHDQVVELLLERGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 542          

HSP 3 Score: 109.768 bits (273), Expect = 1.110e-23
Identity = 82/279 (29.39%), Postives = 129/279 (46.24%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELC--KYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+      G +D V S L   G    +  + G   LHVA KYG L++ K L   +  AD   K   N   PLH A  + N  +   ++ K      +   NG TP HI   + +++    L NY A+  +  K G+  +H AS+  H  ++  L D   NI++   +G T+LH AA  +  +   +L K  AD       G +PL +A  + +++ + +L+  G  ++ +   G TP H A+ QG    ++ LL +GA   A    GNT    A R G+
Sbjct:  533 PLHISAREGQVD-VASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 806          

HSP 4 Score: 105.145 bits (261), Expect = 3.691e-22
Identity = 77/275 (28.00%), Postives = 123/275 (44.73%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + G + +V+ L + GA    +    Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+++   +L    A  ++  K G   +H A+K     + + L       +     G T LH AA  ++     +L++  A        G +PLH+AAK N ++    L++ G   +I   +G TP H+AS +G  + +  LLD GA+I      G T  H A +            H    D   KLG      A  YG+
Sbjct:  468 LHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGN 740          

HSP 5 Score: 100.523 bits (249), Expect = 1.030e-20
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH++ + G +++   L + GA   +   + +   PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L    A      KNG   +H A+K+N  +I   L +     N+    G T LH A+       + +L+   A+I +    G + LHLAA+ + +     L   G   D     G TP  +A   G  + +++LL  GA++ A    G T  H A + GH   I+  L H    +     G      A+R G+  + +  K
Sbjct:  534 LHISAREGQVDVASVLLEAGA--AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 814          

HSP 6 Score: 99.7525 bits (247), Expect = 1.895e-20
Identity = 83/309 (26.86%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN + V   L   G +     RDGL  LH A + GH  +V+ L + GA    +   N   PLH A    +++ V+ ++      +D +  + LT  H+    G     K+L +  A+   +  NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    +     K G      A +YG
Sbjct:  269 PLHVASKRGNTNMVKLLLDRGGQID-AKTRDGLTPLHCAARSGHDQVVELLLERGAPLLAR-TKNGLSPLHMAAQGDHVECVKHLLQHKAP-VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYG 574          

HSP 7 Score: 99.3673 bits (246), Expect = 2.201e-20
Identity = 82/324 (25.31%), Postives = 142/324 (43.83%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNG-----------------------------MQLIHWASKRNHDKIIRYLYDLEININVQC--------DTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEI 1158
            +GN+D V  YLK   ++     ++GL  LH+A K GH+ +V+EL   G+             LH A   G  ++V+ +V +    I++   NG TP ++   E  ++ +K L    A+ +   ++G                             +  +H A++++  K    L   + N +VQ         ++G T LH AA   + +   +L+   A +      G +PLH+A+K  +   ++ L+  G  ID +   G TP H A+  G  + +  LL+ GA +LA    G +  H A +G H E +   L H   VD++
Sbjct:   41 AGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD-SATKKGNTALHIASLAGQAEVVKVLVKEGAN-INAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDV 361          

HSP 8 Score: 91.2781 bits (225), Expect = 9.062e-18
Identity = 69/275 (25.09%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++       D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+AAK+ SL+  + L+      D     G TP H+A+     +    LL+ GA   A    G T  H A +    +     LN+    + + K G      A + GH
Sbjct:  402 LHIACKKNRIKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGAS-PDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGH 674          

HSP 9 Score: 81.6481 bits (200), Expect = 1.072e-14
Identity = 79/311 (25.40%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+ D V   L   G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L    + D   K G      A  Y
Sbjct:  302 PLHCAARSGH-DQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHY 606          

HSP 10 Score: 63.5438 bits (153), Expect = 4.724e-9
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    I+IN     G  ALH AA       +Q L+   + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++A+ +   + + +LL+NGA+     ++G T    A + GH + +   L ++
Sbjct:   28 KSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEND 186          
BLAST of Ankyrin repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.541e-26
Identity = 77/283 (27.21%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LH+A + GH ++   L  +GA            PLH A  +G +++   ++ KS    D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N   I   L +   + N     G  ++H AA       + +L+  NA++++ +  G +PLHLAA+ + +     LV+ G  +D +   G TP H+    G  + +++LL + A + A    G T  H A + GH   I+  L +N S +E+   G      ARR G+  + +  K
Sbjct:  519 LHLAAREGHEDVAAFLLDHGASLSITT-KKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 113.62 bits (283), Expect = 6.477e-25
Identity = 90/333 (27.03%), Postives = 136/333 (40.84%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECL---------------------------------KILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            GNI+     L     V F  + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ +S   + S   NGL+P H+      L C+                                 K+L +  A    K  NG   +H A K+N  +++  L     +I    ++G T +H AA     + +  L+   A  +  +  G + LH+AA+    E +RYLV  G  ++ +    +TP HI++  G  + +  LL  GA   A    G T  H A R GH +     L+H  S+    K G      A +YG
Sbjct:  229 GNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT-RDGLTPLHCGARSGHEQVVEMLLDRSAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG 559          

HSP 3 Score: 109.383 bits (272), Expect = 1.215e-23
Identity = 77/293 (26.28%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQ 1260
            LH+A  YG++N+   L    A   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L    + ++   +   TALH AA        ++L+   A  + +   G +PLH+A K N +  +  L+  G  I      G TP H+A+F G    +  L+ +GA        G T  H A R G  E +   +     V+   K  +     + R G         KA++V  + Q
Sbjct:  222 LHIAAHYGNINVATLLLNRAAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAK-IDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG---------KADIVQQLLQ 503          

HSP 4 Score: 106.686 bits (265), Expect = 1.058e-22
Identity = 78/303 (25.74%), Postives = 143/303 (47.19%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +G+++    Y+K+  +V  I  ++GL  LH+A K GH+ +V EL +  A+            LH A   G  ++V+ +V      +++   NG TP ++   E  LE ++ L +  A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  +E   G +PLH+AA + ++     L++    +D       TP H+AS +G    +  LLD GA I A   +G T  H   R GH + +   L+ +  +    K G +    A +  H
Sbjct:   34 AGHLEKALDYIKNGVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTA-LHIASLAGQAEVVKVLVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDH 329          

HSP 5 Score: 100.523 bits (249), Expect = 8.923e-21
Identity = 75/273 (27.47%), Postives = 126/273 (46.15%), Query Frame = 1
Query:  364 VQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            V   GL  +HVA   GH+NIV +L  +GA       +N R    LH A   G  ++V ++V    + +++   +  TP HI    G+ + ++ L    A       +G   +H A++  H+ +  +L D   ++++    G T LH AA         +L++ +A        G +PLH+AA +++ +    L+  G         G TP HIA+ +   +    LL+ GAD  AV  +G    H A + GH + +   L+ N +V+  NK G
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNT---TNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSG 680          

HSP 6 Score: 95.1301 bits (235), Expect = 5.112e-19
Identity = 66/238 (27.73%), Postives = 103/238 (43.28%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYAC 1095
            LHVA   GH  + K L    A    K   N   PLH AC    I ++E ++ K    I ++  +GLTP H+    G +  +  L ++ A     +  G   +H A++    +++RYL      +  +    +T LH +A       +Q L++  A  +     G +PLHLAA+    +   +L+  G  + I   +G TP H+A+  G  E    LL   A   A    G T  H A 
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAA 589          

HSP 7 Score: 94.3597 bits (233), Expect = 8.818e-19
Identity = 71/279 (25.45%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++         ++    LH A   G+  + + ++ K     ++   NG TP HI   +  +  +++L  + A      ++G+  IH A+   H  I+  L     + N     G+TALH AA +     ++ LV+  A +  +  +  +PLH++A+    + ++ L+  G   +     G TP H+A+ +G  +   +LLD+GA +     +G T  H A + G  E     L  + S D   K G      A  Y
Sbjct:  315 KNGLSPLHMATQGDHLNCVQLLLQHNVPVD-DVTNDYLTALHVAAHCGHYKVAKVLLDKKAS-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 591          

HSP 8 Score: 93.5893 bits (231), Expect = 1.520e-18
Identity = 75/294 (25.51%), Postives = 121/294 (41.16%), Query Frame = 1
Query:  331 YLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +L   G  + +   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A      +N +  +H ASKR +  +++ L D    I+ +   G T LH  A +     ++ML+  +A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    LLD  A   A    G T  H AC+      +   L H  S+  + + G      A   GH
Sbjct:  141 FLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQNDTN-ADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGH 428          

HSP 9 Score: 93.2041 bits (230), Expect = 2.142e-18
Identity = 69/275 (25.09%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L K+GA       S    P+H A   G++++V  ++       ++ +  G T  H+    G+ E ++ L    A    K K+    +H +++     I++ L     + N    +G T LH AA          L+   A +SI   +G +PLH+AAK+  LE    L+      D     G TP H+A+     +    LLD GA   A    G T  H A +    +     L +    + + + G      A + GH
Sbjct:  387 LHIACKKNRIRVMELLLKHGASIQAVTESG-LTPIHVAAFMGHVNIVSQLMHHGAS-PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGH 659          

HSP 10 Score: 92.4337 bits (228), Expect = 3.755e-18
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +V+ L + GA    K   +Q  PLH +   G  D+V+ ++ +     ++  T+G TP H+   EG  +    L ++ A  ++  K G   +H A+K    ++   L     + +    +G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G    H+A+ +G  + +  LL   A++      G T  H A +          +N    VD   K+G         YG+
Sbjct:  447 VRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ-TPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN 725          
BLAST of Ankyrin repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 115.931 bits (289), Expect = 1.126e-25
Identity = 75/275 (27.27%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH++ + GH ++   L  +GA            PLH A  +G +++   ++ KS    D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N   I   L +   + N     G  ++H AA       + +L+  NA++++ +  G +PLHLAA+ + +     LV+ G  +D +   G TP H+    G  + +++LL + A + A    G T  H A + GH   I+  L +N S +E+   G      ARR G+
Sbjct:  544 LHLSAREGHEDVAAFLLDHGASLSITT-KKGFTPLHVAAKYGKLEVASLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGY 816          

HSP 2 Score: 112.464 bits (280), Expect = 1.322e-24
Identity = 89/333 (26.73%), Postives = 137/333 (41.14%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSP---------------------------------LHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            GNI+     L     V F  + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ ++   + S   NGL+P H+      L C+++L  ++        + +  +H A+   H K+ + L D + N N +   G T LH A   N    +++L+K  A I      G +P                                 LH+AA+    E +RYLV  G  ++ +    +TP HI++  G  + +  LL  GA   A    G T  H + R GH +     L+H  S+    K G      A +YG
Sbjct:  254 GNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT-RDGLTPLHCGARSGHEQVVEMLLDRAAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG 584          

HSP 3 Score: 109.383 bits (272), Expect = 1.624e-23
Identity = 77/293 (26.28%), Postives = 131/293 (44.71%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQ 1260
            LH+A  YG++N+   L    A   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L    + ++   +   TALH AA        ++L+   A+ + +   G +PLH+A K N +  +  L+  G  I      G TP H+A+F G    +  L+ +GA        G T  H A R G  E +   +     V+   K  +     + R G         KA++V  + Q
Sbjct:  247 LHIAAHYGNINVATLLLNRAAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAK-IDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG---------KADIVQQLLQ 528          

HSP 4 Score: 100.138 bits (248), Expect = 1.429e-20
Identity = 74/273 (27.11%), Postives = 126/273 (46.15%), Query Frame = 1
Query:  364 VQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            V   GL  +HVA   GH+NIV +L  +GA       +N R    LH A   G  ++V ++V    + +++   +  TP HI    G+ + ++ L    A       +G   +H +++  H+ +  +L D   ++++    G T LH AA         +L++ +A        G +PLH+AA +++ +    L+  G         G TP HIA+ +   +    LL+ GAD  AV  +G    H A + GH + +   L+ N +V+  NK G
Sbjct:  437 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNT---TNVRGETALHMAARSGQAEVVRYLVQDGAQ-VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSG 705          

HSP 5 Score: 99.3673 bits (246), Expect = 2.471e-20
Identity = 81/313 (25.88%), Postives = 143/313 (45.69%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIED--------NEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +G+++    Y+K+  +V  I  ++GL  LH+A K GH+ +V EL +  A  D   K        LH A   G  ++V+ +V      +++   NG TP ++   E  LE ++ L +  A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  IE           G +PLH+AA + ++     L++    +D       TP H+AS +G    +  LLD GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   51 AGHLEKALDYIKNGVDVN-ICNQNGLNALHLASKEGHVEVVSELLQREANVDAATK---KGNTALHIASLAGQAEVVKVLVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP----ALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDH 354          

HSP 6 Score: 94.3597 bits (233), Expect = 9.136e-19
Identity = 65/238 (27.31%), Postives = 104/238 (43.70%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYAC 1095
            LHVA   GH  + K L    A+   K   N   PLH AC    I ++E ++ K    I ++  +GLTP H+    G +  +  L ++ A     +  G   +H A++    +++RYL      +  +    +T LH +A       +Q L++  A  +     G +PLHL+A+    +   +L+  G  + I   +G TP H+A+  G  E    LL   A   A    G T  H A 
Sbjct:  379 LHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAA 614          

HSP 7 Score: 92.8189 bits (229), Expect = 2.713e-18
Identity = 72/282 (25.53%), Postives = 126/282 (44.68%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++     D    Y       LH A   G+  + + ++ K     ++   NG TP HI   +  +  +++L  + A      ++G+  IH A+   H  I+  L     + N     G+TALH AA +     ++ LV+  A +  +  +  +PLH++A+    + ++ L+  G   +     G TP H+++ +G  +   +LLD+GA +     +G T  H A + G  E     L  + S D   K G      A  Y
Sbjct:  340 KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDY----LTALHVAAHCGHYKVAKVLLDKKAN-PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 616          

HSP 8 Score: 92.4337 bits (228), Expect = 3.530e-18
Identity = 75/301 (24.92%), Postives = 124/301 (41.20%), Query Frame = 1
Query:  331 YLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVA-------KSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +L   G  + +   DG   L VA + GH  +V  L +       + P+     LH A    +      ++        +S   ++    +G TP HI    G +    +L N  A      +N +  +H ASKR +  +++ L D    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    LLD  A+  A    G T  H AC+      +   L H  S+  + + G      A   GH
Sbjct:  158 FLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGH 453          

HSP 9 Score: 92.0485 bits (227), Expect = 4.756e-18
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +V+ L + GA    K   +Q  PLH +   G  D+V+ ++ +     ++  T+G TP H+   EG  +    L ++ A  ++  K G   +H A+K    ++   L     + +    +G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G    H+A+ +G  + +  LL   A++      G T  H A +          +N    VD   K+G         YG+
Sbjct:  472 VRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ-TPLHISARLGKADIVQQLLQQGAS-PNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN 750          

HSP 10 Score: 91.6633 bits (226), Expect = 5.869e-18
Identity = 68/275 (24.73%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L K+GA       S    P+H A   G++++V  ++       ++ +  G T  H+    G+ E ++ L    A    K K+    +H +++     I++ L     + N    +G T LH +A          L+   A +SI   +G +PLH+AAK+  LE    L+      D     G TP H+A+     +    LLD GA   A    G T  H A +    +     L +    + + + G      A + GH
Sbjct:  412 LHIACKKNRIRVMELLLKHGASIQAVTESG-LTPIHVAAFMGHVNIVSQLMHHGAS-PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGH 684          

