HTH CENPB-type domain-containing protein

Overview
NameHTH CENPB-type domain-containing protein
Smed IDSMED30010187
Length (bp)2959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HTH CENPB-type domain-containing protein (SMED30010187) t-SNE clustered cells

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30010187) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HTH CENPB-type domain-containing protein (SMED30010187) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30010187) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 87.0409 bits (214), Expect = 6.509e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  197 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 328          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 87.0409 bits (214), Expect = 6.509e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  197 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 328          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Match: Y48G1C.6 (pep chromosome:WBcel235:I:84991:86293:-1 gene:WBGene00021679.1 transcript:Y48G1C.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G1C.6)

HSP 1 Score: 54.299 bits (129), Expect = 9.354e-8
Identity = 42/136 (30.88%), Postives = 71/136 (52.21%), Query Frame = 3
Query: 2412 PIMSSKRCSYTTGFKLKVIE-AAERIGNRGASREYGLSEANVRRWRKNKNTLK---ECRSST---KASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDIS 2798
            P+ + KR +Y   FKL  I  A E      A+++  ++  N+++W   K  ++   E   ST   + SG GR L + DV+K+L+++VH++R     ++    R    E  K++   S FKAS  W   FM R+++S
Sbjct:    9 PVKTRKR-TYDLKFKLHAINYALEHKNISKAAKDLNVNRQNIQQWIAQKAEIEKQLEDNGSTATKRLSGGGRPLKYDDVDKELIKWVHDQRKEKQRVT----RRIIGETAKKISQNSDFKASRGWLDKFMCRHNLS 139          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Match: F21D5.4 (pep chromosome:WBcel235:IV:8738087:8739101:1 gene:WBGene00009009.1 transcript:F21D5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F21D5.4)

HSP 1 Score: 52.7582 bits (125), Expect = 4.520e-7
Identity = 41/134 (30.60%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 2412 PIMSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTL---KECRSSTK-ASGRGRKLFFPDVEKKLVEYVHER--RFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDI 2795
            P    KR ++T  FK +VI  AE+  N  A ++YG++ A ++RWR  K+ L    E +   K   G GR L   ++++K+ +++  +  + SG  I          E  K++   + FKAS  W Q FM R+ +
Sbjct:   15 PPPKKKRANFTLEFKNEVIRFAEQTNNCQAQKKYGVARACIQRWRHLKHELAFESEGKQGAKRLGGAGRPLKNVELDEKVEDWIASKNGKISGKDIK---------EYAKKINGNADFKASNGWLQRFMIRHGL 139          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Match: Y44A6D.3 (pep chromosome:WBcel235:V:20790768:20792411:-1 gene:WBGene00012854.1 transcript:Y44A6D.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y44A6D.3)

HSP 1 Score: 48.9062 bits (115), Expect = 5.892e-6
Identity = 22/56 (39.29%), Postives = 34/56 (60.71%), Query Frame = 3
Query: 2424 SKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKA 2591
            S+   Y+   KL +I  A+  GNR A RE+ ++E+++R WRKN+N L   R +  A
Sbjct:   16 SRTLKYSIDEKLAIISHAKNHGNRAAGREFNVAESSIREWRKNENKLIHNRDAAAA 71          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: CR352209.1 (pep chromosome:GRCz11:24:26088143:26089609:1 gene:ENSDARG00000103972.2 transcript:ENSDART00000171129.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352209.1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.599e-19
Identity = 48/125 (38.40%), Postives = 80/125 (64.00%), Query Frame = 3
Query: 2427 KRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDISL 2801
            KR +Y   FKL+ I  A   GNR A++++ ++E+ VR+WRK +N L++ +  TK S RG K  +P +E +L +++ E+R +G S+STV +RL+A ++ ++M     F+    WC  FMKR  +S+
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGNRAAAKQFQINESMVRKWRKQENELRQVK-KTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEH-FQGGPSWCFRFMKRRHLSI 127          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: BX914205.2 (pep chromosome:GRCz11:4:64121772:64123545:-1 gene:ENSDARG00000099590.2 transcript:ENSDART00000170040.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX914205.2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.682e-19
Identity = 48/125 (38.40%), Postives = 80/125 (64.00%), Query Frame = 3
Query: 2427 KRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDISL 2801
            KR +Y   FKL+ I  A   GNR A++++ ++E+ VR+WRK +N L++ +  TK S RG K  +P +E +L +++ E+R +G S+STV +RL+A ++ ++M     F+    WC  FMKR  +S+
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGNRAAAKQFQINESMVRKWRKQENELRQVK-KTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEH-FQGGPSWCFRFMKRRHLSI 127          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: CR354398.1 (pep chromosome:GRCz11:7:64150332:64152087:-1 gene:ENSDARG00000101994.2 transcript:ENSDART00000165234.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354398.1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.440e-19
Identity = 48/125 (38.40%), Postives = 80/125 (64.00%), Query Frame = 3
Query: 2427 KRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDISL 2801
            KR +Y   FKL+ I  A   GNR A++++ ++E+ VR+WRK +N L++ +  TK S RG K  +P +E +L +++ E+R +G S+STV +RL+A ++ ++M     F+    WC  FMKR  +S+
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGNRAAAKQFQINESMVRKWRKQENELRQVK-KTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEH-FQGGPSWCFRFMKRRHLSI 127          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 87.0409 bits (214), Expect = 5.389e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  216 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 347          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 87.0409 bits (214), Expect = 5.389e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  216 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 347          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 87.0409 bits (214), Expect = 5.522e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  204 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 335          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 87.0409 bits (214), Expect = 5.522e-17
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  204 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 335          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P215|POGK_HUMAN (Pogo transposable element with KRAB domain OS=Homo sapiens OX=9606 GN=POGK PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 3.126e-16
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  197 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 328          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TC5|POGK_MOUSE (Pogo transposable element with KRAB domain OS=Mus musculus OX=10090 GN=Pogk PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 3.636e-16
Identity = 52/132 (39.39%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 2430 RCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL---FPLP 2813
            R SY  GFKL V+E AE   N  A++++G+ E NVR WRK K  L+   +  +A    +   F  V++++ EYV   +  G  I+   ++LKALE+ +EM  P   FKAS  WC+  M+R D+SL    P+P
Sbjct:  197 RRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVP 328          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A2D4M5Y4 (HTH CENPB-type domain-containing protein (Fragment) OS=Micrurus spixii OX=129469 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.948e-20
Identity = 55/125 (44.00%), Postives = 78/125 (62.40%), Query Frame = 3
Query: 2427 KRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDISL 2801
            KR +Y  GFKLK I  A   GNR A RE+ ++E+ VR+WRK ++ L++ +  TK S RG K  +P +E K+ ++V E+R +G SISTV +RLKA  L ++M     F     WC  FMKR  +S+
Sbjct:    5 KRHAYDAGFKLKAISYAVEHGNRAAVREFSINESMVRKWRKQEDALRQVK-KTKLSFRGNKARWPQLEDKIEQWVMEQRNAGRSISTVSIRLKATALARDMEIKD-FLGGPSWCFRFMKRRHLSI 127          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A2B4SCA1 (Coiled-coil domain-containing protein 180 OS=Stylophora pistillata OX=50429 GN=CCDC180 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.351e-20
Identity = 60/132 (45.45%), Postives = 84/132 (63.64%), Query Frame = 3
Query: 2415 IMSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM---CPGSIFKASARWCQLFMKRNDISL 2801
            +  +KR SYT   KL++I  AE+ GN  A RE+G+SE+NVR WRK+K  LK+     K + RG+K  +P++E  L+E++ E+R +G +I    VRLKAL++ K      P   FKA   WCQ FMKRN +SL
Sbjct:    5 LAGTKRQSYTVSDKLRIINFAEQHGNLAAEREFGVSESNVRLWRKSKENLKKM-PRLKRANRGKKAAWPELEVGLLEWITEKRNNGLAILPSLVRLKALDMAKNEKYGIPQGQFKAGNHWCQRFMKRNGLSL 135          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A3B3BHW9 (HTH CENPB-type domain-containing protein OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.572e-19
Identity = 56/126 (44.44%), Postives = 82/126 (65.08%), Query Frame = 3
Query: 2424 SKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDISL 2801
            +KR +Y   FKLK I  AE  GNR A+REY ++E+ VR+WRK +N L++ +  T+ S RG K   P++E++L  ++ E+R SG S+STV +RL+A+ L +EM     FK    WC  FMKR + S+
Sbjct:   16 AKRHAYEAQFKLKAISYAEEHGNRAAAREYKINESMVRKWRKLENELRQAK-KTQLSFRGHKAKLPELEERLERWIIEQRASGRSVSTVTIRLRAVTLAEEMNIEH-FKGGPSWCWRFMKRCNFSI 139          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A4D5RZN6 (Putative pogo transposable element (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.820e-19
Identity = 57/129 (44.19%), Postives = 78/129 (60.47%), Query Frame = 3
Query: 2418 MSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL 2801
            M+S RC Y   FK KV+  AE  GN  A R++G+ E NVRRWRK K  L  C ++ KA    RK  FP+VE+ L +++ ERR  G ++++  V++KA E+ +E   P   FKAS  W Q +MKR   SL
Sbjct:    1 MASHRCHYDAAFKRKVVSEAEVSGNCAAGRKFGVPENNVRRWRKQKTALFACAATRKAFRGPRKGAFPEVEEVLTQFIKERRGRGLAVTSDIVQMKAREIARERGIPALKFKASRGWVQKYMKRAGFSL 129          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: B4DSL7 (HCG2040263, isoform CRA_b OS=Homo sapiens OX=9606 GN=hCG_2040263 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.080e-19
Identity = 52/129 (40.31%), Postives = 80/129 (62.02%), Query Frame = 3
Query: 2418 MSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEM-CPGSIFKASARWCQLFMKRNDISL 2801
            MSSKR  Y +  K KVI  AE+ GNR A R + +SEAN+RRWR ++N++  C+++TK     +K  +P V++ ++ +V E R  G  I+   ++LKA E+ K +    + FKA+  WC  FM+R  +SL
Sbjct:    1 MSSKRSHYDSALKRKVIVYAEKHGNRAAGRTFDISEANIRRWRNDRNSIFSCKATTKCFTGPKKGRYPQVDEAVLRFVSETRAKGLPITRQAMQLKAGEVAKTLGIDETKFKATRGWCDRFMRRAGLSL 129          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000022136.1 (SMESG000022136.1)