HSP 11 Score: 59.3066 bits (142), Expect = 8.018e-8
Identity = 37/150 (24.67%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  694 ASKRNH-DKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            A++  H +K + Y+ +  +++N+    G  ALH A+       +  L++  A++     +G++ LH+A+     E ++ LV+ G  ++ +   G TP ++A+ +   E + +LLDNGA      ++G T    A + GH + +   L ++
Sbjct:   48 AARAGHLEKALDYIKN-GVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEND 196          
BLAST of Ankyrin repeat-containing domain protein vs. TrEMBL
Match: K1QW74 (Ankyrin-3 OS=Crassostrea gigas OX=29159 GN=CGI_10022580 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.861e-73
Identity = 137/392 (34.95%), Postives = 218/392 (55.61%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLD 1557
            LH+AC YG L++V++L K       K  +  R PLH+ C  G+ + +  ++  +   ++  D +G TPAH+    GEL C+K+L++  A+   +D  G Q+ H+A+ RNH KI+++L+D  I+++ +C+ GKT +HYAA   +  ++ +LV+ + DI++ DN G    H AA+HN L+ LR+LV  G  I+  Q  G++PSH+A+  G  + LHWL + GAD    +  GNT GHYA  GGH E + C+L H G ++  N  GE    +AR+ GHP++ +KA   EV C  C  +  K +W++ H P  V R I  ++   ++NPL     V            T+++      IN+ K   +  K    P     G  R+  ++YYG +LD
Sbjct:   47 LHIACTYGQLSMVEKLLKQNHSPVSKTKTG-RTPLHEVCVGGHKECLRTLLQYTPE-VNIRDRDGQTPAHVAAFNGELGCIKMLQDKGANLIAEDHRGRQVAHFAAMRNHKKILQFLFDQGIDLDCRCEMGKTPVHYAAQYGALQSVILLVQRDCDITLTDNNGYLASHHAARHNKLDCLRFLVKQGSNIEATQADGKSPSHVAALYGSIDVLHWLFEKGADPNKQDYFGNTPGHYASEGGHPECLSCYLYHEGDIENQNIKGETPLDSARKAGHPLLMQKAITNEVPCKTCFQKHKKIEWERNHPPAKVERQITTAKSVAYKNPLPKTDKV-----------PTQLE------INLMKREKRLEKLMPKP----TGPKRDASAQYYGHYLD 415          
BLAST of Ankyrin repeat-containing domain protein vs. TrEMBL
Match: A0A1S3JNY8 (ankyrin repeat domain-containing protein 42 OS=Lingula unguis OX=7574 GN=LOC106174877 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 4.195e-73
Identity = 143/445 (32.13%), Postives = 235/445 (52.81%), Query Frame = 1
Query:  265 VKMLKHPISSLVASGNIDGVNSYLKSE---GNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGE----RKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLDNH*LSNF 1578
             K  K  + S    G+ D +   L++     ++K   ++   LH+A  YG ++ V+EL K GAD   +  S  R PLH+A   G+ D++  ++   +  I++ D +G +  H+    GE +CL++L N  A  +++D+ G    H A+ RNH KI+  L+   +++   CD GK  LHYAA      ++  L++ + DI+I DN G+ P H+AA H+ L+ LR+LV  G  +D+ Q  G+TP+H+A+  G   CLHWL +        +  GNT GHYA  G H +  +C+L H GS+D +N   E    TARR+GHP++ E A K E++C +C+ +  + +W++ HAP  V R I ++ +  +  P+   A      ++   E    +K    +K I+   +     QK KK   P        R+L +RY+G+ + +  L  F
Sbjct:    8 TKERKERLVSAAQKGDADTIKRVLENTTINPDIKVKHEKRSPLHLAAGYGQVSAVEELLKAGADPS-QTTSIGRTPLHEATLGGHYDVIRVLL-DYVEDINAQDKDGHSAVHLAAYHGEEKCLEVLSNRGASLSIEDQWGRHPAHLAAIRNHPKILELLFGKGVDLECTCDLGKLPLHYAAQYGGLESLICLIERDCDITIGDNNGNVPAHMAAWHDHLDCLRFLVKQGSAMDVAQGEGKTPAHVAALHGSVNCLHWLFEKKLTPNYQDGYGNTPGHYAAEGAHPKCFNCYLQHEGSLDIVNDRMETPLDTARRFGHPLLMESAVKNELLCPLCEAKWERLEWEKEHAPAPVERSIIRTGQVAYTCPVPPKARHKPQEEEASNEKTDGKKQPAPKKEIKAKVLTGSYLQKEKKKLPP--------RDLTTRYFGNHIQSSDLFKF 442          
BLAST of Ankyrin repeat-containing domain protein vs. TrEMBL
Match: A0A210QDK2 (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18880 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 7.150e-64
Identity = 124/392 (31.63%), Postives = 207/392 (52.81%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLD 1557
            LH+A  YG   IV++L K GA+      +  R PLH+ C  G+ + +  ++  +   ++  D +  TPAH     GEL CLKIL    +    +DK G Q+ H A+ RNH KI++YL+D  ++++ +C+ GKT +HYAA   S   + +L++ + DI++ DN G    H A++H+ L+ +R+LV  G  +++ Q  G+T SH+A+  G    LHWLL+ GAD    +  GNT GHYA      E + CFL H G ++  N  G+     AR+ G P+  EK    +  C +C  +  K  WD+ H P ++ R +++++ + ++NP+ +   V    +    +R   +  K    +N+ K                    R+L ++Y+G++LD
Sbjct:   39 LHIASSYGQYPIVEKLLKAGAE-PLDRNNTGRTPLHEVCTGGHKECLNLLLQHTPE-VNVRDRDNQTPAHTAAFNGELGCLKILHAKGSSLVAEDKLGRQVSHLAAMRNHKKILQYLFDQGVDLDSRCEIGKTPVHYAAQYGSLDCVILLIQRDCDITLGDNNGYLAAHHASRHDKLDIVRFLVKQGTSLEVTQADGKTLSHVAAQHGALNVLHWLLEKGADPNQTDYFGNTPGHYAADSRRPECLSCFLYHEGDIESQNIKGDTPLDAARKAGCPLEMEKGVNNKQPCQLCFQKYKKAVWDRSHPPTAMERQLSRAKTTAYKNPVPAPVRVPTQLQLNLMKRDKRL-AKAAPKVNMSK--------------------RDLSAQYFGEYLD 407          
BLAST of Ankyrin repeat-containing domain protein vs. TrEMBL
Match: A0A2T7PKQ5 (ANK_REP_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05271 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.767e-62
Identity = 133/422 (31.52%), Postives = 218/422 (51.66%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFI-VQRDGL----LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLD 1557
            G+++ +   L S   V  I V R+G     L +AC YG  ++V+EL K GAD   +     R+PLHDAC  GN + +  ++   +  +D  D N  T  H     GE++CL++L    A+   +D  G Q  H A+  NH KI++ L+D  ++++ QC  GKT LHYAA   +  ++  LV+ + D ++ DN      H AA+++ ++ LR+LV  G  +D   + GRT +H+A+  G    LHWLL+ GAD  A +  GNT  H A   G  +  +C L H+G +  +N   ++    A++ GHP +  +A K E VC  C  ++   KWD+ H+P  V R I  ++ S + +PL                ++T++ +      N+ +   +K  K+  P        R+L ++Y+G++LD
Sbjct:   30 GDMEAIKKVLDSGSLVPDITVMREGFEKSPLSLACIYGQTSVVEELLKNGAD-PMRRSGTGRVPLHDACIGGNSECMSLLL-DYMSDVDVADHNKQTALHHAAYNGEIKCLRLLTQKGANLVAEDSKGRQAAHLAAMHNHVKILQLLFDHGVDLDCQCQAGKTPLHYAAQHGALESLICLVEHDCDTTVSDNNTFLAAHQAARYDKVDCLRFLVQQGTELDAALSDGRTLAHVAAQYGATNALHWLLEKGADANAQDKLGNTPAHCAADRGKADCFNCCLQHDGDLSLMNISRDSPLDAAKKSGHPQLIARALKNETVCMQCFKKMKVAKWDEEHSPAQVERGIIAARSSAYISPL----------PPARHSQQTQLQK------NLFRTKMKKETKTRLPE-------RDLPAKYFGEYLD 426          
BLAST of Ankyrin repeat-containing domain protein vs. TrEMBL
Match: A0A267FE66 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014646g1 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.062e-58
Identity = 127/397 (31.99%), Postives = 199/397 (50.13%), Query Frame = 1
Query:  286 ISSLVASGNIDGV-NSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFID----------------SIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDL------EININVQCDTGKTALHYAAITNSCSAIQMLV-KCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEV-------VCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVN 1383
            ++  V SG+   V + +L +   V+ +V+RD LLHVAC +GHL +V+EL ++G       P++ R PLH+A + G     E +V + L +I+                ++D  G +  H    +GEL CL +L    A   + D  G+   H A+ R+H ++++ L            ++ +   G T  H+AA + +  A+  L  +  A + + D +G+ P HLAA+H+ L  LR L   G+ +D+    G+ P H A+  G  +CLHWLL+ GAD  A + EGNT GH+    G  E   C+L H G  +  N +GEN  Q ARR GHPV+     K           C +C  +  K KW+Q H    V+R +  S + ++ +PLG Y   +N
Sbjct:    4 LAEAVRSGDAGRVRDQFLSNHTQVRLLVERDRLLHVACGFGHLEVVRELLQHGVPPNLAAPNSGRRPLHEAVSAG----FEPVVRELLPWIEKQQQQQQQPQADGGINAVDNRGRSAVHAACEQGELACLNLLAAAGASLNLPDSGGVTPAHLAAGRDHPELLKRLRKRCGPAAGNALMSARDGKGLTPAHWAAASGATRALHALASELKAPVDLPDRQGNQPAHLAARHDRLNCLRLLADRGVALDLPGRAGKLPMHFAAQFGNLQCLHWLLEQGADPNAQDAEGNTPGHWTNLSGQAECFACWLRHGGDSELANLMGENCAQAARRAGHPVLMATVVKQPTDNAAKSPSCPLCVEKDRKWKWEQAHQSAPVLRAMGASARRVYTDPLGDYRANLN 396          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 124.79 bits (312), Expect = 1.373e-29
Identity = 80/281 (28.47%), Postives = 135/281 (48.04%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK 1224
            LH+A  YG++N+   L   GA   +K   N   PLH A   GN ++V+ ++ +  R ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L   E+ ++   +   TALH AA        +++V   A+ + +   G +PLH+A K N ++ +  L+  G  I      G TP H+A+F G    +  L+++GA        G T  H A R G  E +   + +   VD  +K  +     + R G P I ++
Sbjct:  186 LHIAAHYGNINVATLLLNRGAAVDFKA-RNDITPLHVASKRGNSNMVKLLLERGAR-IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQ 464          

HSP 2 Score: 109.383 bits (272), Expect = 1.538e-24
Identity = 85/301 (28.24%), Postives = 133/301 (44.19%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F  + D   LHVA K G+ N+VK L + GA    K   +   PLH     G+  +VE ++ +    + S   NGL+P H+      L C+++L +++        + +  +H A+   H K+ + + D + N N +   G T LH A   N    +++L+K  A I      G +P+H+AA       +  L++ G   +    RG T  H+A+  G  E + +L+ NGA + A   +  T  H + R G  E I   L H    D     G      A R GH
Sbjct:  193 GNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKT-KDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGH 491          

HSP 3 Score: 107.842 bits (268), Expect = 5.125e-24
Identity = 76/275 (27.64%), Postives = 124/275 (45.09%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GH ++   L   GA  G         PLH A  +G I++   ++ K     D+   +GLTP H+       +   +L +  A      KNG   +H A+K+N  +I   L +   + N     G + LH A+   +   + +L+  +A I++ +  G +PLHLAA+ + +     LV+ G  +D     G TP H+A   G  + +H+LL N A + A           A + GH   I+  L H  + +E+   G      ARR G+
Sbjct:  483 LHLAAREGHKDVASILLDQGASLGITT-KKGFTPLHVAAKYGKIEVANLLLQKRAP-PDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNA------KTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGY 749          

HSP 4 Score: 107.457 bits (267), Expect = 5.602e-24
Identity = 80/296 (27.03%), Postives = 141/296 (47.64%), Query Frame = 1
Query:  331 YLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            YLKS  ++  I  ++GL  LH+A K GH+ +V +L K GA  D   K        LH A   G  D+V+ +V      +++   NG TP ++   E  L+ ++ L +  +  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   A  +L++ + +  +E   G +PLH+AA + ++     L++ G  +D +     TP H+AS +G    +  LL+ GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:    7 YLKSGVDIN-ICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATK---KGNTALHIASLAGQSDVVKELVTNGAN-VNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDH 293          

HSP 5 Score: 99.7525 bits (247), Expect = 2.099e-21
Identity = 75/281 (26.69%), Postives = 121/281 (43.06%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G   +VK L + GA    K   +Q  PLH +   G  ++++ ++       DS  T+G TP H+   EG  +   IL +  A   +  K G   +H A+K    ++   L       +    +G T LH AA  ++     +L+   A        G +PLH+AAK N +E    L+  G   +    +G +P H+AS +G  + +  L+   A I      G T  H A +          +NH  +VD   K+G      A  YG+
Sbjct:  411 VRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQ-TPLHISSRLGKPEIIQQLLQHG-ACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGN 689          

HSP 6 Score: 98.2117 bits (243), Expect = 6.220e-21
Identity = 72/276 (26.09%), Postives = 128/276 (46.38%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTN-GLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH++ + G   I+++L ++GA C     ++   PLH A   G+ D+   ++ +       I T  G TP H+    G++E   +L    A      K+G+  +H A+  ++ K+   L D   + +     G T LH AA  N       L++  AD +    +G SPLHLA++  +++ +  L++    I++    G TP H+A+ +        L+++GA +      G T  H AC  G+ + +H  L +   V+   K+      TA + GH
Sbjct:  450 LHISSRLGKPEIIQQLLQHGA-CPDSTTTSGYTPLHLAAREGHKDVASILLDQGASL--GITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGH 716          

HSP 7 Score: 95.9005 bits (237), Expect = 3.121e-20
Identity = 87/339 (25.66%), Postives = 132/339 (38.94%), Query Frame = 1
Query:  295 LVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQN---------------------------------RGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            + A  N   V  YL   G+ + I   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A    K +N +  +H ASKR +  +++ L +    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N                                  G TP HIA  +   + +  LL +GA I AV + G T  H A   GH   +   +NH  S +  N  GE     A R G 
Sbjct:   93 MAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKAAALLLQND-HNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQ 425          

HSP 8 Score: 92.0485 bits (227), Expect = 5.930e-19
Identity = 73/279 (26.16%), Postives = 124/279 (44.44%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L  +         ++    LH A   G+  + + IV K     ++   NG TP HI   +  ++ +++L  + A      ++G+  IH A+   H+ I+  L +   + N     G+TALH AA       ++ LV+  A +  +  +  +PLH++++    E ++ L+  G   D     G TP H+A+ +G  +    LLD GA +     +G T  H A + G  E  +  L      D   K G      A  Y
Sbjct:  279 KNGLSPLHMATQGDHLNCVQLLLHHEVPVD-DVTNDYLTALHVAAHCGHYKVAKVIVDKKAN-PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHY 555          

HSP 9 Score: 90.5077 bits (223), Expect = 1.758e-18
Identity = 76/305 (24.92%), Postives = 125/305 (40.98%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLH 1296
            LH+ACK   + +++ L K+GA       S    P+H A   G+ ++V  ++       ++ +  G T  H+    G+ E +K L    A    K K+    +H +S+    +II+ L       +    +G T LH AA         +L+   A + I   +G +PLH+AAK+  +E    L+    P D     G TP H+A+     +    LLD GA   A    G T  H A +    E     L +    + I + G +    A + G+  +       +   ++C    NK     LH
Sbjct:  351 LHIACKKNRIKVMELLLKHGASIQAVTESG-LTPIHVAAFMGHENIVTQLMNHGAS-PNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLC----NKSGLTPLH 649          

HSP 10 Score: 58.151 bits (139), Expect = 1.921e-8
Identity = 35/143 (24.48%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  712 DKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            +K + YL    ++IN+    G  ALH A+       +  L+K  A +     +G++ LH+A+     + ++ LV+ G  ++ +   G TP ++A+ +   + + +LLDNG+      ++G T    A + GH + +   L ++
Sbjct:    2 EKALDYLKS-GVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEND 143          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 119.398 bits (298), Expect = 8.251e-28
Identity = 79/275 (28.73%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GH      L ++GA            PLH A  +G I+  + ++ K     D+    GLTP H+           +L ++ A      KNG   +H A+K+N  +I   L +     N     G + LH AA   S   + +L+  NA++++ +  G +PLHLAA+ + +     L++ G  +D     G TP H+A   G  + + +LL+N A I +    G T  H A + GH   I+  L H  S +E+   G      ARR G+
Sbjct:  538 LHLAVREGHQETASLLLEHGASLSAAT-KKGFTPLHVAAKYGQIEAAKLLLQKRA-APDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGY 810          

HSP 2 Score: 117.472 bits (293), Expect = 3.358e-27
Identity = 93/334 (27.84%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYD---------------------------------ADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F+ + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ +    + S   NGL+P H+      L C+++L  +D                                 A+   K  NG   +H A K+N  K++  L     ++    ++G T +H AA     + ++ L    A  +  +  G + LH+AA+    + +RYL+  G  +DI+    +T  HIAS  G  E +  LL  GA   A    G T  H A R GH ET    L H  S+    K G      A +YG 
Sbjct:  248 GNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKT-KDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQ 579          

HSP 3 Score: 116.701 bits (291), Expect = 7.271e-27
Identity = 83/301 (27.57%), Postives = 137/301 (45.51%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKW 1284
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L   ++ ++   +   TALH AA        +++V   A+ + +   G +PLH+A K N ++ +  L+  G  +      G TP H+A+F G    +  L  +GA        G T  H A R G  + +   L +   VD   K  +     A R G         KAE+V    QL + K  W
Sbjct:  241 LHIAAHYGNINVATLLLNRGAAVDF-MARNDITPLHVAAKRGNGNMVKLLLDRGAK-IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLG---------KAEIV----QLLLQKGAW 526          

HSP 4 Score: 114.775 bits (286), Expect = 3.167e-26
Identity = 83/305 (27.21%), Postives = 144/305 (47.21%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +GN++    YLK+  ++  I  ++GL  LH+A K GH+ +V EL K GA  D   K        LH A   G  D+V  +V      +++   NG TP ++   E  LE ++ L  + A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   +  +L++ + +  +E   G +PLH+AA + ++     L++ G  +D       TP H+A+ +G    +  LLD GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   53 AGNLEKALDYLKTGVDIN-ICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATK---KGNTALHIASLAGQTDVVRELVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDH 348          

HSP 5 Score: 103.99 bits (258), Expect = 7.569e-23
Identity = 77/280 (27.50%), Postives = 121/280 (43.21%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            V+ +  LH+A + G  ++V+ L + GA    K   +Q   LH A   G  ++V+ ++ K   +  +  T+G TP H+ V EG  E   +L  + A  +   K G   +H A+K    +  + L       +    TG T LH AA  ++     +L+   A        G +PLH+AAK N LE    L+  G   +    +G +P H+A+ +G  + +  LL   A++      G T  H A +          LNH   VD   K G      A  YG
Sbjct:  466 VRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ-TALHIASRLGKAEIVQLLLQKGA-WASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYG 743          

HSP 6 Score: 96.6709 bits (239), Expect = 1.954e-20
Identity = 75/280 (26.79%), Postives = 127/280 (45.36%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++  D      +N  +  LH A   G+  + + IV K     ++   NG TP HI   +  ++ +++L  + A      ++G+  IH A+   H+ I++ L     + N     G+TALH AA       ++ L++  A + I+  +  + LH+A++    E ++ L+  G         G TP H+A  +G  E    LL++GA + A   +G T  H A + G  E     L    + D   K G      A  Y
Sbjct:  334 KNGLSPLHMATQGDHLNCVQLLLQH--DVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN-PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHY 610          

HSP 7 Score: 93.9745 bits (232), Expect = 1.343e-19
Identity = 67/255 (26.27%), Postives = 109/255 (42.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGS 1146
            LHVA   GH  + K +    A+   K   N   PLH AC    + ++E ++ K    + ++  +GLTP H+    G    +K L ++ A     +  G   +H A++     ++RYL      ++++    +TALH A+       +Q+L++  A  S     G +PLHLA +    E+   L+  G  +     +G TP H+A+  G  E    LL   A        G T  H A    +       L+H  S
Sbjct:  373 LHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRVKVMELLL-KHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGAS 625          

HSP 8 Score: 90.1225 bits (222), Expect = 2.386e-18
Identity = 75/303 (24.75%), Postives = 126/303 (41.58%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK 1224
            V  +L   G  + I   DG   L VA + GH  +V  L +       + P+     LH A    +      ++       D    +G TP HI    G +    +L N  A      +N +  +H A+KR +  +++ L D    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    ++D  A+  A    G T  H AC+    + +   L H  S+  + + G      A   GH  I ++
Sbjct:  157 VVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKSAALLLQND-HNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQ 453          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 119.013 bits (297), Expect = 1.094e-27
Identity = 79/275 (28.73%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GH      L ++GA            PLH A  +G I+  + ++ K     D+    GLTP H+           +L ++ A      KNG   +H A+K+N  +I   L +     N     G + LH AA   S   + +L+  NA++++ +  G +PLHLAA+ + +     L++ G  +D     G TP H+A   G  + + +LL+N A I +    G T  H A + GH   I+  L H  S +E+   G      ARR G+
Sbjct:  510 LHLAVREGHQETASLLLEHGASLSAAT-KKGFTPLHVAAKYGQIEAAKLLLQKRA-APDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGY 782          

HSP 2 Score: 117.472 bits (293), Expect = 3.783e-27
Identity = 93/334 (27.84%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYD---------------------------------ADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GNI+     L     V F+ + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ +    + S   NGL+P H+      L C+++L  +D                                 A+   K  NG   +H A K+N  K++  L     ++    ++G T +H AA     + ++ L    A  +  +  G + LH+AA+    + +RYL+  G  +DI+    +T  HIAS  G  E +  LL  GA   A    G T  H A R GH ET    L H  S+    K G      A +YG 
Sbjct:  220 GNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKT-KDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQ 551          

HSP 3 Score: 116.316 bits (290), Expect = 9.980e-27
Identity = 83/301 (27.57%), Postives = 137/301 (45.51%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKW 1284
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L   ++ ++   +   TALH AA        +++V   A+ + +   G +PLH+A K N ++ +  L+  G  +      G TP H+A+F G    +  L  +GA        G T  H A R G  + +   L +   VD   K  +     A R G         KAE+V    QL + K  W
Sbjct:  213 LHIAAHYGNINVATLLLNRGAAVDF-MARNDITPLHVAAKRGNGNMVKLLLDRGAK-IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLG---------KAEIV----QLLLQKGAW 498          

HSP 4 Score: 107.071 bits (266), Expect = 8.589e-24
Identity = 83/313 (26.52%), Postives = 145/313 (46.33%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIED--------NEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            +GN++    YLK+  ++  I  ++GL  LH+A K GH+ +V EL K GA  D   K        LH A   G  D+V  +V      +++   NG TP ++   E  LE ++ L  + A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   +  +L++ + +  +E         + G +PLH+AA + ++     L++ G  +D       TP H+A+ +G    +  LLD GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:   17 AGNLEKALDYLKTGVDIN-ICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATK---KGNTALHIASLAGQTDVVRELVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDH 320          

HSP 5 Score: 103.605 bits (257), Expect = 9.630e-23
Identity = 77/280 (27.50%), Postives = 121/280 (43.21%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            V+ +  LH+A + G  ++V+ L + GA    K   +Q   LH A   G  ++V+ ++ K   +  +  T+G TP H+ V EG  E   +L  + A  +   K G   +H A+K    +  + L       +    TG T LH AA  ++     +L+   A        G +PLH+AAK N LE    L+  G   +    +G +P H+A+ +G  + +  LL   A++      G T  H A +          LNH   VD   K G      A  YG
Sbjct:  438 VRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ-TALHIASRLGKAEIVQLLLQKGA-WASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYG 715          

HSP 6 Score: 96.2857 bits (238), Expect = 2.591e-20
Identity = 75/280 (26.79%), Postives = 127/280 (45.36%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++  D      +N  +  LH A   G+  + + IV K     ++   NG TP HI   +  ++ +++L  + A      ++G+  IH A+   H+ I++ L     + N     G+TALH AA       ++ L++  A + I+  +  + LH+A++    E ++ L+  G         G TP H+A  +G  E    LL++GA + A   +G T  H A + G  E     L    + D   K G      A  Y
Sbjct:  306 KNGLSPLHMATQGDHLNCVQLLLQH--DVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN-PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHY 582          

HSP 7 Score: 93.5893 bits (231), Expect = 1.505e-19
Identity = 67/255 (26.27%), Postives = 109/255 (42.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGS 1146
            LHVA   GH  + K +    A+   K   N   PLH AC    + ++E ++ K    + ++  +GLTP H+    G    +K L ++ A     +  G   +H A++     ++RYL      ++++    +TALH A+       +Q+L++  A  S     G +PLHLA +    E+   L+  G  +     +G TP H+A+  G  E    LL   A        G T  H A    +       L+H  S
Sbjct:  345 LHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRVKVMELLL-KHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGAS 597          

HSP 8 Score: 85.8853 bits (211), Expect = 5.168e-17
Identity = 77/319 (24.14%), Postives = 131/319 (41.07%), Query Frame = 1
Query:  295 LVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIV-------AKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK 1224
            + A  N   V  +L   G  + I   DG   L VA + GH  +V  L +       + P+     LH A    +      ++        +S     +   +G TP HI    G +    +L N  A      +N +  +H A+KR +  +++ L D    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    ++D  A+  A    G T  H AC+    + +   L H  S+  + + G      A   GH  I ++
Sbjct:  112 MAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA-----LHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQ 425          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 3.893e-27
Identity = 80/282 (28.37%), Postives = 127/282 (45.04%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV--KCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V  ++ +  + ID+   +GLTP H     G    +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+  + N +       G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  230 LHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQ-IDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQ 510          

HSP 2 Score: 105.531 bits (262), Expect = 3.189e-23
Identity = 85/317 (26.81%), Postives = 144/317 (45.43%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYD-----------LEI------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNE-GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEI 1158
            +GNID V  YLK   ++     ++GL  LH+A K GH+++V+EL + G+             LH A   G  ++V+ +V +    I++   NG TP ++   E  L+ ++ L     + +   ++G   +  A ++ H++++  L +           L I                  N +VQ  +G T LH AA   + +   +L+   A +     + G +PLH+A+K  +   +R L+  G  ID +   G TP H A+  G    +  LL+ GA ILA    G +  H A +G H E +   L H   VD++
Sbjct:   42 AGNIDKVLEYLKGGVDIG-TSNQNGLNALHLAAKEGHMDLVQELLERGSSVD-SATKKGNTALHIASLAGQAEVVKILVKQGAD-INAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDV 355          

HSP 3 Score: 100.523 bits (249), Expect = 1.122e-21
Identity = 73/275 (26.55%), Postives = 122/275 (44.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH++ + G L++   L + GA            PLH A  +G++D+ + ++ +     DS   NGLTP H+       +   +L +  A      KNG   +H A+K+N  +I   L   E   N+    G T LH A+         +L++  A +++    G + LHLAA+ + +     LV  G  +D +   G TP  +A   G  + +++LL + A + A    G T  H A + G+   I+  L +    + I   G      ARR G+
Sbjct:  530 LHISAREGQLDVASVLLEAGASHSLA-TKKGFTPLHVASKYGSLDVAKLLLQRRAP-PDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGY 802          

HSP 4 Score: 100.138 bits (248), Expect = 1.807e-21
Identity = 90/344 (26.16%), Postives = 142/344 (41.28%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDA---DFTVK---------------------DK-----------NGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            P+      GN++     L     V F  +++G+  LHVA K G+ N+V+ L   G+    K   +   PLH A   G+   VE ++ +    + +   NGL+P H+      +EC+K L  + A   D T+                      DK           NG   +H A K+N  K++  L     +I    ++G T +H AA     + + +L++  A   + +  G + LH+AA+   +E +R L+  G  +D R    +TP HIAS  G  E +  LL + A   A    G T  H + R G  +     L    S     K G      A +YG
Sbjct:  229 PLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAK-TRDGLTPLHCAARSGHDTAVELLLERGAPIL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYG 570          

HSP 5 Score: 92.8189 bits (229), Expect = 3.080e-19
Identity = 70/275 (25.45%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++       D  +  G T  H+    G++E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+A+K+ SL+  + L+    P D     G TP H+A+     +    LLD GA   A    G T  H A +    E     L +    + + K G      A + GH
Sbjct:  398 LHIACKKNRVKVMELLVKYGASIQAITESGL-TPIHVAAFMGHLNIVLLLLQNGAS-PDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGH 670          

HSP 6 Score: 78.9518 bits (193), Expect = 6.687e-15
Identity = 72/283 (25.44%), Postives = 121/283 (42.76%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLR-FIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K       ++  NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+TALH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  +    LL+ GA       +G T  H A + G  +     L      D   K G      A  Y
Sbjct:  324 KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHY 602          

HSP 7 Score: 78.1814 bits (191), Expect = 1.458e-14
Identity = 51/189 (26.98%), Postives = 91/189 (48.15%), Query Frame = 1
Query:  649 DFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNT---IGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            D    ++NG+  +H A+K  H  +++ L +   +++     G TALH A++      +++LVK  ADI+ +   G +PL++A++ N L+ +RYL+  G         G TP  IA  QG ++ +  LL+N       + +G       H A R    ++    L ++ + D  +K G      A  YG+
Sbjct:   57 DIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN-------DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGN 238          

HSP 8 Score: 74.3294 bits (181), Expect = 2.181e-13
Identity = 65/263 (24.71%), Postives = 106/263 (40.30%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            LH+A + G + +V+ L + GA    +   +Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+L+   +L    A  ++  K G                                  T LH A+   S    ++L++  A        G +PLH+AA +++ +    L+  G         G TP HIA+ +   E    LL   A+   +  +G T  H A + GH +     L     V+   K G
Sbjct:  464 LHMAARAGQVEVVRCLLRNGAMVDARAREDQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGF---------------------------------TPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSG 691          

HSP 9 Score: 62.003 bits (149), Expect = 1.351e-9
Identity = 40/160 (25.00%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  661 KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHN 1140
            K  +    +  A   N DK++ YL    ++I      G  ALH AA       +Q L++  + +     +G++ LH+A+     E ++ LV  G  I+ +   G TP ++AS +   + + +LL+NG +     ++G T    A + GH + +   L ++
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYLKG-GVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEND 187          

HSP 10 Score: 58.5362 bits (140), Expect = 1.752e-8
Identity = 48/174 (27.59%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  778 TALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            T+   AA   +   +   +K   DI   +  G + LHLAAK   ++ ++ L+  G  +D    +G T  HIAS  G  E +  L+  GADI A    G T  + A +  H + +   L + G+     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   34 TSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKV--RLPALHIAARKDD 205          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 117.087 bits (292), Expect = 6.489e-27
Identity = 79/275 (28.73%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GH      L ++GA            PLH A  +G I+  + ++ K     D+    GLTP H+           +L ++ A      KNG   +H A+K+N  +I   L +     N     G + LH AA   S   + +L+  NA++++ +  G +PLHLAA+ + +     L++ G  +D     G TP H+A   G  + + +LL+N A I +    G T  H A + GH   I+  L H  S +E+   G      ARR G+
Sbjct:  490 LHLAVREGHQETASLLLEHGASLSAATKKG-FTPLHVAAKYGQIEAAKLLLQKRAA-PDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGY 762          

HSP 2 Score: 115.931 bits (289), Expect = 1.283e-26
Identity = 83/301 (27.57%), Postives = 137/301 (45.51%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKW 1284
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L +  A    K KNG+  +H A++ +H   ++ L   ++ ++   +   TALH AA        +++V   A+ + +   G +PLH+A K N ++ +  L+  G  +      G TP H+A+F G    +  L  +GA        G T  H A R G  + +   L +   VD   K  +     A R G         KAE+V    QL + K  W
Sbjct:  193 LHIAAHYGNINVATLLLNRGAAVDF-MARNDITPLHVAAKRGNGNMVKLLLDRGAK-IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLG---------KAEIV----QLLLQKGAW 478          

HSP 3 Score: 114.39 bits (285), Expect = 3.864e-26
Identity = 94/342 (27.49%), Postives = 139/342 (40.64%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRD-GLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSP---------------------------------LHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+      GNI+     L     V F+ + D   LHVA K G+ N+VK L   GA    K   +   PLH     G+  +VE ++ +    + S   NGL+P H+      L C+++L  +D        + +  +H A+   H K+ + + D + N N +   G T LH A   N    +++L+K  A +      G +P                                 LH+AA+    + +RYL+  G  +DI+    +T  HIAS  G  E +  LL  GA   A    G T  H A R GH ET    L H  S+    K G      A +YG 
Sbjct:  192 PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAK-TKDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQ 531          

HSP 4 Score: 101.293 bits (251), Expect = 7.862e-22
Identity = 81/304 (26.64%), Postives = 140/304 (46.05%), Query Frame = 1
Query:  331 YLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIED--------NEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            YLK+  ++  I  ++GL  LH+A K GH+ +V EL K GA  D   K        LH A   G  D+V  +V      +++   NG TP ++   E  LE ++ L  + A  ++  ++G   +  A ++ HD+++  L + +    V+      ALH AA  +   +  +L++ + +  +E         + G +PLH+AA + ++     L++ G  +D       TP H+A+ +G    +  LLD GA I A   +G T  H   R GH + +   L+    +    K G +    A +  H
Sbjct:    6 YLKTGVDIN-ICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATK---KGNTALHIASLAGQTDVVRELVTNGAN-VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDH 300          

HSP 5 Score: 99.7525 bits (247), Expect = 2.330e-21
Identity = 77/281 (27.40%), Postives = 122/281 (43.42%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V+ +  LH+A + G  ++V+ L + GA    K   +Q   LH A   G  ++V+ ++ K   +  +  T+G TP H+ V EG  E   +L  + A  +   K G   +H A+K    +  + L       +    TG T LH AA  ++     +L+   A        G +PLH+AAK N LE    L+  G   +    +G +P H+A+ +G  + +  LL   A++      G T  H A +          LNH   VD   K G      A  YG+
Sbjct:  418 VRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ-TALHIASRLGKAEIVQLLLQKG-AWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGN 696          

HSP 6 Score: 94.7449 bits (234), Expect = 8.914e-20
Identity = 75/280 (26.79%), Postives = 127/280 (45.36%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            ++GL  LH+A +  HLN V+ L ++  D      +N  +  LH A   G+  + + IV K     ++   NG TP HI   +  ++ +++L  + A      ++G+  IH A+   H+ I++ L     + N     G+TALH AA       ++ L++  A + I+  +  + LH+A++    E ++ L+  G         G TP H+A  +G  E    LL++GA + A   +G T  H A + G  E     L    + D   K G      A  Y
Sbjct:  286 KNGLSPLHMATQGDHLNCVQLLLQH--DVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN-PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHY 562          

HSP 7 Score: 90.8929 bits (224), Expect = 1.315e-18
Identity = 67/255 (26.27%), Postives = 109/255 (42.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGS 1146
            LHVA   GH  + K +    A+   K   N   PLH AC    + ++E ++ K    + ++  +GLTP H+    G    +K L ++ A     +  G   +H A++     ++RYL      ++++    +TALH A+       +Q+L++  A  S     G +PLHLA +    E+   L+  G  +     +G TP H+A+  G  E    LL   A        G T  H A    +       L+H  S
Sbjct:  325 LHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLL-KHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGAS 577          

HSP 8 Score: 85.8853 bits (211), Expect = 4.672e-17
Identity = 57/218 (26.15%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  571 NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEK 1224
            +G TP HI    G +    +L N  A      +N +  +H A+KR +  +++ L D    I+ +   G T LH  A +     ++ML+   A I  +   G SPLH+A + + L  ++ L+   +P+D   N   T  H+A+  G ++    ++D  A+  A    G T  H AC+    + +   L H  S+  + + G      A   GH  I ++
Sbjct:  188 SGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQ 405          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.598e-29
Identity = 84/292 (28.77%), Postives = 143/292 (48.97%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDG-LLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKI-IRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGE 1173
            +GN++ VN  +    NV  + +R+   +H A   GH  +VK L   GAD  +K       PLH A A G++ +V  +++     ++  +  G T  H+    G+   +  L +  AD   +++ G   +H+A+   H  I +  L +   ++N Q   GK+ LH  AI    +  Q L++   +I   D EG++PLH+AA++     +  L+S G     R + G  P H+A+  GF +C   LL  G D+ AV++ G T  H A  GG+ E I+  L+    + + ++ G 
Sbjct:   57 NGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWK-DKKGYTPLHAAAASGHVTVVRLLLSLKAE-MNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGS 346          

HSP 2 Score: 83.1889 bits (204), Expect = 4.968e-17
Identity = 63/251 (25.10%), Postives = 111/251 (44.22%), Query Frame = 1
Query:  469 NQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHE-CLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIF 1218
            N + PLH A A   I   + ++   L  ++  D  G T  H     G LE + +L +  A+    DK   + +HWA    H ++++ L     ++N +   G T LH AA +   + +++L+   A+++  +  G++ LH+A  +     +  L+  G     R  RG T  H A+       CL  L+++ AD+ A   +G +  H     G        + + G +D  +K G      A RYGH ++ 
Sbjct:   13 NWQTPLHVASANRAIKCADALI-PLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLI 262          

HSP 3 Score: 78.5666 bits (192), Expect = 1.360e-15
Identity = 56/215 (26.05%), Postives = 100/215 (46.51%), Query Frame = 1
Query:  553 IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGET-IHCFLNHNGSVDEINKLGEN-LYQTA 1191
            +++ D N  TP H+      ++C   L    ++  V D+ G   +H A+   + +++  L     N+N      + A+H+A        ++ML+   AD++ +D +G +PLH AA    +  +R L+S    ++     G T  H+A   G    +  LLD GAD     + G T  H+A    HG   +   +NH+  V+  +  G++ L+ TA
Sbjct:    7 VNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTA 221          

HSP 4 Score: 74.7146 bits (182), Expect = 2.265e-14
Identity = 71/269 (26.39%), Postives = 105/269 (39.03%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGM------------------------------------QLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAA---------ITNSCSAIQMLVKCNADISIEDNEGSS---PLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGA 1044
            LH+A +YGH  ++  L   GAD   +  S+   PLH A   G  D    ++      +D++D  G T  H     G  EC+ +L +  AD   KD+ G                                      LI  AS     + + +L        ++   G TA HYAA         + +   A+Q L+       + D +  S   PLHLAA H   ++L  L+      D+R   GR P  +A+ +G  EC+  LL NGA
Sbjct:  250 LHIAARYGHELLINTLISNGADAARR-GSHGMFPLHLAALSGFSDCCRKLLTPGFD-VDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGSIAFVQDSGNSRYSCNVRTIAMRQSYNQHSHDTRICEPLICNASAAALHRCLEHLLQNGAEPALRDKQGYTAAHYAAAFGHRLCLELVSPAPALQQLLDMAGAELLRDPDSRSLVSPLHLAAYHGHHQALEVLLRFVGEADLRDGHGRAPLELAAARGHTECVETLLANGA 516          

HSP 5 Score: 73.559 bits (179), Expect = 5.450e-14
Identity = 52/192 (27.08%), Postives = 80/192 (41.67%), Query Frame = 1
Query:  640 YDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVI 1215
            + AD   +DKN    +H AS     K    L  L  N+NV    G+TALH+AA   +   + +L+   A+++  D      +H A      E ++ L+S G  ++ +  +G TP H A+  G    +  LL   A++      GNT  H AC  G    +   L+        N+ G      A    H  I
Sbjct:    3 HAADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAI 194          

HSP 6 Score: 71.2478 bits (173), Expect = 2.647e-13
Identity = 96/322 (29.81%), Postives = 134/322 (41.61%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYL--KSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACA--FGNIDLVEFIV-------AKSL-------------RF------------IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQ--NRGRTPSHI-------ASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGH 1107
            P+ +  ASG++  V   L  K+E N +F    +  LHVAC  G   +V EL   GAD G++   N+R    LH A A   G I L E +V       A+S              RF            ID  D  G TP HI    G    +  L +  AD   +  +GM  +H A+        R L     +++   + G+T LH AA   +   I +L+   AD+  +D  GS    +A   +S  S RY  +    I +RQ  N+    + I       AS    H CL  LL NGA+    + +G T  HYA   GH
Sbjct:  116 PLHAAAASGHVTVVRLLLSLKAEMN-EFNGFGNTALHVACHNGQDAVVSELLDAGADAGHR---NERGFTALHFAAASTHGAICL-ELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGS----IAFVQDSGNS-RYSCNVRT-IAMRQSYNQHSHDTRICEPLICNASAAALHRCLEHLLQNGAEPALRDKQGYTAAHYAAAFGH 426          

HSP 7 Score: 60.8474 bits (146), Expect = 4.973e-10
Identity = 37/113 (32.74%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  778 TALHYAAITNSCSAIQMLVKCNAD--ISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNG-ADILAVEDEGNTIGHYACRGGH 1107
            T LH A + ++ S  +ML+       +  +D +G +PLH AA  +++E  + L+S G  +D    RGRTP    + QG    + +L++N   D+   +D+ NT  H AC  GH
Sbjct:  687 TPLHCAVMNDNESCAEMLIDAMGAKIVMCQDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGH 799          

HSP 8 Score: 55.8398 bits (133), Expect = 1.693e-8
Identity = 48/195 (24.62%), Postives = 87/195 (44.62%), Query Frame = 1
Query:  415 IVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIV-AKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYD-LEININVQCDTGKTALHYA-AITNSCSAIQML--VKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPS 984
            ++++LC+       K+  N   PLH A    N    E ++ A   + +   D  G TP H       +EC ++L ++ A     D+ G   +   + +    I+ YL +  + ++++  D   TALH A    +   A+ +L  V+  A I   +    +PLHLAA++     ++ L+S G  +      G TP+
Sbjct:  673 LLEQLCQ-------KFEGNPFTPLHCAVMNDNESCAEMLIDAMGAKIVMCQDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGHETCALLLLEKVEVVALIDCPNRNQHTPLHLAARNGLSTVVQDLLSKGASVLALDENGHTPA 860          