HSP 1 Score: 142.895 bits (359), Expect = 4.934e-38
Identity = 69/82 (84.15%), Postives = 73/82 (89.02%), Query Frame = 3
Query: 2418 MSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERR 2663
            MSSK  +Y+    L VIEAAERIGNRGAS+EYG SEANVRRWRKNKNTLKECRSSTKASG GRKLFFPDVEKKLVEY+HERR
Sbjct:    1 MSSKNHNYSV-LSLTVIEAAERIGNRGASKEYGFSEANVRRWRKNKNTLKECRSSTKASGGGRKLFFPDVEKKLVEYIHERR 81          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000024543.1 (SMESG000024543.1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.426e-15
Identity = 45/65 (69.23%), Postives = 49/65 (75.38%), Query Frame = 3
Query: 2418 MSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKL 2612
            MSSKRCSYTTGFKLKVIEAAERIGNRGASREYG SEAN      + + L+  R S  ASG  RK+
Sbjct:    1 MSSKRCSYTTGFKLKVIEAAERIGNRGASREYGFSEAN------SADPLQ--RPSFTASGNRRKV 57          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000040582.1 (SMESG000040582.1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.597e-9
Identity = 39/124 (31.45%), Postives = 71/124 (57.26%), Query Frame = 3
Query: 2427 KRCSYTTGFKLKVIEAAERIGN-RGASREYGLSEANVRRWRKNKNTLKECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALELVKEMCPGSIFKASARWCQLFMKRNDI 2795
            +R S+++  K ++IE A ++GN R  +R Y ++E  +RRW   ++ +K  ++  + S RG    +P++E KL E++  +R     +S V + L+A  + KEM    +  AS++W   FMK  +I
Sbjct:   12 QRRSFSSAKKKEIIELARQLGNIREVARRYNINETVIRRWIAQESVIK-AKNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIHLQAQVIAKEMKIEGL-AASSQWTDNFMKCKNI 133          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 50.0618 bits (118), Expect = 7.713e-9
Identity = 23/58 (39.66%), Postives = 38/58 (65.52%), Query Frame = 1
Query:  598 LLCVKKKDIHDFRIYLVFRTIINMTDQKIFLIPNANEQLDALKEGKYFSTIELNEQFF 771
            L+CV KK+  D R+ L FR +  +T+++ F +PN +E LD L   +YFS+I+L   ++
Sbjct: 2767 LVCVWKKEKKDIRLCLDFRQLNKITERQAFPMPNVDEILDILHGSRYFSSIDLGNAYY 2824          