HSP 9 Score: 55.4546 bits (132), Expect = 2.649e-8
Identity = 70/305 (22.95%), Postives = 123/305 (40.33%), Query Frame = 1
Query:  256 NFFVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFI-VQRDGLLHVACKYG---------HLNIVKELCKYGADCG-----YKYPSNQRIP----LHDACAFGNI------DLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTV--KDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVK-CNADISIEDNEGSSPLHLA-AKHNSLESLRYL--VSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNT 1077
            N FV+  + P+   V +G+ D V   +    N   + +Q+   LH   + G          +++V+ L  +    G     +  P   + P    LH   A   I        VE ++ +        + N  TP H  VM     C ++L +      V  +D  G   +H A+  ++ +  + L      ++     G+T L   A+      ++ LV     D+S+ D++ ++ LHLA  K +   +L  L  V     ID       TP H+A+  G    +  LL  GA +LA+++ G+T
Sbjct:  557 NLFVRTDRTPLMLAVTNGHTDCVLLLMDKGANPDAVDLQKHTALHRGVRLGPQDPVMNLVQISVVRRLRPHHPSGGGGCLLFSRPVLPQAPTNLYLHSQRALCKIYYNSHEACVELLLEQ---LCQKFEGNPFTPLHCAVMNDNESCAEMLIDAMGAKIVMCQDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGHETCALLLLEKVEVVALIDCPNRNQHTPLHLAARNGLSTVVQDLLSKGASVLALDENGHT 858          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 2.616e-29
Identity = 77/280 (27.50%), Postives = 135/280 (48.21%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            RDGL  LH A + GH  +++ L +  A    K   N   PLH A    ++  V+ ++ +    +D +  + LTP H+    G     K+L +   +   +  NG   +H A K+N  K++  L     +I+   ++G T +H A+     + +Q+L++  A  +  +  G +PLH+A++   LE ++ L+ +G  + ++    +TP HIAS  G  E +  LL  G+D  A    G+T  ++A R GHG+     L +   +  + K G      A +YG
Sbjct:  269 RDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAP-VDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYG 546          

HSP 2 Score: 115.546 bits (288), Expect = 2.470e-27
Identity = 83/293 (28.33%), Postives = 128/293 (43.69%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQ 1260
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L   DA    K KNG+  +H A++  H   ++ L   +  ++       T LH AA        ++L+    + +     G +PLH+A K N ++ +  L+  G  I      G TP H+ASF G    +  LL NGA   A    G T  H A R G  E +   L     V    +  +     A R G         KAE+V  + Q
Sbjct:  209 LHIAAHYGNMNVATLLLNLGAAVDFT-ARNGITPLHVAAKRGNNNMVKLLLDRGAK-IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLG---------KAEIVQLLLQ 490          

HSP 3 Score: 107.842 bits (268), Expect = 6.259e-25
Identity = 81/286 (28.32%), Postives = 140/286 (48.95%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            +GN++ +  +LK   ++    Q +GL  LH+A K GH+++V EL K  A  D   K  +     LH A   G  D+V  +V      I++   NG TP ++   E  LE +K L +  A+ +V  ++G   +  A ++ H++++  L + +    V+      ALH AA  +  +A  +L++   +  +    G +PLH+AA + ++     L++ G  +D     G TP H+A+ +G +  +  LLD GA I     +G T  H A R GH + I   L  +  +
Sbjct:   21 NGNLERLMDHLKGGMDINTCNQ-NGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTA---LHIAALAGQTDIVRVLVEFGAN-INAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLP----ALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI 297          

HSP 4 Score: 99.7525 bits (247), Expect = 2.406e-22
Identity = 74/278 (26.62%), Postives = 124/278 (44.60%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSI-DTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            L+ A + GH ++   L + GAD     P  ++   PLH A  +G +++   ++ K       +   NGLTP H+       +   +L +  A      KNG   +H A+K+N  ++ + L +L    N+    G   LH AA       + +L+  +A IS+    G + +HLAA+ + +     L      ++       TP H+AS  G  + +++LL N A + A    G T  H A + GH   ++  L H  S +E+   G      ARR G+
Sbjct:  506 LYFASREGHGDVASLLLENGADIS---PVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGY 780          

HSP 5 Score: 79.337 bits (194), Expect = 8.560e-16
Identity = 61/225 (27.11%), Postives = 93/225 (41.33%), Query Frame = 1
Query:  550 FIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIG-------HYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            F  S  ++  T        G LE L        D    ++NG+  +H ASK  H  ++  L   E  I+     G TALH AA+      +++LV+  A+I+ +   G +PL++AA+ N LE +++L+  G    +    G TP  +A  QG  + +  LL           E +T G       H A R          L H  + D  +K G      A  YG
Sbjct:    3 FALSFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL-----------ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYG 216          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 2.982e-29
Identity = 77/280 (27.50%), Postives = 135/280 (48.21%), Query Frame = 1
Query:  370 RDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            RDGL  LH A + GH  +++ L +  A    K   N   PLH A    ++  V+ ++ +    +D +  + LTP H+    G     K+L +   +   +  NG   +H A K+N  K++  L     +I+   ++G T +H A+     + +Q+L++  A  +  +  G +PLH+A++   LE ++ L+ +G  + ++    +TP HIAS  G  E +  LL  G+D  A    G+T  ++A R GHG+     L +   +  + K G      A +YG
Sbjct:  276 RDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAP-VDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYG 553          

HSP 2 Score: 115.546 bits (288), Expect = 2.587e-27
Identity = 83/293 (28.33%), Postives = 128/293 (43.69%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQ 1260
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V+ ++ +  + ID+   +GLTP H     G  + +++L   DA    K KNG+  +H A++  H   ++ L   +  ++       T LH AA        ++L+    + +     G +PLH+A K N ++ +  L+  G  I      G TP H+ASF G    +  LL NGA   A    G T  H A R G  E +   L     V    +  +     A R G         KAE+V  + Q
Sbjct:  216 LHIAAHYGNMNVATLLLNLGAAVDFT-ARNGITPLHVAAKRGNNNMVKLLLDRGAK-IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLG---------KAEIVQLLLQ 497          

HSP 3 Score: 104.375 bits (259), Expect = 9.497e-24
Identity = 84/293 (28.67%), Postives = 143/293 (48.81%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVK--CNADISIE------DNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            GN++ +  +LK   ++    Q +GL  LH+A K GH+++V EL K  A  D   K  +     LH A   G  D+V  +V      I++   NG TP ++   E  LE +K L +  A+ +V  ++G   +  A ++ H++++  L + +    V+      ALH AA  +  +A  +L++   NAD++ +         G +PLH+AA + ++     L++ G  +D     G TP H+A+ +G +  +  LLD GA I     +G T  H A R GH + I   L  +  +
Sbjct:   21 GNLERLMDHLKGGMDINTCNQ-NGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTA---LHIAALAGQTDIVRVLVEFGAN-INAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLP----ALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI 304          

HSP 4 Score: 101.679 bits (252), Expect = 6.489e-23
Identity = 75/277 (27.08%), Postives = 124/277 (44.77%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            L+ A + GH ++   L + GAD     P  ++   PLH A  +G +++   ++ K     D    NGLTP H+       +   +L +  A      KNG   +H A+K+N  ++ + L +L    N+    G   LH AA       + +L+  +A IS+    G + +HLAA+ + +     L      ++       TP H+AS  G  + +++LL N A + A    G T  H A + GH   ++  L H  S +E+   G      ARR G+
Sbjct:  513 LYFASREGHGDVASLLLENGADIS---PVTKKGFTPLHIASKYGRLEVATLLLEK-YASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGY 785          

HSP 5 Score: 101.293 bits (251), Expect = 9.592e-23
Identity = 71/275 (25.82%), Postives = 123/275 (44.73%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L K+GA   +    +   P+H A   G++++V+ ++       ++ +  G TP H+    G+LE +K L    A   VK +     +H AS+    +I++ L     + N    +G T L++A+         +L++  ADIS    +G +PLH+A+K+  LE    L+      D +   G TP H+A+     +    LLD GA   +    G T  H A +    E     L      + + + G      A + GH
Sbjct:  381 LHIACKKNRIKVMELLLKHGASI-HTTTESGLTPIHVASFMGHLNVVQLLLQNGASS-NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGH 653          

HSP 6 Score: 94.7449 bits (234), Expect = 1.145e-20
Identity = 73/274 (26.64%), Postives = 115/274 (41.97%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G L +VK L + GA  G K   +Q  PLH A   G  ++V+ ++ +     ++   +G TP +    EG  +   +L    AD +   K G   +H ASK    ++   L +   + + +   G T LH A   +      +L+   A        G +PLH+AAK N LE  + L+  G   ++   +G  P H+A+ +G  + +  LL   A I      G T  H A +            H   V+   KL       A  YG
Sbjct:  447 LHMASRAGQLEVVKTLLQSGARVGVKAREDQ-TPLHIASRLGKAEIVQLLLQRG-SDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYG 718          

HSP 7 Score: 70.4774 bits (171), Expect = 5.031e-13
Identity = 61/260 (23.46%), Postives = 101/260 (38.85%), Query Frame = 1
Query:  553 IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSP-----------------------------LHLAAKHNSLESLRYL--------VSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            I++ + NGL   H+   EG ++ +  L   +A+     K G   +H A+      I+R L +   NIN Q   G T L+ AA  N    ++ L+   A+ S+   +G +P                             LH+AA+ +   +   L        V++ + ++     G TP HIA+  G       LL+ GA +      G T  H A + G+   +   L+    +D   + G      A R GH  + E
Sbjct:   36 INTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIE 295          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.416e-25
Identity = 79/281 (28.11%), Postives = 131/281 (46.62%), Query Frame = 1
Query:  367 QRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            ++DGL  LH A + GH  +V+ L + GA    K   N   PLH A    +++ V+ ++ +    +D I  + LT  H+    G     K+L +  A+  V+  NG   +H A K+N  +++  L     +I    ++G T +H +A   + + + +L++  A  +  +  G + LH+AA+    E +R L+  G  +D +    +TP HIA+  G  E +  LL + A   A    G T  H A R GH +     L H  S+    K G      A +YG
Sbjct:    3 RQDGLTPLHCAARSGHEQVVEILLEQGAPILAKT-KNGLSPLHMATQGDHVECVQ-VLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYG 281          

HSP 2 Score: 101.293 bits (251), Expect = 9.723e-23
Identity = 71/242 (29.34%), Postives = 107/242 (44.21%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            PLH A   G+  +VE ++ +    +     NGL+P H+      +EC+++L  Y A       + +  +H A+   H +  + L D   N NV+   G T LH A   N    +++L+K  A I      G +P+H++A   +L  +  L+  G   +    RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H  S D     G      A R GH
Sbjct:    9 PLHCAARSGHEQVVEILLEQGAPILAKTK-NGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGH 249          

HSP 3 Score: 99.3673 bits (246), Expect = 4.701e-22
Identity = 73/280 (26.07%), Postives = 118/280 (42.14%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            V+ +  LH+A + G   +V+ L + GA    K    Q  PLH A   G +++V+ ++ + +   D+  +NG TP H+   EG  +   IL  + A   V  K G   +H ASK    ++   L     + +     G T LH A+  ++     +L+   A        G +PLH+AAK + LE    L+  G   +    +G  P H+ + +G  +    LL   AD+      G +  H A +          + H   V+   KLG      A  YG
Sbjct:  169 VRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQ-TPLHIAARLGKLEIVQLLL-QHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYG 446          

HSP 4 Score: 98.9821 bits (245), Expect = 6.405e-22
Identity = 73/283 (25.80%), Postives = 122/283 (43.11%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAK 1230
            LHVA + GH ++   L ++GA            PLH A  +G +++   ++ +     D+   NGLTP H+       +   +L +  A      KNG   +H A+K++  +I   L +     N     G   LH  A         +L+   AD++     G SPLHLAA+ + +     LV  G  ++     G TP  +A   G  + +++LL +GAD+ +    G T  H A + GH   ++  L      +++   G      ARR G+  + +  K
Sbjct:  241 LHVAAREGHEDVTAILLEHGASLAVTT-KKGFTPLHVASKYGKMEVASLLLQR-FASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 521          

HSP 5 Score: 91.2781 bits (225), Expect = 1.562e-19
Identity = 68/275 (24.73%), Postives = 116/275 (42.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H +   GN+++V  I+ +     ++ +  G T  H+    G+ E ++ L    A    K +     +H A++    +I++ L     + +     G T LH AA         +L++  A +++   +G +PLH+A+K+  +E    L+      D     G TP H+AS     +    LLD GA   A    G T  H A +    E     L +    + I + G        + GH
Sbjct:  109 LHIACKKNRIRVMELLLKYGASIEAVTESG-LTPMHVSAFMGNLNIV-LILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGH 381          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008561.1 (pep scaffold:Pmarinus_7.0:GL477362:121892:134159:-1 gene:ENSPMAG00000007756.1 transcript:ENSPMAT00000008561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 5.644e-23
Identity = 57/200 (28.50%), Postives = 102/200 (51.00%), Query Frame = 1
Query:  505 GNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGG 1104
            G+ + V  +++K        D  G T  H+ V++G  +CL ++ ++ AD  + D +G+ ++H A+K  H + +R L   +  + V   +G TALH+AAI+     +Q L    A +   D EG + L LA +   +E  ++L+  G  ++      +T   +A   G    +  LL +GA+ + V+  G++  HYACR G
Sbjct:   16 GDAEKVALLLSKKGISATRPDGEGRTALHLAVIKGSSDCLDVMLSHGADVGLLDPSGLSVLHLAAKNGHTQCVRKLIQHKYPVEVVDPSGLTALHHAAISGIVPCVQFLCDQKAFVDARDLEGHTALALAGRLGRVEVCKHLLDRGADVNAFNKELKTVLMLACEGGHLATVELLLKHGAEPMVVDSVGHSALHYACRSG 215          

HSP 2 Score: 80.1073 bits (196), Expect = 2.617e-17
Identity = 58/228 (25.44%), Postives = 93/228 (40.79%), Query Frame = 1
Query:  667 KNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHW---------------------------------LLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCS 1251
            K G +L+    + + +K+   L    I+       G+TALH A I  S   + +++   AD+ + D  G S LHLAAK+   + +R L+    P+++    G T  H A+  G   C+ +                                 LLD GAD+ A   E  T+   AC GGH  T+   L H      ++ +G +    A R G+P +    + A  + S
Sbjct:    4 KYGDRLLQAVEQGDAEKVALLLSKKGISATRPDGEGRTALHLAVIKGSSDCLDVMLSHGADVGLLDPSGLSVLHLAAKNGHTQCVRKLIQHKYPVEVVDPSGLTALHHAAISGIVPCVQFLCDQKAFVDARDLEGHTALALAGRLGRVEVCKHLLDRGADVNAFNKELKTVLMLACEGGHLATVELLLKHGAEPMVVDSVGHSALHYACRSGNPTMLTLVQSATRMSS 231          

HSP 3 Score: 56.225 bits (134), Expect = 2.607e-9
Identity = 43/173 (24.86%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAK 900
            LH+A   G  + +  +  +GAD G   PS   + LH A   G+   V  ++      ++ +D +GLT  H   + G + C++ L +  A    +D  G   +  A +    ++ ++L D   ++N      KT L  A      + +++L+K  A+  + D+ G S LH A +
Sbjct:   43 LHLAVIKGSSDCLDVMLSHGADVGLLDPSGLSV-LHLAAKNGHTQCVRKLIQHKYP-VEVVDPSGLTALHHAAISGIVPCVQFLCDQKAFVDARDLEGHTALALAGRLGRVEVCKHLLDRGADVNAFNKELKTVLMLACEGGHLATVELLLKHGAEPMVVDSVGHSALHYACR 213          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 64.3142 bits (155), Expect = 2.701e-11
Identity = 56/214 (26.17%), Postives = 96/214 (44.86%), Query Frame = 1
Query:  367 QRDGLL---HVACKYGHLNIVKELCKYGA--DCGYKYPSNQRIP-LHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRY-LYDLE----ININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGR 975
            + D LL   H AC+ G L  VKE+  +G   +      S + I  LH A     + +V+F+V++             TP H     G +  +  L  + AD T+ D  G  L+H +   ++  ++ Y L+++     ++I+ +   G+T+L +AA       +  L+K  A I I D EG +PLH          L+YL+  G     + + G+
Sbjct:   69 EEDPLLTRYHTACQRGDLATVKEMI-HGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGK 281          

HSP 2 Score: 63.929 bits (154), Expect = 3.721e-11
Identity = 53/219 (24.20%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  685 IHWASKRNHDKIIRYLYDLEININVQCDT-GKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYL----VSTGI-PIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARR------------------YGHPV--IFEKAKKAEVVCSICQL 1263
            +HWAS  N   ++ +L     ++N +      T LH+AA       +  L+K  AD ++ D++G + LHL+   +++  + Y+    VS G+  ID R  +GRT    A++QG    +  LL  GA I   + EG T  H+    G    +   +       +    G++ +  A+                   +G+P+   F+K++ A++V  I   
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKKSQHAKLVTFITPF 331          

HSP 3 Score: 55.4546 bits (132), Expect = 1.377e-8
Identity = 41/152 (26.97%), Postives = 67/152 (44.08%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFI----VAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQ 825
            LH A +YG++ IV  L K+GAD          + LH +    NI LV ++    V+K L  ID  D  G T       +G+   +  L  + A   + D  G   +HW + +    +++YL     +   + DTGK     A   N+  +++
Sbjct:  147 LHWAARYGYVYIVDFLLKHGADPTMTDDQGFNL-LHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR 297          

HSP 4 Score: 51.9878 bits (123), Expect = 1.568e-7
Identity = 43/186 (23.12%), Postives = 76/186 (40.86%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELE-CLKILKNYDA----DFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLR 924
            LH A     L++V  L   GAD   +  +    PLH A  +G + +V+F++          D  G    H+ V    +   L +L N  +    D   +D  G   + WA+ +     +  L     +I +    G T LH+  +      ++ L++  AD   + + G     +A + N++ SLR
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGAD-PTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR 297          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 61.2326 bits (147), Expect = 2.624e-10
Identity = 61/253 (24.11%), Postives = 111/253 (43.87%), Query Frame = 1
Query:  391 ACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRF-------IDSI----DTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNA-DISIEDNE-GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNR-GRTPSHIASFQGFHECLHWLLDNGADILAVEDEG--NTIGHYACRG 1101
            AC   +  I++EL  +   C +++ + +R PLH +C +G  ++ + I+     +       ID +    D   LTP H+CV+    +  ++L                                L  L+ N+ ++     + LH A   N+   + +L+     DI+ +DNE   +PL+LA + N  E+   L+  G  ++IR+   G T   +A+ +GF + +  L+ N A+   +EDEG    + H   RG
Sbjct:  403 ACTLSY--ILEELPIHLRPCLFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVL--------------------------------LQSLDPNVKLK---SSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNAN-FDIEDEGGWTPMEHAVLRG 617          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 58.5362 bits (140), Expect = 3.023e-10
Identity = 59/236 (25.00%), Postives = 97/236 (41.10%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAK--SLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYD--LEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTG-IPIDIRQNRGRTPSHIASFQGFHECLHWLLDN-GADILAVEDEG 1071
            LH AC       V+EL         +   + RIPLH + +F   ++  F+++K  ++   D  D +G TP HI    G LE                                 +++ LYD  L+ ++N   + G T LH A         Q L++  A + I+D     PLH AA   SL+ +  L   G   ++ +  +G TP   A  +G  +    L++  GA+   V+++G
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLE---------------------------------VVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 59.6918 bits (143), Expect = 7.562e-10
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  685 IHWASKRNHDKIIRYLYDLEININVQCDTG-KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVST------GIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKA 1227
            +HWA   N   + ++L     N N     G  TALH+AA   +   + +L+K  AD +++D +G + +H +   +++  + Y++         + ID + N  RTP   A++QG    +  LL  G+ +   ++ G    H A  GG    I   +    +  E N   ++ +  A   G   +FE+A
Sbjct:   88 LHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQA 275          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 53.9138 bits (128), Expect = 3.130e-8
Identity = 36/157 (22.93%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  484 LHDACAFGNIDLVEFIVAKSLRFIDSIDT-NGLTPAHICVMEGE-LECLKILK-NYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYD-LEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTG 942
            L +A   GN+ +V+ ++ ++   + +ID+ NG +  H     G  L C+ +++  +D    +K   G   +H A  + H++ +  L       IN + + G+  +H A + +    + +L+   AD+ + D  G +PLH+  ++ S+  ++ L++ G
Sbjct:    9 LREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165          

HSP 2 Score: 46.9802 bits (110), Expect = 4.494e-6
Identity = 40/144 (27.78%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  715 KIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADIS--IEDNEGSSPLHLAAKHNSLESLRYLVSTGIP--IDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLN 1134
            +++R   DL  NI+   + G ++LHYA+          L++   D    I+  +G++ +HLA      ++L  L+    P  I+ R   GR P HIA    +++CL  L+  GAD+  ++  G+T  H     G    +   LN
Sbjct:   23 RLLRRNPDLLTNID--SENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQ-FPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLN 163          

HSP 3 Score: 46.595 bits (109), Expect = 5.788e-6
Identity = 43/167 (25.75%), Postives = 75/167 (44.91%), Query Frame = 1
Query:  595 CVMEGELECLKIL--KNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININ--VQCDTGKTALHYAAITNSCSAIQMLVKCNAD-ISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADIL--AVEDEGN 1074
             ++EG L  +K L  +N D    +  +NG   +H+AS      I  YL  L  + +  ++   G T +H A +      + +L++     I+     G +P+H+A  ++  + L  L+  G  + +    G TP H+    G   C+  LL+ G   L   V D+GN
Sbjct:   12 AIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGN 178          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 105.916 bits (263), Expect = 3.768e-26
Identity = 72/225 (32.00%), Postives = 116/225 (51.56%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHD-KIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGS---SPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGA 1044
            LH+AC  G     K+L  YG D   K  +N R PLH A   GN++ +E +++++  F + ID  G  P H         C+  L    ++    D      +H+A+  + D K + +L     N + +   G +A+HYA+      AI+ML+  +A+  +  + GS   +PLHLAA H    +L  L+ +   +++R +RGRTP  +ASFQG  EC+  LL++ A
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAK-DNNDRTPLHCAACSGNVNCLELLMSQAGDF-NCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 2 Score: 66.2402 bits (160), Expect = 1.870e-12
Identity = 56/226 (24.78%), Postives = 85/226 (37.61%), Query Frame = 1
Query:  577 LTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHN----------------------SLESLRYLVSTGIPIDIRQ----------NRGR-----TPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNG 1143
            + P H+  + G  EC K L  Y  D   KD N    +H A+   +   +  L     + N     G+  LHYAA   +   +  LV   ++++  D +  +PLH AA  +                         ++ Y  + G  + I            NR       TP H+A+F G    L  L+ +  D+   +D G T    A   GH E + C LNHN 
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 76.2554 bits (186), Expect = 3.932e-16
Identity = 53/191 (27.75%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  391 ACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNG-----LTPAHICVME-GELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLY-DLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTG 942
            AC+ G  + V++L +          ++   PLH A    ++D+V+ ++         +D  G       P  IC  +   +E  ++L    AD  + +  G   +H A++R H K++  L  D ++++NV      T+LH AA+  S   I+ L+ C A+I+ +DN+G +  HLAA+    E L+ L+ TG
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGA----DVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 2 Score: 71.633 bits (174), Expect = 1.679e-14
Identity = 50/187 (26.74%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  493 ACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIH---WASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVK-CNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNG 1041
            AC  G  D V  ++  +L  ++++D +G +P H       ++ +++L +  AD  V+    +Q I     A+K N  +  R L     ++N+    G+TALH+A        +++L++    D+++ D + ++ LH+AA   S   ++ L+  G  I  + N G T  H+A+ +G  E L  LL  G
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 3 Score: 61.2326 bits (147), Expect = 4.975e-11
Identity = 45/162 (27.78%), Postives = 74/162 (45.68%), Query Frame = 1
Query:  748 NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDN---EGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNG-ADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            N+N     G + LHYA  TN    +QML+   AD+ +  +   +   P+  AAK N++ES R L+  G  ++I    G+T  H A+ +G  + +  LL +G  D+  V+ +  T  H A   G    I   L    ++   +  G   +  A R G   + +
Sbjct:   21 NLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQ 182          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 73.1738 bits (178), Expect = 9.408e-15
Identity = 55/190 (28.95%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPI 951
            LHVACK G + + + L + GA    K    +  PLH A   G+ D ++F+++K +  ID  D +  TP    V  G  E   +L         KD+N    +H A        +  L    ++ N + + G++ALH AA++     +  L++  ADI+  D+   +PL  AAK  S+++   L+ +G  I
Sbjct:   40 LHVACKKGSMEVGRLLVEKGAALDKKNDKGE-TPLHMAACIGSFDALKFLLSKGV-AIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 62.7734 bits (151), Expect = 2.559e-11
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:  751 INVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADI 1050
            +N   DTG +ALH+A   N   A+  L++   + SIED   S+PLH+A K  S+E  R LV  G  +D + ++G TP H+A+  G  + L +LL  G  I
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIR---NGSIEDL--STPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAI 95          

HSP 3 Score: 55.8398 bits (133), Expect = 6.462e-9
Identity = 47/180 (26.11%), Postives = 81/180 (45.00%), Query Frame = 1
Query:  664 DKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            D  G   +H A++ N  + +      E+  N   +   T LH A    S    ++LV+  A +  ++++G +PLH+AA   S ++L++L+S G+ ID R    RTP   A   G  E    LL+        E++ + + H AC  G    +        S +E ++ G++    A   G
Sbjct:    5 DDTGFSALHHATRYNRVEAM-----AELIRNGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD------ENQKSPL-HLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSG 172          

HSP 4 Score: 51.9878 bits (123), Expect = 1.347e-7
Identity = 44/190 (23.16%), Postives = 77/190 (40.53%), Query Frame = 1
Query:  580 TPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSV 1149
            TP H+   +G +E  ++L    A    K+  G   +H A+       +++L    + I+ +  + +T    A          +L++       +D    SPLHLA        +  L   G+  + R   G++  H+A+  GF + +  LL  GADI A +    T    A + G  +T    L    S+
Sbjct:   38 TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO34823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB2])

HSP 1 Score: 73.559 bits (179), Expect = 8.109e-14
Identity = 53/171 (30.99%), Postives = 87/171 (50.88%), Query Frame = 1
Query:  529 IVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYL-YDLEININVQCDTGKTALHYAAITNSCSAIQML-VKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQ--NRGRTPSHIASFQGFHECLHWL 1029
            IVA S   ++   T+G TP ++   +G  +CLK L    A   +  ++GM  IH A++  H   + YL     +++  +  TG T  HYAA     S ++ L V+C  D+ I+D+ G +PLH AA+   L  LR+LV   + +D+R   +   +P  +A   G   C  ++
Sbjct:   20 IVASS---VNESATDGTTPLYLAAQDGNFDCLKFLHGVGAKCNITSRDGMHPIHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKWLNVRC--DVKIKDSLGGTPLHDAAEKGQLHCLRFLVEV-VHLDVRSKDSSNTSPIDLAERYGHVTCHEYM 184          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO47344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMH4])

HSP 1 Score: 68.1662 bits (165), Expect = 1.470e-13
Identity = 51/161 (31.68%), Postives = 79/161 (49.07%), Query Frame = 1
Query:  664 DKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADIS-IEDNE---GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEG-NTIGHYACRGGHGETIHCFL 1131
            D  G   I  A++    + +R L D   N++++    KT LHYA          + VK   +IS +  N    G++PLH AA+H  + ++  + +    I +R  +G+TP H A+ QG  + L  +L+N  D L V D+  NT  H A  GGH E +   L
Sbjct:    5 DHLGRTPIMLAAENGCFESVRVLLDHNANVDIRDSENKTVLHYAIGVAEILKEILKVKAGTEISRLTSNNYRLGNTPLHYAARHGYISTIHEMFT----IYLRDVQGQTPLHYAARQGSKKALELILENKPDCLNVTDKNQNTAIHMAALGGHAEILEFLL 161          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 120.168 bits (300), Expect = 4.724e-28
Identity = 80/280 (28.57%), Postives = 127/280 (45.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V  ++ +  + ID+   +GLTP H     G    +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  230 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVRLLLDRGSQ-IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQ 507          

HSP 2 Score: 112.464 bits (280), Expect = 1.426e-25
Identity = 89/302 (29.47%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+V+ L   G+    K   +   PLH A   G+   VE ++ K    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  237 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKT-RDGLTPLHCAARSGHEASVEVLLEKGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 535          

HSP 3 Score: 110.153 bits (274), Expect = 8.988e-25
Identity = 83/317 (26.18%), Postives = 141/317 (44.48%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEI-----------------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GNID V  YLK   ++    Q +GL  LH+A K GH+++V+EL   GA             LH +   G  ++V+ +V +    I++   NG TP ++   E  L+ ++ L     + +   ++G   +  A ++ H++++  L + +                              N +VQ  +G T LH AA   + +   +L+   A +      G +PLH+A+K  +   +R L+  G  ID +   G TP H A+  G    +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:   42 AGNIDKVLEYLKGGVDISTCNQ-NGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGN-TALHISSLAGQAEVVKTLVKRGAD-INAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 355          

HSP 4 Score: 105.531 bits (262), Expect = 2.448e-23
Identity = 75/274 (27.37%), Postives = 119/274 (43.43%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G   +V+ L + GA    +   +Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+LE   +L    A  ++  K G   +H  SK     + + L   +   +     G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G TP H+AS +G  +    L+  GA I      G T  H A +          + +  ++D   KLG      A  YG
Sbjct:  461 LHMAARAGQAEVVRCLLRNGAMVDARAREDQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYG 732          

HSP 5 Score: 101.293 bits (251), Expect = 6.929e-22
Identity = 74/275 (26.91%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH++ + G L     L + GA            PLH    +G++D+ + ++ +     DS   NGLTP H+       +   +L +  A      KNG   +H A+K+N   I   L       N     G T LH A+         +L+   A I++    G + LHLAA+ + +     LV  G  +D +   G TP  +A   G  + + +LL NGA + A    G T  H A + G+   I+  L H    + +   G      ARR G+
Sbjct:  527 LHISAREGQLETASVLLEAGASHSLATKKG-FTPLHVVSKYGSLDVAKLLLQRQAP-PDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGY 799          

HSP 6 Score: 92.8189 bits (229), Expect = 2.752e-19
Identity = 67/275 (24.36%), Postives = 117/275 (42.55%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G+ E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+ +K+ SL+  + L+    P D     G TP H+A+     +    LLD GA        G T  H A +    +     L +    + + K G      A + GH
Sbjct:  395 LHIACKKNRVKVMELLVKYGASIQAVTESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGH 667          

HSP 7 Score: 88.1965 bits (217), Expect = 8.308e-18
Identity = 78/298 (26.17%), Postives = 126/298 (42.28%), Query Frame = 1
Query:  337 KSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGS---SPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            KS+ N  F+         A + G+++ V E  K G D       N    LH A   G++DLV+ ++ +    +DS    G T  HI  + G+ E +K L    AD   + +NG   ++ A++ NH  ++RYL +   N +   + G T L  A        + +L++        D +G      LH+AA+ +  +S   L+      D++   G TP HIA+  G       LL+ GA +      G T  H A + G+   +   L+    +D   + G      A R GH    E
Sbjct:   29 KSDSNTSFLR--------AARAGNIDKVLEYLKGGVDIS-TCNQNGLNALHLAAKEGHMDLVQELLDRGAP-VDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVE 309          

HSP 8 Score: 81.6481 bits (200), Expect = 1.076e-15
Identity = 77/311 (24.76%), Postives = 130/311 (41.80%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+   V   L+ +G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+T+LH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  E    LL+ GA       +G T  H   + G  +     L      D   K G      A  Y
Sbjct:  295 PLHCAARSGHEASVEVLLE-KGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHY 599          

HSP 9 Score: 61.2326 bits (147), Expect = 2.318e-9
Identity = 49/174 (28.16%), Postives = 77/174 (44.25%), Query Frame = 1
Query:  778 TALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            T+   AA   +   +   +K   DIS  +  G + LHLAAK   ++ ++ L+  G P+D    +G T  HI+S  G  E +  L+  GADI A    G T  + A +  H + +   L + G+     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   34 TSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKV--RLPALHIAARKDD 205          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 120.168 bits (300), Expect = 5.370e-28
Identity = 80/280 (28.57%), Postives = 127/280 (45.36%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            LH+A  YG++N+   L   GA   +    N   PLH A   GN ++V  ++ +  + ID+   +GLTP H     G    +++L    A    + KNG+  +H A++ +H + +++L   +  ++       TALH AA        ++L+   A+ +     G +PLH+A K N ++ +  LV  G  I      G TP H+A+F G    +  LL NGA        G T  H A R G  E + C L +   VD   +  +     A R G   I +
Sbjct:  245 LHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVRLLLDRGSQ-IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQ 522          

HSP 2 Score: 112.464 bits (280), Expect = 1.481e-25
Identity = 89/302 (29.47%), Postives = 133/302 (44.04%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            GN++ V + L + G       R+G+  LHVA K G+ N+V+ L   G+    K   +   PLH A   G+   VE ++ K    + +   NGL+P H+      +EC+K L  + A       + +  +H A+   H ++ + L D   N N +   G T LH A   N    +++LVK  A I      G +P+H+AA    L  +  L+  G   D+   RG T  H+A+  G  E +  LL NGA + A   E  T  H A R G  E +   L H    D     G      + R G 
Sbjct:  252 GNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKT-RDGLTPLHCAARSGHEASVEVLLEKGAPLL-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 550          

HSP 3 Score: 109.768 bits (273), Expect = 1.030e-24
Identity = 83/317 (26.18%), Postives = 141/317 (44.48%), Query Frame = 1
Query:  304 SGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEI-----------------------------NINVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEIN 1161
            +GNID V  YLK   ++    Q +GL  LH+A K GH+++V+EL   GA             LH +   G  ++V+ +V +    I++   NG TP ++   E  L+ ++ L     + +   ++G   +  A ++ H++++  L + +                              N +VQ  +G T LH AA   + +   +L+   A +      G +PLH+A+K  +   +R L+  G  ID +   G TP H A+  G    +  LL+ GA +LA    G +  H A +G H E +   L H   VD++ 
Sbjct:   57 AGNIDKVLEYLKGGVDISTCNQ-NGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGN-TALHISSLAGQAEVVKTLVKRGAD-INAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT 370          

HSP 4 Score: 105.531 bits (262), Expect = 2.802e-23
Identity = 75/274 (27.37%), Postives = 119/274 (43.43%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A + G   +V+ L + GA    +   +Q  PLH A   G  ++V+ ++ + +   D+  TNG TP HI   EG+LE   +L    A  ++  K G   +H  SK     + + L   +   +     G T LH AA  ++     +L+   A        G +PLH+AAK N ++    L+  G   +    +G TP H+AS +G  +    L+  GA I      G T  H A +          + +  ++D   KLG      A  YG
Sbjct:  476 LHMAARAGQAEVVRCLLRNGAMVDARAREDQ-TPLHIASRLGKTEIVQLLL-QHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYG 747          

HSP 5 Score: 100.908 bits (250), Expect = 7.857e-22
Identity = 74/275 (26.91%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH++ + G L     L + GA            PLH    +G++D+ + ++ +     DS   NGLTP H+       +   +L +  A      KNG   +H A+K+N   I   L       N     G T LH A+         +L+   A I++    G + LHLAA+ + +     LV  G  +D +   G TP  +A   G  + + +LL NGA + A    G T  H A + G+   I+  L H    + +   G      ARR G+
Sbjct:  542 LHISAREGQLETASVLLEAGASHSLATKKG-FTPLHVVSKYGSLDVAKLLLQRQAP-PDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGY 814          

HSP 6 Score: 92.8189 bits (229), Expect = 3.228e-19
Identity = 67/275 (24.36%), Postives = 117/275 (42.55%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK   + +++ L KYGA       S    P+H A   G++++V  ++ ++    D  +  G T  H+    G+ E ++ L    A    + +     +H AS+    +I++ L     + +     G T LH +A         +L++  A  S+   +G +PLH+ +K+ SL+  + L+    P D     G TP H+A+     +    LLD GA        G T  H A +    +     L +    + + K G      A + GH
Sbjct:  410 LHIACKKNRVKVMELLVKYGASIQAVTESG-LTPIHVAAFMGHLNIV-LLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGH 682          

HSP 7 Score: 87.4261 bits (215), Expect = 1.734e-17
Identity = 78/303 (25.74%), Postives = 128/303 (42.24%), Query Frame = 1
Query:  322 VNSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGS---SPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            V + + S+ N  F+         A + G+++ V E  K G D       N    LH A   G++DLV+ ++ +    +DS    G T  HI  + G+ E +K L    AD   + +NG   ++ A++ NH  ++RYL +   N +   + G T L  A        + +L++        D +G      LH+AA+ +  +S   L+      D++   G TP HIA+  G       LL+ GA +      G T  H A + G+   +   L+    +D   + G      A R GH    E
Sbjct:   39 VPAEMLSDSNTSFLR--------AARAGNIDKVLEYLKGGVDIS-TCNQNGLNALHLAAKEGHMDLVQELLDRGAP-VDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVE 324          

HSP 8 Score: 81.2629 bits (199), Expect = 1.165e-15
Identity = 77/311 (24.76%), Postives = 130/311 (41.80%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGA---DCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRY 1200
            P+     SG+   V   L+ +G       ++GL  LH+A +  H+  VK L ++ A   D    Y +     LH A   G+  + + ++ K     ++   NG TP HI   +  ++ +++L  Y A      ++G+  IH A+   H  I+  L     + +V    G+T+LH AA       ++ L++  A +     E  +PLH+A++    E ++ L+      D     G TP HI++ +G  E    LL+ GA       +G T  H   + G  +     L      D   K G      A  Y
Sbjct:  310 PLHCAARSGHEASVEVLLE-KGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLT----ALHVAAHCGHYRVTKLLLDKRAN-PNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHY 614          