HSP 2 Score: 30.0314 bits (66), Expect = 7.713e-9
Identity = 18/40 (45.00%), Postives = 26/40 (65.00%), Query Frame = 3
Query:  489 IIMNPRRQPFHLLQKIINIVKH-EDVW*KRECNSM*NTPM 605
            I++ PRRQP +L  KI   +K+ E+    R+CNS  NTP+
Sbjct: 2728 IMIKPRRQPINLEDKIEEAIKNLENNGIIRKCNSPWNTPL 2767          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000029866.1 (SMESG000029866.1)

HSP 1 Score: 49.6766 bits (117), Expect = 7.295e-8
Identity = 23/58 (39.66%), Postives = 37/58 (63.79%), Query Frame = 1
Query:  598 LLCVKKKDIHDFRIYLVFRTIINMTDQKIFLIPNANEQLDALKEGKYFSTIELNEQFF 771
            L+C+KKKD  + R+ L F  +   +++ IF IPN  E LD++   KYF+T++L   F+
Sbjct:  119 LVCIKKKDCENIRLCLDFGLLNKSSERPIFPIPNIEEILDSIYGAKYFTTVDLGSVFY 176          

HSP 2 Score: 27.335 bits (59), Expect = 7.295e-8
Identity = 12/15 (80.00%), Postives = 12/15 (80.00%), Query Frame = 3
Query:  489 IIMNPRRQPFHLLQK 533
            IIMN RRQP HLL K
Sbjct:   80 IIMNSRRQPVHLLPK 94          
The following BLAST results are available for this feature:
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
POGK6.509e-1739.39pogo transposable element derived with KRAB domain... [more]
POGK6.509e-1739.39pogo transposable element derived with KRAB domain... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y48G1C.69.354e-830.88pep chromosome:WBcel235:I:84991:86293:-1 gene:WBGe... [more]
F21D5.44.520e-730.60pep chromosome:WBcel235:IV:8738087:8739101:1 gene:... [more]
Y44A6D.35.892e-639.29pep chromosome:WBcel235:V:20790768:20792411:-1 gen... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CR352209.12.599e-1938.40pep chromosome:GRCz11:24:26088143:26089609:1 gene:... [more]
BX914205.22.682e-1938.40pep chromosome:GRCz11:4:64121772:64123545:-1 gene:... [more]
CR354398.14.440e-1938.40pep chromosome:GRCz11:7:64150332:64152087:-1 gene:... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pogk5.389e-1739.39pogo transposable element with KRAB domain [Source... [more]
Pogk5.389e-1739.39pogo transposable element with KRAB domain [Source... [more]
Pogk5.522e-1739.39pogo transposable element with KRAB domain [Source... [more]
Pogk5.522e-1739.39pogo transposable element with KRAB domain [Source... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9P215|POGK_HUMAN3.126e-1639.39Pogo transposable element with KRAB domain OS=Homo... [more]
sp|Q80TC5|POGK_MOUSE3.636e-1639.39Pogo transposable element with KRAB domain OS=Mus ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D4M5Y41.948e-2044.00HTH CENPB-type domain-containing protein (Fragment... [more]
A0A2B4SCA18.351e-2045.45Coiled-coil domain-containing protein 180 OS=Stylo... [more]
A0A3B3BHW93.572e-1944.44HTH CENPB-type domain-containing protein OS=Oryzia... [more]
A0A4D5RZN63.820e-1944.19Putative pogo transposable element (Fragment) OS=I... [more]