HSP 9 Score: 61.2326 bits (147), Expect = 2.464e-9
Identity = 52/192 (27.08%), Postives = 84/192 (43.75%), Query Frame = 1
Query:  724 RYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKAEVVCSICQLEINKRKWD 1287
            +Y  +  +   +  D+  + L  A   N    ++ L K   DIS  +  G + LHLAAK   ++ ++ L+  G P+D    +G T  HI+S  G  E +  L+  GADI A    G T  + A +  H + +   L + G+     + G      A + GH     ++ E   K +V   +  L I  RK D
Sbjct:   32 QYFCEEHVPAEMLSDSNTSFLRAARAGNIDKVLEYL-KGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKV--RLPALHIAARKDD 220          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 116.316 bits (290), Expect = 6.709e-27
Identity = 85/306 (27.78%), Postives = 148/306 (48.37%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDG-LLHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKI-IRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENL--YQTARRYGH 1206
            G+ + VN  L    N+    ++DG  LH A   GHL++V  L  +GA+   K   ++R   PLH A + G I +V+ +++ S+  ID  +  G T  H+    G+   +  L +Y A+ +  +  G   +H+A+   H  + + +L +   +IN+Q   GK+ LH  A+    +  Q L++   +I+  D +G++PLH+AA++     +  L+++G     R   G  P H+A+     +C   LL +G  I   +  G T  H A  GG+ + +   L   G  +  +K G     Y  A R+ H
Sbjct:  151 GHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCK---DKRGYTPLHAAASSGQIAVVKHLLSLSVE-IDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYH 452          

HSP 2 Score: 102.064 bits (253), Expect = 2.863e-22
Identity = 74/255 (29.02%), Postives = 116/255 (45.49%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGS 1146
            LH A   G   I + L   GA    K  +    PLH A A  + D V+ ++  S   +++ D N  TP H+      L C +++        V D+ G   +H A+   H +++  L     NIN        ALH+AA       + +LV   A++S +D  G +PLH AA    +  +++L+S  + ID     G T  H+A F G    +  L+D GA++    ++G T  H+A    HG     FL +NG+
Sbjct:   45 LHAAAFLGDAEITELLILSGARVNAK-DNMWFTPLHRAVASRSQDAVQVLIRHSAD-VNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGA 297          

HSP 3 Score: 100.523 bits (249), Expect = 8.012e-22
Identity = 73/262 (27.86%), Postives = 119/262 (45.42%), Query Frame = 1
Query:  466 SNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVE-DEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVC 1248
            + +R PLH A   G+ ++ E ++    R +++ D    TP H  V     + +++L  + AD   +DKN    +H A+  N  +    +  L  ++NV    G+TALH+AA+      + +L+   A+I+  D +    LH AA    L+ +  LVS G  +  +  RG TP H A+  G    +  LL      L+VE DE N  G+ A        + CF   +  V E+   G N+ Q   +   P+ F  A     +C
Sbjct:   39 AEKRTPLHAAAFLGDAEITELLILSGAR-VNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLS-----LSVEIDEPNAFGNTALH------LACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALC 288          

HSP 4 Score: 89.3521 bits (220), Expect = 3.143e-18
Identity = 91/308 (29.55%), Postives = 135/308 (43.83%), Query Frame = 1
Query:  286 ISSLVASGNIDGVNSYLKSEG--NVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQ--RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELE---CLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTG--KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGI-PIDIRQNRGRTPSHIASFQGFHECLHWLLD--NGADILAVED-EGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            + +  A GN+D V   LKS G  N      R   LH A    H + ++ L   G D      ++Q  R  LH A A  ++D       +  R     D+ G+        E E E   CL+ L    A   +KDK G   +H+A+   H   +  L D       + D G  ++ LH AA      A+Q+L++   ++   D  G +PL LAA     + +  L+S G  P+   Q  GRTP H+A   G   C+  LLD  +GA++L V D +G T    A  GGH + +   L    +V+  +K G
Sbjct:  409 LHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTP-LHYAAASRHYHCLETLVVCGTDINA---TDQWGRSALHYAAA-SDLD-------RRRRVALEPDSEGVQ------AEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKG 698          

HSP 5 Score: 88.5817 bits (218), Expect = 4.748e-18
Identity = 80/317 (25.24%), Postives = 126/317 (39.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDAD---FTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLV------STGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN---------------------------------GADILAVED-EGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  +GH   ++ L + G +   +  +  R PL  A   G+ D V  ++++    + +    G TP H+ VM G   C+++L +         V D  G   +  A    H   +  L + E N+N     G  ALH A +      +Q L++ +A +   D++G +P+HLAA       L  L+      S+ +P  ++   G TP H A F G   C+  LL+                                  G+DI    D +G T  H A   G  E I   L+H+  VD  +  G     TA   G
Sbjct:  566 LHLAAYHGHAQALQVLLRGGREVDERDQAG-RTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVP-PLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKG 880          

HSP 6 Score: 87.0409 bits (214), Expect = 1.708e-17
Identity = 83/335 (24.78%), Postives = 142/335 (42.39%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNV-----------------------KFIVQRDGLL-----------HVACKYGHLNIVKELCKYGADCGYKYP----SNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKN-YDADFT-VKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLV---STGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            + P+   V  G++D V+  L+ E NV                       + ++++D  L           H+A   GH + + EL           P     +   PLH AC +G    VE ++ +  R    ID N  TP H  V+ G   C  +L +   +D T  +D  G   +H A+     + I+ L   +  ++   D G+T L  AA      A++ L+   A +S+ D +G++PLH+A  + + + +  ++   S    I+      +TP H+A+ +G  + +  LL  GA    V+++G T    AC     +   C L H+GS D
Sbjct:  666 RTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQ--RGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTPA-LACAPSR-QVADC-LAHSGSHD 995          

HSP 7 Score: 85.5001 bits (210), Expect = 5.471e-17
Identity = 82/320 (25.62%), Postives = 136/320 (42.50%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKY--GADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININ-----VQCDTGKTALHYA-------------------------------AITN---SCSAIQMLVKCNADIS-IEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGG 1104
            + P++     G+ D V++ L    +     Q  G   +H+A   GH   V+ L     GA+         R PL  A   G++D V  ++ +    +++ D  GL   H+ ++  + EC++ L   DA     D  G   IH A+ + H   +  L  +  + +     ++  +G T LH+A                               A+ N   SC+A+ +L    +DI+   D +G +PLH AA     E ++ L+S   P+D   + GRTP   A+ +G    L  LLD GA +  ++ +GNT  H AC  G
Sbjct:  596 RTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREAN-VNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAAL-LLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNG 913          

HSP 8 Score: 83.9593 bits (206), Expect = 1.444e-16
Identity = 85/318 (26.73%), Postives = 125/318 (39.31%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDL-VEFIV--------------------AKSLRF------------IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-----------------------ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLN-HNGSVDEIN 1161
            LH+AC  G   +V EL  YGA+     P+N+   PLH A A  +  L +EF+V                    A   RF            I+S+D +G TP H+    G    +  L    AD   +  +GM  +H A+   H    R L      I+     G+T LH AA   +   +Q+L+K   + +  D  G +PLH AA       L  LV  G  I+     GR+  H A+                            +CL +LL +GA     + +G +  HYA   GH   +   L+ H+G  +E +
Sbjct:  243 LHLACFNGQDAVVSELIDYGAN--VSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEAD 558          

HSP 9 Score: 76.2554 bits (186), Expect = 3.786e-14
Identity = 55/214 (25.70%), Postives = 97/214 (45.33%), Query Frame = 1
Query:  583 PAHI-CVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            PA I  +  G+ E +++L     D  V D      +H A+     +I   L      +N + +   T LH A  + S  A+Q+L++ +AD++  D    +PLH+AA +N+L     ++     +++    GRT  H A+  G  E ++ LL  GA+I A + +     H+A   GH + +   ++H   V   +K G      A   G   + +
Sbjct:   10 PALIQAIFSGDPEEIRMLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVK 223          

HSP 10 Score: 64.6994 bits (156), Expect = 1.886e-10
Identity = 76/343 (22.16%), Postives = 123/343 (35.86%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGAD------CGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVM---------------EG--------ELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTG--KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIP-------------------------------------IDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH A   G+++ V+ L K G +      CG       R PLH A A  +   +E +V      I++ D  G +  H                   EG          +CL+ L    A   +KDK G   +H+A+   H   +  L D       + D G  ++ LH AA      A+Q+L++   ++   D  G +PL LAA     + +  L+S G                                       +D+   +GRTP  +A   G  + +  LL+  A++   + +G    H A      E + C L  +  + + +  G      A   GH
Sbjct:  409 LHAAAAGGNVDCVQLLLKSGGEHNRTDKCG-------RTPLHYAAASRHYHCLETLVVCGTD-INATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGH 743          

HSP 11 Score: 59.3066 bits (142), Expect = 8.312e-9
Identity = 51/202 (25.25%), Postives = 85/202 (42.08%), Query Frame = 1
Query:  721 IRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH--PVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRI 1320
            IR L     +INV     +T LH AA        ++L+   A ++ +DN   +PLH A    S ++++ L+     ++ R    +TP H+A+      C   ++     +   +  G T  H+A   GH E ++  L    +++  +K        A   GH   V    +  AEV C       +KR +  LHA  S  +I
Sbjct:   24 IRMLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCK------DKRGYTPLHAAASSGQI 219          

HSP 12 Score: 58.9214 bits (141), Expect = 9.217e-9
Identity = 48/216 (22.22%), Postives = 94/216 (43.52%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDT-NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEIN-INVQCDTGKTALHYAAITNSCSAIQMLVKCNAD----ISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHG 1110
            P+H A AFG+   +E ++       +  D  N  +P H+    G  + L++L     +   +D+ G   +  A+ R H   +  L     + ++     G+T +H A +    + +++L+    D    + + D +G +PL LA     ++++  L+     ++    +G    H+A      EC+  LL+  A +L  + +G T  H A   GH 
Sbjct:  530 PVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLD-EPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHA 744          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 115.931 bits (289), Expect = 7.844e-27
Identity = 85/306 (27.78%), Postives = 148/306 (48.37%), Query Frame = 1
Query:  307 GNIDGVNSYLKSEGNVKFIVQRDG-LLHVACKYGHLNIVKELCKYGADCGYKYPSNQR--IPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKI-IRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENL--YQTARRYGH 1206
            G+ + VN  L    N+    ++DG  LH A   GHL++V  L  +GA+   K   ++R   PLH A + G I +V+ +++ S+  ID  +  G T  H+    G+   +  L +Y A+ +  +  G   +H+A+   H  + + +L +   +IN+Q   GK+ LH  A+    +  Q L++   +I+  D +G++PLH+AA++     +  L+++G     R   G  P H+A+     +C   LL +G  I   +  G T  H A  GG+ + +   L   G  +  +K G     Y  A R+ H
Sbjct:  101 GHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCK---DKRGYTPLHAAASSGQIAVVKHLLSLSVE-IDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYH 402          

HSP 2 Score: 94.3597 bits (233), Expect = 8.679e-20
Identity = 60/212 (28.30%), Postives = 100/212 (47.17%), Query Frame = 1
Query:  511 IDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGS 1146
            +D V+ ++  S   +++ D N  TP H+      L C +++        V D+ G   +H A+   H +++  L     NIN        ALH+AA       + +LV   A++S +D  G +PLH AA    +  +++L+S  + ID     G T  H+A F G    +  L+D GA++    ++G T  H+A    HG     FL +NG+
Sbjct:   37 LDAVQVLIRHSAD-VNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGA 247          

HSP 3 Score: 90.8929 bits (224), Expect = 8.954e-19
Identity = 69/271 (25.46%), Postives = 120/271 (44.28%), Query Frame = 1
Query:  409 LNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHE-CLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIF 1218
            L+ V+ L ++ AD   +   N + PLH A A   +   E I+   L  ++  D  G T  H   + G  E + +L    A+    DK   + +HWA+   H  ++  L      ++ +   G T LH AA +   + ++ L+  + +I   +  G++ LHLA  +     +  L+  G  +    N+G TP H A+       CL +L++NGADI     +G +  H     G        + + G ++ ++K G      A RYGH ++ 
Sbjct:   37 LDAVQVLIRHSADVNAR-DKNWQTPLHVAAANNALRCAEVII-PLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLI 305          

HSP 4 Score: 88.9669 bits (219), Expect = 4.167e-18
Identity = 91/308 (29.55%), Postives = 135/308 (43.83%), Query Frame = 1
Query:  286 ISSLVASGNIDGVNSYLKSEG--NVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQ--RIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELE---CLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTG--KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGI-PIDIRQNRGRTPSHIASFQGFHECLHWLLD--NGADILAVED-EGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG 1170
            + +  A GN+D V   LKS G  N      R   LH A    H + ++ L   G D      ++Q  R  LH A A  ++D       +  R     D+ G+        E E E   CL+ L    A   +KDK G   +H+A+   H   +  L D       + D G  ++ LH AA      A+Q+L++   ++   D  G +PL LAA     + +  L+S G  P+   Q  GRTP H+A   G   C+  LLD  +GA++L V D +G T    A  GGH + +   L    +V+  +K G
Sbjct:  359 LHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTP-LHYAAASRHYHCLETLVVCGTDINA---TDQWGRSALHYAAA-SDLD-------RRRRVALEPDSEGVQ------AEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKG 648          

HSP 5 Score: 88.5817 bits (218), Expect = 5.327e-18
Identity = 80/317 (25.24%), Postives = 126/317 (39.75%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDAD---FTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLV------STGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN---------------------------------GADILAVED-EGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH+A  +GH   ++ L + G +   +  +  R PL  A   G+ D V  ++++    + +    G TP H+ VM G   C+++L +         V D  G   +  A    H   +  L + E N+N     G  ALH A +      +Q L++ +A +   D++G +P+HLAA       L  L+      S+ +P  ++   G TP H A F G   C+  LL+                                  G+DI    D +G T  H A   G  E I   L+H+  VD  +  G     TA   G
Sbjct:  516 LHLAAYHGHAQALQVLLRGGREVDERDQAG-RTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVP-PLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKG 830          

HSP 6 Score: 87.0409 bits (214), Expect = 1.771e-17
Identity = 83/335 (24.78%), Postives = 142/335 (42.39%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNV-----------------------KFIVQRDGLL-----------HVACKYGHLNIVKELCKYGADCGYKYP----SNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKN-YDADFT-VKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLV---STGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVD 1152
            + P+   V  G++D V+  L+ E NV                       + ++++D  L           H+A   GH + + EL           P     +   PLH AC +G    VE ++ +  R    ID N  TP H  V+ G   C  +L +   +D T  +D  G   +H A+     + I+ L   +  ++   D G+T L  AA      A++ L+   A +S+ D +G++PLH+A  + + + +  ++   S    I+      +TP H+A+ +G  + +  LL  GA    V+++G T    AC     +   C L H+GS D
Sbjct:  616 RTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQ--RGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTPA-LACAPSR-QVADC-LAHSGSHD 945          

HSP 7 Score: 85.1149 bits (209), Expect = 6.197e-17
Identity = 82/320 (25.62%), Postives = 136/320 (42.50%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKY--GADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININ-----VQCDTGKTALHYA-------------------------------AITN---SCSAIQMLVKCNADIS-IEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGG 1104
            + P++     G+ D V++ L    +     Q  G   +H+A   GH   V+ L     GA+         R PL  A   G++D V  ++ +    +++ D  GL   H+ ++  + EC++ L   DA     D  G   IH A+ + H   +  L  +  + +     ++  +G T LH+A                               A+ N   SC+A+ +L    +DI+   D +G +PLH AA     E ++ L+S   P+D   + GRTP   A+ +G    L  LLD GA +  ++ +GNT  H AC  G
Sbjct:  546 RTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREAN-VNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAAL-LLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNG 863          

HSP 8 Score: 83.9593 bits (206), Expect = 1.539e-16
Identity = 85/318 (26.73%), Postives = 125/318 (39.31%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDL-VEFIV--------------------AKSLRF------------IDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFH-----------------------ECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLN-HNGSVDEIN 1161
            LH+AC  G   +V EL  YGA+     P+N+   PLH A A  +  L +EF+V                    A   RF            I+S+D +G TP H+    G    +  L    AD   +  +GM  +H A+   H    R L      I+     G+T LH AA   +   +Q+L+K   + +  D  G +PLH AA       L  LV  G  I+     GR+  H A+                            +CL +LL +GA     + +G +  HYA   GH   +   L+ H+G  +E +
Sbjct:  193 LHLACFNGQDAVVSELIDYGAN--VSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEAD 508          

HSP 9 Score: 64.3142 bits (155), Expect = 2.167e-10
Identity = 76/343 (22.16%), Postives = 123/343 (35.86%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGAD------CGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVM---------------EG--------ELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTG--KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIP-------------------------------------IDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH A   G+++ V+ L K G +      CG       R PLH A A  +   +E +V      I++ D  G +  H                   EG          +CL+ L    A   +KDK G   +H+A+   H   +  L D       + D G  ++ LH AA      A+Q+L++   ++   D  G +PL LAA     + +  L+S G                                       +D+   +GRTP  +A   G  + +  LL+  A++   + +G    H A      E + C L  +  + + +  G      A   GH
Sbjct:  359 LHAAAAGGNVDCVQLLLKSGGEHNRTDKCG-------RTPLHYAAASRHYHCLETLVVCGTD-INATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGH 693          

HSP 10 Score: 62.003 bits (149), Expect = 1.147e-9
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  805 NSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            N   A+Q+L++ +AD++  D    +PLH+AA +N+L     ++     +++    GRT  H A+  G  E ++ LL  GA+I A + +     H+A   GH + +   ++H   V   +K G      A   G   + +
Sbjct:   35 NVLDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVK 173          

HSP 11 Score: 58.9214 bits (141), Expect = 9.084e-9
Identity = 48/216 (22.22%), Postives = 94/216 (43.52%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDT-NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEIN-INVQCDTGKTALHYAAITNSCSAIQMLVKCNAD----ISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHG 1110
            P+H A AFG+   +E ++       +  D  N  +P H+    G  + L++L     +   +D+ G   +  A+ R H   +  L     + ++     G+T +H A +    + +++L+    D    + + D +G +PL LA     ++++  L+     ++    +G    H+A      EC+  LL+  A +L  + +G T  H A   GH 
Sbjct:  480 PVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLD-EPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHA 694          

HSP 12 Score: 50.447 bits (119), Expect = 3.947e-6
Identity = 39/170 (22.94%), Postives = 74/170 (43.53%), Query Frame = 1
Query:  682 LIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTA 1191
            LI+ +   N    ++ L     ++N +    +T LH AA  N+    ++++     +++ D  G + LH AA +   E +  L++ G  I+    +     H A+F G  + +  L+ +GA++   +  G T  H A   G    +   L+ +  +DE N  G      A
Sbjct:   27 LIYKSEDINVLDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLA 196          
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 115.931 bits (289), Expect = 1.022e-26
Identity = 85/308 (27.60%), Postives = 133/308 (43.18%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYL--YDLEIN-------------------------------INVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A  Y ++++ + L   GA+  +  P N   PLH A   GN+ +V  ++ +  + ID+   + LTP H     G +  ++IL  + A    K KNG+  IH A++ +H   +R L  Y+ EI+                                N +   G T LH A   N   ++ +L+K +A +      G +PLH+AA    L  ++ L+  G   +    +  TP H+AS  G  E   +LL N A + A   +  T  H A R GH E +   L+H  + D     G      A R GH
Sbjct:  208 LHIAAHYENMSVAQLLLNRGANVNFT-PKNGITPLHIASRRGNVMMVRLLLDRGAQ-IDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGH 513          

HSP 2 Score: 112.079 bits (279), Expect = 1.864e-25
Identity = 75/275 (27.27%), Postives = 126/275 (45.82%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+A + GH++ ++ L   GA    K       PLH A  +G +D+ E ++ +     ++   NGLTP H+ V    L+ +K+L +         +NG   +H A+K+N  ++   L     + N +   G T LH A+       + ML+   A++++ +  G +PLHL A+   +     LV  G  +      G TP H+A   G  + + +LL   A + A    G T  H A + GH + +   L H    +EI   G +    A+R G+
Sbjct:  505 LHIAAREGHIHTIRILLDAGAQ-QVKMTKKGFTPLHVASKYGKVDVAELLLERGAN-PNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGY 777          

HSP 3 Score: 108.612 bits (270), Expect = 2.334e-24
Identity = 76/274 (27.74%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            LH A + GH+ I++ L ++GA    K   N   P+H A    ++D V  ++  +   ID I  + LTP H+    G     K+L +  A    +  NG   +H A K+NH + +  L     ++    ++G T LH AA     + ++ L++  A  +  + +  +PLH+A++    E  ++L+     +D R    +TP H A+  G  E +  LLD+ A+  +    G+T  H A R GH  TI   L+      ++ K G      A +YG
Sbjct:  274 LHCAARNGHVRIIEILLEHGAPIQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAE-IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYG 545          

HSP 4 Score: 103.219 bits (256), Expect = 1.484e-22
Identity = 77/280 (27.50%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  364 VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYG 1203
            V+ +  LH+A + GH  + + L +  A    +   +Q  PLH A   G+ +LV+ ++       DS  T G TP HI   EG +  ++IL +  A      K G   +H ASK     +   L +   N N     G T LH A   N+   +++LV            G +PLH+AAK N +E    L+  G   +    +G TP H+AS +G  + +  L+   A++      G T  H   + GH       +    SV   +++G      A  YG
Sbjct:  433 VKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQ-TPLHCAARMGHKELVKLLLDHKAN-PDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYG 710          

HSP 5 Score: 102.834 bits (255), Expect = 2.060e-22
Identity = 80/291 (27.49%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRI-PLHDACAFGNIDLVEFIVAKSLRFIDSIDT-NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH----PVIFEKAKKA 1236
            LH+A   G   +V EL  YGA+   +  S++   PL+ A    ++++V+F++        S+ T +G TP  + + +G    + +L NY      K K  +  +H A++ +  +    L   + N +V   TG T LH AA   + S  Q+L+   A+++     G +PLH+A++  ++  +R L+  G  ID +     TP H A+  G    +  LL++GA I A    G +  H A +G H + +   L +N  +D+I          A   GH     V+ +K  KA
Sbjct:   80 LHIAALAGQEKVVAELVNYGANVNAQ--SHKGFSPLYMAAQENHLEVVKFLLENGAN--QSLPTEDGFTPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKA 362          

HSP 6 Score: 90.5077 bits (223), Expect = 1.620e-18
Identity = 75/294 (25.51%), Postives = 127/294 (43.20%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPV-IFEKAKKAEVVCSICQ 1260
            LHVA   GH  + K L   GA    +   N   PLH AC   ++  ++ ++  S   ++++  +GLTP H+    G L  +K L    A     +      +H AS+  H ++ ++L      ++ +    +T LH AA       +++L+   A+       G +PLH+AA+   + ++R L+  G        +G TP H+AS  G  +    LL+ GA+  A    G T  H A    + + +   ++  GS           + TAR    P+ I  K  + EV   + Q
Sbjct:  340 LHVAAHCGHHRMAKVLLDKGAKANARA-LNGFTPLHIACKKNHMRSMDLLLKHSAS-LEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSA----------HSTARNGYTPLHIAAKQNQIEVASVLLQ 621          

HSP 7 Score: 85.1149 bits (209), Expect = 8.130e-17
Identity = 76/308 (24.68%), Postives = 125/308 (40.58%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAK---------------------------------HNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            LH+ACK  H+  +  L K+ A       S    PLH A   G++++V+ ++ +     ++ +    TP H+    G  E  + L    A    + K+    +H A++  H ++++ L D + N +     G T LH AA       I++L+   A       +G +PLH+A+K                                 HN+L+ ++ LVS G         G TP HIA+ Q   E    LL NGA       +G T  H A + G  + +   ++   +V+  NK G        + GH
Sbjct:  373 LHIACKKNHMRSMDLLLKHSASLEAVTESGL-TPLHVAAFMGHLNIVKNLLQRGAS-PNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGH 678          
BLAST of Ankyrin repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000011193.1 (SMESG000011193.1)

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 429/431 (99.54%), Postives = 431/431 (100.00%), Query Frame = 1
Query:  271 MLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLDNH 1563
            MLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYK+PSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAH+CVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLDNH
Sbjct:    1 MLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGLLHVACKYGHLNIVKELCKYGADCGYKHPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHVCVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQKVKKSSTPHRIEEGGYRELISRYYGDFLDNH 431          

HSP 2 Score: 74.3294 bits (181), Expect = 5.431e-14
Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = -3
Query:    1 MLKHPISSLVASGNIDGVNTYLKSEGNVKFIVQRDG 108
            MLKHPISSLVASGNIDGVN+YLKSEGNVKFIVQRDG
Sbjct:    1 MLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDG 36          
BLAST of Ankyrin repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 122.479 bits (306), Expect = 3.849e-29
Identity = 89/316 (28.16%), Postives = 155/316 (49.05%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL-LHVACKYGHLNIVKELCKYGADCGYKY-PSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADI-LAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            PI     +G++D V+  LK    ++   + D   +H AC+ GHLN+V+ L   G  C  +    ++R P+H AC   ++++V+ ++ KS   +++ D NGL P H     G +E +K+L +       +   G + IH+AS   HD+I++ L     NI +Q      A+HYA      + ++ML+  + +I+  D     P+H A ++   E ++ LVS     ++R     TP H A F G+ + +  LL N   + +  +D+G  I HYAC  GH   +   ++ N +++   K   +    A + G   I E
Sbjct:  206 PIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEG--CSIEICDKDKRKPIHFACQNDHVEIVKLLL-KSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAIHYACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPI-HYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE 517          

HSP 2 Score: 110.538 bits (275), Expect = 3.705e-25
Identity = 90/319 (28.21%), Postives = 144/319 (45.14%), Query Frame = 1
Query:  262 FVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFI-VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVI 1215
            F K  K PI     SG+ D V   L  + N++   +     +H AC+ G+  IV+ L    AD   K  +N R PLH AC  G+ ++VE ++      I+  D + L P H   + G  + +++L +        DK+ M  +H+AS+  H  ++  L     N+N      ++ +HYAA      A+ +L+K N+ I   D     P+H A ++  L  +R L+S G  I+I     R P H A      E +  LL +  ++ A +  G    HYAC  G+ E +   ++    +D  +  G      A  YGH  I
Sbjct:   35 FCKNDKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGR-PLHHACRSGHANVVELLLNYYCD-IEVHDKSNLRPIHYACLSGSYQIVEMLID-RCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEI 350          

HSP 3 Score: 100.908 bits (250), Expect = 3.545e-22
Identity = 69/261 (26.44%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINK 1164
            +H AC+YG L++VK L     D    +  N + P+H AC  G+ D+V+ +++     I+  D N + P H     G  + +++L +  AD   KDKN  + +H A +  H  ++  L +   +I V   +    +HYA ++ S   ++ML+     I   D     PLH A+++     L  L+S    ++    R ++P H A+  G  + +  LL + + I A +       HYAC+ GH   +   ++   S++  +K
Sbjct:   10 IHYACQYGQLDLVKMLLMGMCDVEV-FCKNDKRPIHYACESGDYDIVKLLLSYKCN-IEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLID-RCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDK 267          

HSP 4 Score: 98.2117 bits (243), Expect = 2.906e-21
Identity = 80/296 (27.03%), Postives = 130/296 (43.92%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNH-----------------DK----------------IIRYLYDLEININVQCDTGK-TALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADI-LAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINK 1164
            LH AC+ GH N+V+ L  Y  D      SN R P+H AC  G+  +VE ++ +    I+S+D + + P H     G    L++L +  ++    DK     IH+A++  H                 DK                ++R L     +I + CD  K   +H+A   +    +++L+K   ++   D  G  P+H A  H ++E ++ L+S+   +D     G  P H ASF G  E +  LL    +I L  +D G  I HYAC  GH   +   L  +  ++  +K
Sbjct:  109 LHHACRSGHANVVELLLNYYCDIEVHDKSNLR-PIHYACLSGSYQIVEMLIDRCQ--IESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI-CDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAI-HYACCRGHLNIVEMLLAQSCEINAGDK 399          

HSP 5 Score: 89.7373 bits (221), Expect = 1.434e-18
Identity = 60/242 (24.79%), Postives = 109/242 (45.04%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+H AC +G +DLV+ ++   +  ++    N   P H     G+ + +K+L +Y  +  V D N M+ IH+A +  + KI+  L   + +   +       LH+A  +   + +++L+    DI + D     P+H A    S + +  L+     I+        P H AS  G    L  LL   +++ AV+    +  HYA + GH + +   L HN +++  +K        A + GH
Sbjct:    9 PIHYACQYGQLDLVKMLLM-GMCDVEVFCKNDKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDR-CQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGH 248          

HSP 6 Score: 74.3294 bits (181), Expect = 1.077e-13
Identity = 71/286 (24.83%), Postives = 119/286 (41.61%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV--KC-------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLD 1035
            PI     +G+++ V   L SEG    I  +D    +H AC+  H+ IVK L K   +      +  R P+H AC  GN+++V+ +++ S   +D+    G  P H     G  E +KIL +   +  ++DK+  + IH+A  R H  I+  L      IN      +  +H+A     C  +++LV  KC                               N  + + D +   P+H A     L  ++ L+S    I+       +P  +AS +GF + +  L D
Sbjct:  239 PIHYACQNGHLNVVR-LLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLR-PIHYACFHGNVEIVKLLIS-SQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAIHYACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSD 521          

HSP 7 Score: 67.781 bits (164), Expect = 1.095e-11
Identity = 61/234 (26.07%), Postives = 103/234 (44.02%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIG 1083
            +H A  YGH  IVK L     +   +   + R  +H AC  G++++VE ++A+S   I++ D N   P H     G  E +K+L +Y  D  V+D+N +  IH+A    +  ++  L      + V        +HYA        +++L+  N +I     E  SPL LA++    + +  L  T     +R+    +       Q F  C H+L  +  +    + EG  IG
Sbjct:  339 IHFASFYGHDEIVKILLSERCNIELQDKDSGR-AIHYACCRGHLNIVEMLLAQSCE-INAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT-----LRRKIIDSLVEELGIQCFDGCSHYLCKSSLESKQFQ-EGEFIG 564          

HSP 8 Score: 67.3958 bits (163), Expect = 1.458e-11
Identity = 52/215 (24.19%), Postives = 93/215 (43.26%), Query Frame = 1
Query:  565 DTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTG-KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            D + + P H     G+L+ +K+L     D  V  KN  + IH+A +     I++ L   + NI V CD      +HYA        +++L+   AD   +D     PLH A +      +  L++    I++       P H A   G ++ +  L+D    I +++       HYA + GH   +   L+   +V+ ++K  ++    A + GH
Sbjct:    3 DNDLMRPIHYACQYGQLDLVKMLLMGMCDVEVFCKNDKRPIHYACESGDYDIVKLLLSYKCNIEV-CDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDR-CQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGH 215          
BLAST of Ankyrin repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 122.479 bits (306), Expect = 3.854e-29
Identity = 89/316 (28.16%), Postives = 155/316 (49.05%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL-LHVACKYGHLNIVKELCKYGADCGYKY-PSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADI-LAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            PI     +G++D V+  LK    ++   + D   +H AC+ GHLN+V+ L   G  C  +    ++R P+H AC   ++++V+ ++ KS   +++ D NGL P H     G +E +K+L +       +   G + IH+AS   HD+I++ L     NI +Q      A+HYA      + ++ML+  + +I+  D     P+H A ++   E ++ LVS     ++R     TP H A F G+ + +  LL N   + +  +D+G  I HYAC  GH   +   ++ N +++   K   +    A + G   I E
Sbjct:  200 PIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEG--CSIEICDKDKRKPIHFACQNDHVEIVKLLL-KSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAIHYACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPI-HYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVE 511          

HSP 2 Score: 110.538 bits (275), Expect = 3.457e-25
Identity = 90/319 (28.21%), Postives = 144/319 (45.14%), Query Frame = 1
Query:  262 FVKMLKHPISSLVASGNIDGVNSYLKSEGNVKFI-VQRDGLLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVI 1215
            F K  K PI     SG+ D V   L  + N++   +     +H AC+ G+  IV+ L    AD   K  +N R PLH AC  G+ ++VE ++      I+  D + L P H   + G  + +++L +        DK+ M  +H+AS+  H  ++  L     N+N      ++ +HYAA      A+ +L+K N+ I   D     P+H A ++  L  +R L+S G  I+I     R P H A      E +  LL +  ++ A +  G    HYAC  G+ E +   ++    +D  +  G      A  YGH  I
Sbjct:   29 FCKNDKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGR-PLHHACRSGHANVVELLLNYYCD-IEVHDKSNLRPIHYACLSGSYQIVEMLID-RCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEI 344          

HSP 3 Score: 101.293 bits (251), Expect = 3.461e-22
Identity = 69/261 (26.44%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINK 1164
            +H AC+YG L++VK L     D    +  N + P+H AC  G+ D+V+ +++     I+  D N + P H     G  + +++L +  AD   KDKN  + +H A +  H  ++  L +   +I V   +    +HYA ++ S   ++ML+     I   D     PLH A+++     L  L+S    ++    R ++P H A+  G  + +  LL + + I A +       HYAC+ GH   +   ++   S++  +K
Sbjct:    4 IHYACQYGQLDLVKMLLMGMCDVEV-FCKNDKRPIHYACESGDYDIVKLLLSYKCN-IEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLID-RCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDK 261          

HSP 4 Score: 98.2117 bits (243), Expect = 2.994e-21
Identity = 80/296 (27.03%), Postives = 130/296 (43.92%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNH-----------------DK----------------IIRYLYDLEININVQCDTGK-TALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADI-LAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINK 1164
            LH AC+ GH N+V+ L  Y  D      SN R P+H AC  G+  +VE ++ +    I+S+D + + P H     G    L++L +  ++    DK     IH+A++  H                 DK                ++R L     +I + CD  K   +H+A   +    +++L+K   ++   D  G  P+H A  H ++E ++ L+S+   +D     G  P H ASF G  E +  LL    +I L  +D G  I HYAC  GH   +   L  +  ++  +K
Sbjct:  103 LHHACRSGHANVVELLLNYYCDIEVHDKSNLR-PIHYACLSGSYQIVEMLIDRCQ--IESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI-CDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAI-HYACCRGHLNIVEMLLAQSCEINAGDK 393          

HSP 5 Score: 89.7373 bits (221), Expect = 1.365e-18
Identity = 60/242 (24.79%), Postives = 109/242 (45.04%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+H AC +G +DLV+ ++   +  ++    N   P H     G+ + +K+L +Y  +  V D N M+ IH+A +  + KI+  L   + +   +       LH+A  +   + +++L+    DI + D     P+H A    S + +  L+     I+        P H AS  G    L  LL   +++ AV+    +  HYA + GH + +   L HN +++  +K        A + GH
Sbjct:    3 PIHYACQYGQLDLVKMLLM-GMCDVEVFCKNDKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDR-CQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGH 242          

HSP 6 Score: 74.3294 bits (181), Expect = 1.001e-13
Identity = 71/287 (24.74%), Postives = 119/287 (41.46%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLV--KC-------------------------------NADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDN 1038
            PI     +G+++ V   L SEG    I  +D    +H AC+  H+ IVK L K   +      +  R P+H AC  GN+++V+ +++ S   +D+    G  P H     G  E +KIL +   +  ++DK+  + IH+A  R H  I+  L      IN      +  +H+A     C  +++LV  KC                               N  + + D +   P+H A     L  ++ L+S    I+       +P  +AS +GF + +  L D 
Sbjct:  233 PIHYACQNGHLNVVR-LLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLR-PIHYACFHGNVEIVKLLIS-SQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCNIELQDKDSGRAIHYACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT 516          

HSP 7 Score: 68.1662 bits (165), Expect = 1.036e-11
Identity = 61/234 (26.07%), Postives = 103/234 (44.02%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIG 1083
            +H A  YGH  IVK L     +   +   + R  +H AC  G++++VE ++A+S   I++ D N   P H     G  E +K+L +Y  D  V+D+N +  IH+A    +  ++  L      + V        +HYA        +++L+  N +I     E  SPL LA++    + +  L  T     +R+    +       Q F  C H+L  +  +    + EG  IG
Sbjct:  333 IHFASFYGHDEIVKILLSERCNIELQDKDSGR-AIHYACCRGHLNIVEMLLAQSCE-INAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLASQKGFSQIVELLSDT-----LRRKIIDSLVEELGIQCFDGCSHYLCKSSLESKQFQ-EGEFIG 558          

HSP 8 Score: 65.855 bits (159), Expect = 4.561e-11
Identity = 51/211 (24.17%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  577 LTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTG-KTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            + P H     G+L+ +K+L     D  V  KN  + IH+A +     I++ L   + NI V CD      +HYA        +++L+   AD   +D     PLH A +      +  L++    I++       P H A   G ++ +  L+D    I +++       HYA + GH   +   L+   +V+ ++K  ++    A + GH
Sbjct:    1 MRPIHYACQYGQLDLVKMLLMGMCDVEVFCKNDKRPIHYACESGDYDIVKLLLSYKCNIEV-CDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDR-CQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYAAQNGH 209          
BLAST of Ankyrin repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000016842.1 (SMESG000016842.1)

HSP 1 Score: 121.709 bits (304), Expect = 7.105e-29
Identity = 80/313 (25.56%), Postives = 147/313 (46.96%), Query Frame = 1
Query:  280 HPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL-LHVACKYGHLNIVKELCKYGAD---CGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
             PI      G++D V   ++++ +++ + + +   +H ACKYGH+ IVK L + G+    CG     N   P+H A   G+++L+  ++ K    ++++      P HI   +G LE +K+L +Y  D  +  +   + IHWA    H +I+R L D   NI V        LHYA    +   + +L++ + DI         P+H+A +   LE ++ L+  G   +        P HIA   G ++ ++ L+ +  +I A   +     H ACR GH + +   +    + D ++K   +    A++Y +
Sbjct:  202 QPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACG----ENNWQPIHYASMLGDVELITLLLEKKCD-VEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYCGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTETYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 509          

HSP 2 Score: 98.5969 bits (244), Expect = 2.064e-21
Identity = 71/309 (22.98%), Postives = 139/309 (44.98%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDG-LLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            P+      G+++ V   +++  ++    +++  L+H AC   H++IVK L +   D   +     + P+  AC  GN+++VE ++  + + ID        P H+    G L+ +K+L     D     +   + IH A K  H +I++ L      ++   +     +HYA++      I +L++   D+         P+H+      LE ++ L+     I+I   + R P H A + G +E +  L+D+  +I   + E     HYAC  G+ + ++  + ++  +D  +KL       A R GH
Sbjct:  104 PVHKAAFYGHLEIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQ-PIFYACKSGNVEIVELLINNNCK-IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYCGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGH 410          

HSP 3 Score: 90.5077 bits (223), Expect = 7.517e-19
Identity = 72/311 (23.15%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  298 VASGNIDGVNSYLKSEGNVKFIVQRDGL----LHVACKYGHLNIVK----ELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGH 1206
            V S  I  +    K    V+F+  +D      +H AC  G++ +VK    +LC   A   + +      P+H AC   +I++V+ ++      I+S+ +    P H     G LE +K+L   + D   + +   +LIHWA    H  I++ L +   ++ V+       + YA  + +   +++L+  N  I ++      P+H+A +H  L+ ++ L+     I+        P H A   G  E +  L+ NG+ + A  +      HYA   G  E I   L     V+ + ++           GH
Sbjct:   11 VKSNKIKDIRRLFK----VQFLEMKDDKNMQPIHYACIGGNVEVVKFFIEKLCNINAPSEFNW-----CPIHYACENNHIEIVKLLIENRCN-IESLSSIEWKPVHKAAFYGHLEIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGH 311          

HSP 4 Score: 62.7734 bits (151), Expect = 4.075e-10
Identity = 43/147 (29.25%), Postives = 72/147 (48.98%), Query Frame = 1
Query:  283 PISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL-LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKI 720
            P+     +GN+D VN  +++  ++    + D   +HVAC+ GHL IVK L + G      Y   +  P+H AC  GN D+V  +++     I++   +   P HI    G  + +K+L     +  V DKN    +  A K N+++I
Sbjct:  368 PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCK-TETYTEGKWRPIHIACLIGNYDIVNLLISSRCN-IEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 512          
BLAST of Ankyrin repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.849e-28
Identity = 92/360 (25.56%), Postives = 170/360 (47.22%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDG--LLHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRIINQSQKSLFR 1350
            K PI   +  GN + V   + ++ ++  +  +DG   +H AC+ G   IV+ L     D   +    ++ P+H AC  G  ++V+ ++      I++ D +G  P H  +  G  E ++IL N   D    D+ G Q IH+A K    +I++ L + + +IN + + GK  +HYA    +   +Q+L+    D+   D  G  P+H A K    E ++ L++    I+ R   G+ P H A  +G  E +  L++N  D++A +  G    HYAC+GG  E +   +N+   +   +  G+     A + G P + +      ++ + C +      + ++ + P +++ I   QK  FR
Sbjct: 1167 KQPIHYSMDRGNPEMVQILINNKCDINAL-DKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQ-PIHYACKGGKPEIVQILINNKCD-INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQL-----LINNKCDINARDELYLRMASSPFIMQSIEAIQK-WFR 1517          

HSP 2 Score: 118.242 bits (295), Expect = 1.495e-27
Identity = 77/280 (27.50%), Postives = 138/280 (49.29%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            +H ACK G   IV+ L     D       + + P+H +   GN ++V+ ++      I+++D +G  P H     G+ E ++IL N   D   +D+ G Q IH+A K    +I++ L + + +IN + + GK  +HYA    +   +Q+L+    D+   D  G  P+H A K    E ++ L++    I+ R   G+ P H A  +G  E +  L++N  D++A +  G    HYAC+GG  E +   +N+   ++  ++ G+     A   G+P + +
Sbjct: 1137 IHYACKDGKPEIVQILINNKCDID-ACDRDGKQPIHYSMDRGNPEMVQILINNKCD-INALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQ 1414          

HSP 3 Score: 117.857 bits (294), Expect = 2.066e-27
Identity = 83/319 (26.02%), Postives = 150/319 (47.02%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL----LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            K PI   +  GN + V   + ++ ++     RD L    +H ACK G   +++ L     D   +   +++ P+H AC  G  +L++ ++      I++ D   + P H     G+ E LKIL N   D   +D++G Q IH+A  R + +I+  L + + +I+ +   GK  +HYA   +    +Q+L+    DI   D  G  P+H A    + E ++ L++    ID        P H A  +G  E +  L++N  DI A +++     HYAC+ G  E +   +N+   +D  ++ G+     +   G+P + +
Sbjct:  870 KQPIHYAINRGNPEMVQILINNKCDIN---ARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQ-PIHYACKGGKPELLQLLINNKCD-INARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQ 1183          

HSP 4 Score: 117.087 bits (292), Expect = 3.575e-27
Identity = 76/270 (28.15%), Postives = 129/270 (47.78%), Query Frame = 1
Query:  481 PLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQ 1290
            P+H AC  GN +L++ ++      ID+ D +G  P H  +  G  E ++IL N   D   +D    Q IH+A K    ++++ L + + +IN +    K  +HYA        +Q+L+    DI+  D E   P+H A K    E L+ L++    ID R   G+ P H A  +G  E +  L++N  DI A +  G    HYAC+G   E +   +N+   +D  ++ G+     A   G+P + +      ++ + C ++   R+W Q
Sbjct:  839 PIHYACKAGNPELLQILINNKCD-IDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQI-----LINNKCDIDACDREWMQ 1102          

HSP 5 Score: 114.005 bits (284), Expect = 3.055e-26
Identity = 83/317 (26.18%), Postives = 149/317 (47.00%), Query Frame = 1
Query:  277 KHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGL--LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            K PI   +  GN + V   + ++ ++     R+ +  +H A   G+  +V+ L     D  +        P+H AC  G  ++V+ ++      ID+ D +G  P H  +  G  E ++IL N   D    DK+G Q IH+A +R   +I++ L + + +IN + + GK  +HYA        +Q+L+    DI+  D +G  P+H A    + E ++ L++    +      G+ P H A   G  E +  L++N  DI A +++G    HYA   G+ E +   +N+   +   ++LG+     A + G P I +
Sbjct: 1068 KQPIHYAIDRGNPEMVQILINNKCDID-ACDREWMQPIHYAIDRGNPEMVQILINNKCDI-HARDEKWMQPIHYACKDGKPEIVQILINNKCD-IDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQ 1381          

HSP 6 Score: 108.997 bits (271), Expect = 1.272e-24
Identity = 75/280 (26.79%), Postives = 131/280 (46.79%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            +H ACK G   +++ L     D   +     + P+H AC  G  +L++ ++      ID+ D +G  P H  +  G  E ++IL N   D   +D  G Q IH+A K +  +I++ L + + +I+ +   GK  +HYA    +   +Q+L+    DI   D E   P+H A    + E ++ L++    I  R  +   P H A   G  E +  L++N  DI A + +G    HY+   G+ E +   +N+   ++ ++K G+     A   G P I +
Sbjct:  939 IHYACKGGKPELLQLLINNKCDINARDREWMQ-PIHYACKGGKPELLKILINNKCD-IDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQ 1216          

HSP 7 Score: 108.612 bits (270), Expect = 2.173e-24
Identity = 75/280 (26.79%), Postives = 132/280 (47.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            +H ACK G   ++K L     D   +    ++ P+H A   GN ++VE ++      ID+ D  G  P H      + E ++IL N   D   +D+ G Q IH+A  R + ++++ L + + +I+         +HYA    +   +Q+L+    DI   D +   P+H A K    E ++ L++    ID     G+ P H +  +G  E +  L++N  DI A++ +G    HYAC  G  E +   +N+   ++  ++LG+     A + G P I +
Sbjct:  972 IHYACKGGKPELLKILINNKCDIDARDEDGKQ-PIHYAIDRGNPEIVEILINNKCD-IDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQ 1249          

HSP 8 Score: 105.531 bits (262), Expect = 1.841e-23
Identity = 69/233 (29.61%), Postives = 110/233 (47.21%), Query Frame = 1
Query:  523 EFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            +FI       I+  D +G  P H  +  G  E ++IL N   D    DK G Q IH+A K  + ++++ L + + +I+ +   GK  +HYA    +   +Q+L+    DI+  D     P+H A K    E L+ L++    I+ R    + P H A   G  E L  L++N  DI A + E     HYAC+GG  E +   +N+   +D  ++ G+     A   G+P I E
Sbjct:  786 DFINYAQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVE 1018          

HSP 9 Score: 103.99 bits (258), Expect = 5.540e-23
Identity = 71/280 (25.36%), Postives = 132/280 (47.14%), Query Frame = 1
Query:  382 LHVACKYGHLNIVKELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDTNGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNEGSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECLHWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLGENLYQTARRYGHPVIFE 1221
            +H A   G+  IV+ L     D   +    ++ P+H AC     ++V+ ++      ID+ D  G  P H  +  G  E ++IL N   D    D+  MQ IH+A  R + ++++ L + + +I+ + +     +HYA        +Q+L+    DI   D +G  P+H +    + E ++ L++    I+     G+ P H A  +G  E +  L++N  DI A ++ G    HYAC+GG  E +   +N+   ++  ++ G+     A   G+P + +
Sbjct: 1005 IHYAIDRGNPEIVEILINNKCDIDARDWLGKQ-PIHYACKGDKPEIVQILINNKCD-IDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQ 1282          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK28.447e-2828.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK28.535e-2828.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.395e-2728.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.420e-2728.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.437e-2728.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-445.703e-2829.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.703e-2829.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.882e-2829.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.882e-2829.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-446.519e-2829.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.266e-3029.84gene:FBgn0261788 transcript:FBtr0303118[more]
Ank21.367e-3029.84gene:FBgn0261788 transcript:FBtr0344222[more]
Ank21.414e-3029.84gene:FBgn0261788 transcript:FBtr0303122[more]
Ank22.432e-3029.84gene:FBgn0261788 transcript:FBtr0303119[more]
Ank24.912e-3029.84gene:FBgn0261788 transcript:FBtr0334061[more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b7.482e-2928.47ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3b8.064e-2928.47ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank2b4.805e-2728.21ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank2a1.346e-2627.86ankyrin 2a, neuronal [Source:ZFIN;Acc:ZDB-GENE-111... [more]
ank1b2.276e-2627.30ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo98.416e-2827.81F-box protein 9 [Source:Xenbase;Acc:XB-GENE-100244... [more]
ANK11.430e-2729.17ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.586e-2729.17ankyrin 1 [Source:NCBI gene;Acc:613080][more]
tpm45.864e-2726.73tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm46.586e-2726.73tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank24.556e-2828.57ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank25.963e-2828.57ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank21.836e-2728.57ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank33.585e-2727.21ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.701e-2727.21ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C8R3|ANK2_MOUSE1.272e-2628.57Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|Q4UMH6|Y381_RICFE1.314e-2629.11Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|Q01484|ANK2_HUMAN2.710e-2628.57Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|G5E8K5|ANK3_MOUSE3.541e-2627.21Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT1.126e-2527.27Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QW741.861e-7334.95Ankyrin-3 OS=Crassostrea gigas OX=29159 GN=CGI_100... [more]
A0A1S3JNY84.195e-7332.13ankyrin repeat domain-containing protein 42 OS=Lin... [more]
A0A210QDK27.150e-6431.63Serine/threonine-protein phosphatase 6 regulatory ... [more]
A0A2T7PKQ53.767e-6231.52ANK_REP_REGION domain-containing protein OS=Pomace... [more]
A0A267FE662.062e-5831.99ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b1.373e-2928.47ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a8.251e-2828.73ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.094e-2728.73ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000017800.23.893e-2728.37pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3a6.489e-2728.73ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007954.11.598e-2928.77pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000000095.12.616e-2927.50pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.12.982e-2927.50pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.11.416e-2528.11pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000008561.15.644e-2328.50pep scaffold:Pmarinus_7.0:GL477362:121892:134159:-... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR12.701e-1126.17Palmitoyl transferase involved in protein palmitoy... [more]
GDE12.624e-1024.11Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
NAS63.023e-1025.00Evolutionarily conserved 19S regulatory particle a... [more]
AKR27.562e-1025.00Ankyrin repeat-containing protein; member of a fam... [more]
AVO23.130e-822.93Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494853.768e-2632.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391133.932e-1627.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387259.408e-1528.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348238.109e-1430.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473441.470e-1331.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039458.14.724e-2828.57ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.15.370e-2828.57ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ankrd446.709e-2727.78ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd447.844e-2727.78ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ank1b1.022e-2627.60ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
back to top
BLAST of Ankyrin repeat-containing domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011193.15.431e-1499.54SMESG000011193.1[more]
SMESG000026756.13.849e-2928.16SMESG000026756.1[more]
SMESG000026756.13.854e-2928.16SMESG000026756.1[more]
SMESG000016842.17.105e-2925.56SMESG000016842.1[more]
SMESG000032664.11.849e-2825.56SMESG000032664.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010188 ID=SMED30010188|Name=Ankyrin repeat-containing domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1595bp
GCCGTCTCGTTGAACAATGAATTTAACATTTCCTTCAGATTTCAAATAAG
TATTAACTCCATCAATATTTCCACTTGCTACTAATGATGAAATTGGATGT
TTTAACATTTTTACAAAAAACTTATAAATAATATCGTAAATTTACATTAA
AAATTATTGATTAAATTTATATTTCAATATTTTCTTATTTTGTCAAAGAA
TTGTAAATTTTAATTTAATCAATAATTTTTAATGTAAATTTACGATATTA
TTTATAATTTTTTTGTAAAAATGTTAAAACATCCAATTTCATCATTAGTA
GCAAGTGGAAATATTGATGGAGTTAATAGTTATTTGAAATCTGAAGGAAA
TGTTAAATTTATTGTTCAACGAGACGGTTTGTTACATGTTGCATGCAAAT
ATGGGCATTTAAATATTGTAAAAGAATTATGCAAATATGGTGCCGATTGT
GGTTATAAATATCCTAGTAATCAACGCATTCCATTACACGATGCTTGTGC
TTTCGGAAACATAGATTTAGTTGAATTTATAGTGGCAAAATCATTGAGAT
TTATTGACAGTATTGATACCAATGGTTTGACACCGGCTCATATATGTGTA
ATGGAAGGCGAGTTGGAATGTCTGAAAATTTTAAAAAATTACGATGCAGA
TTTTACAGTAAAAGATAAAAATGGAATGCAATTAATTCATTGGGCATCCA
AAAGAAATCATGACAAAATAATTAGGTATTTATATGACCTGGAGATAAAT
ATAAATGTTCAATGTGACACCGGCAAAACTGCTCTGCATTACGCGGCTAT
CACAAACAGTTGCAGTGCAATTCAAATGCTGGTGAAATGCAACGCTGATA
TTTCAATTGAAGATAACGAAGGTTCTTCCCCACTGCACCTGGCTGCAAAA
CACAATTCTTTGGAATCGCTAAGATATTTAGTTTCAACTGGTATCCCAAT
AGATATAAGGCAAAACCGAGGACGAACTCCATCTCATATCGCTTCTTTTC
AAGGGTTTCATGAATGTCTTCATTGGTTACTTGACAACGGTGCGGATATT
CTAGCTGTCGAAGATGAAGGTAACACAATCGGGCATTATGCCTGTCGAGG
CGGTCATGGGGAAACTATACATTGTTTCCTAAATCACAATGGCTCAGTGG
ATGAGATAAATAAATTAGGTGAAAATTTATATCAAACTGCTCGACGATAT
GGTCATCCCGTTATATTTGAAAAAGCCAAAAAAGCCGAAGTCGTTTGTTC
GATTTGTCAACTGGAAATTAATAAACGAAAATGGGACCAACTTCATGCTC
CTCCAAGTGTGATAAGGATTATAAATCAATCACAAAAATCCTTGTTTCGA
AATCCTTTAGGAAGTTATGCAACTGTTGTCAATGACTACAAAAAAATGTT
CGGTGAACGAAAAACTGAAATCGACCGAAAGAATATTGAAACAATAAATA
TTGGCAAAATATCATCGCAGAAAGTCAAGAAATCATCAACTCCCCATCGG
ATTGAAGAGGGGGGGTATCGAGAATTAATCAGTCGATATTATGGAGATTT
TCTAGATAATCATTAATTGTCAAATTTCTATTAATTGAATGTGAC
back to top

protein sequence of SMED30010188-orf-1

>SMED30010188-orf-1 ID=SMED30010188-orf-1|Name=SMED30010188-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
MLKHPISSLVASGNIDGVNSYLKSEGNVKFIVQRDGLLHVACKYGHLNIV
KELCKYGADCGYKYPSNQRIPLHDACAFGNIDLVEFIVAKSLRFIDSIDT
NGLTPAHICVMEGELECLKILKNYDADFTVKDKNGMQLIHWASKRNHDKI
IRYLYDLEININVQCDTGKTALHYAAITNSCSAIQMLVKCNADISIEDNE
GSSPLHLAAKHNSLESLRYLVSTGIPIDIRQNRGRTPSHIASFQGFHECL
HWLLDNGADILAVEDEGNTIGHYACRGGHGETIHCFLNHNGSVDEINKLG
ENLYQTARRYGHPVIFEKAKKAEVVCSICQLEINKRKWDQLHAPPSVIRI
INQSQKSLFRNPLGSYATVVNDYKKMFGERKTEIDRKNIETINIGKISSQ
KVKKSSTPHRIEEGGYRELISRYYGDFLDNH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0005200structural constituent of cytoskeleton
GO:0008092cytoskeletal protein binding
GO:0030507spectrin binding
GO:0030674protein binding, bridging
GO:0044325ion channel binding
GO:0045296cadherin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0007009plasma membrane organization
GO:0007010cytoskeleton organization
GO:0007165signal transduction
GO:0007409axonogenesis
GO:0007411axon guidance
GO:0007528neuromuscular junction development
GO:0010628positive regulation of gene expression
GO:0010650positive regulation of cell communication by electrical coupling
GO:0010765positive regulation of sodium ion transport
GO:0010960magnesium ion homeostasis
GO:0019228neuronal action potential
GO:0034112positive regulation of homotypic cell-cell adhesion
GO:0043001Golgi to plasma membrane protein transport
GO:0043266regulation of potassium ion transport
GO:0045184establishment of protein localization
GO:0045760positive regulation of action potential
GO:0045838positive regulation of membrane potential
GO:0050808synapse organization
GO:0071286cellular response to magnesium ion
GO:0071709membrane assembly
GO:0072659protein localization to plasma membrane
GO:0072660maintenance of protein location in plasma membrane
GO:0072661protein targeting to plasma membrane
GO:0090314positive regulation of protein targeting to membrane
GO:0099612protein localization to axon
GO:1900827positive regulation of membrane depolarization during cardiac muscle cell action potential
GO:1902260negative regulation of delayed rectifier potassium channel activity
GO:2000651positive regulation of sodium ion transmembrane transporter activity
GO:2001259positive regulation of cation channel activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0009986cell surface
GO:0014704intercalated disc
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016328lateral plasma membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030054cell junction
GO:0030315T-tubule
GO:0030424axon
GO:0030425dendrite
GO:0031594neuromuscular junction
GO:0033268node of Ranvier
GO:0033270paranode region of axon
GO:0042383sarcolemma
GO:0042995cell projection
GO:0043034costamere
GO:0043194axon initial segment
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 101..130
e-value: 0.0096
score: 25.1
coord: 167..196
e-value: 0.006
score: 25.8
coord: 233..262
e-value: 0.025
score: 23.7
coord: 67..97
e-value: 1.7
score: 17.6
coord: 33..62
e-value: 0.0041
score: 26.3
coord: 266..295
e-value: 0.044
score: 22.9
coord: 200..229
e-value: 2.9E-4
score: 30.2
coord: 134..163
e-value: 0.062
score: 22.4
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 200..232
score: 12.583
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 233..265
score: 10.713
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 101..133
score: 10.205
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 167..199
score: 11.781
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 15..90
e-value: 1.4E-8
score: 35.2
coord: 107..198
e-value: 5.7E-14
score: 52.5
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 33..312
score: 64.622
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 3..342
e-value: 1.3E-74
score: 253.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 5..254
NoneNo IPR availablePFAMPF13637Ank_4coord: 202..254
e-value: 5.9E-11
score: 42.7
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 26..135
coord: 179..301
coord: 131..267
coord: 100..222