B4DSL74.080e-1940.31HCG2040263, isoform CRA_b OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022136.14.934e-3884.15SMESG000022136.1[more]
SMESG000024543.12.426e-1569.23SMESG000024543.1[more]
SMESG000040582.12.597e-931.45SMESG000040582.1[more]
SMESG000029259.17.713e-939.66SMESG000029259.1[more]
SMESG000029866.17.295e-839.66SMESG000029866.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010187 ID=SMED30010187|Name=HTH CENPB-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2959bp
AGTTTACTAATAATGTAATTAAATATGATAAGTTTAATGGTAAACCAAGT
GTTTCAAAATATATTAATGGTATTGGATTTTATTATTTGTTAGACACGAG
GGCTAAAGTTAGTGTTATGGATAAAGTTTATTTAAAAGATTGGAATTAAT
AAGCTTGAAAAATGTTTAACAAAATTAAGGTGTACCAATGAATCACATAT
TACAATTTTTGGTAAAGTTATTATTTATTGTTTTAAATTTTAGGTATTCT
AGATCTAAAACGTGTTGAGTATATTAATACTGAAGAAATTTCTCGATAAT
TAATTGGCGGAATTTATTTTTAAAAGATATTTGATATTATGTTTTTTAAA
TTGTAAATAAAAATTATCAAAAAAATAACAACAACCTTACTAAATTATTA
GTAAAATATGATGATATTTTTATGAAACACAAAGTGGATGTGGGAAAACT
AATTTATTAATTCGTGAAACTTTAATTTCAGACTTGTTATTATTATGAAT
CCAAGACGACAACCATTTCATTTATTGCAAAAAATAATAAATATAGTAAA
ACATGAAGACGTTTGGTAAAAAAGAGAGTGTAATTCAATGTGAAACACTC
CTATGTGTGAAAAAGAAGGATATACATGACTTTCGGATATATTTGGTCTT
TAGAACTATTATAAATATGACAGACCAAAAGATTTTTTTGATTCCGAATG
CTAATGAACAATTGGATGCTTTAAAAGAAGGAAAATATTTTAGTACAATT
GAGTTGAATGAACAATTTTTCTAATCAAATTTCATTTAAAAAAGTGGCGA
CCCCAGTATCTTTTTAAAATCTGTTGAATGCTGTTTTCGGTGAAATTAAC
TGGGATTTAGCGATCGTATAATTATATATTTTTTTTCAAGGAAAATAAGT
AATCACTTACAATGTTGAATGTATTTTAGGAAAAATTAAACAAACCTTAT
AACAAACCTAAAAGCTCATTGAAATGTCAATTTTAAAAAGATGAAGAATG
TTCCTTGGTAACGAGTGATAAGTATAAATTGTTTGAAAACTAATGCAAAA
AAATTCTAGTGGTAAAACAATTTGAAAGACTCAATTATGTTAACCCCTTT
ACCGTATGTCACGAGTTAACTCGTCATAATAAATGTTGGGCTTAACCATG
AACCACAAGTTAAAAAAGTACGAAAATTCAGGTTTTCTTATTTTCCTCAC
AATTCCTAAAAGACAACTCATTTTCACTTAAAAAAACATTTTATTTTGAC
AGGACAACATAACATCAAATTATGAAAGAAAAAATACACGGTTTGCATAA
CAAAAAAATTTTTTCCACGGTAAAAGGGTTAAGGATGGTTTTAGAATTAT
AAATAAAAAATTTATTAAATATTACATGGAAAATTCAAATATTTTAGAAA
AGTTTTGTGGAGGTAAATTAAAAAGATGGAACGAGGAAAGACTGTTTGTT
TTATCTGAACAAATATTTCTGATGTTAAATTGCCTTCACATCCTTAGCAT
GGGATGAAAAATTGCATTGAATCCAGCATAGTTGGCTCACGCGCTTGACT
TTATTATCCAATCCATTTCAATCGGAAGTTATATTCACTTAAGTAGAGCA
TTCAATAGCTTCTTTTTGGAAAATCGGCCACGATATCAGCATTATTCGGA
TTTTCAAAACATTGGTATAGGTCATATAAAATTCCTGACATTACGTCAGC
TTCATCTCCTGTATCATTATCACGTAAAACCTTTCGATGATGCTTGGCTC
CACCTTTTCCTCCTTTACCGCAACCAGACATTTTTATTCAATAAAATTTC
AATTTTAATAACAATAAAATCAAATTTCAAGATTTATTTTAAATGAGAAG
ATTCAAATAATGTATTCCGAATAATAATTTTCCAATATAATTAAAATATA
CAAAGTTTTTCAAAAGTTATTTCAAAATTTCCACAAACGAAAATTTCCAA
TTGATTTGATTAAACAACAACTAGTTCCATTAATTTCGATAAATCCAAAA
ACTGATTGTTCAAATCAAAATTCAATCTTTTAATTAACGATGCGCACACA
GACGCGAGAACACACCCACACAAATTACAAGTCGATACAAAAACAACGAT
GCACACACAGACTCACAAAATTCACAACAAAGGCGTACACAGATGCCAAA
CACAATTTATCTGGCCGAAACAGACTAAATATGAAGGAAGCTATTGTAAA
CAAGGAAAGAACTTTTTTGTAATTATCCGAATATAAGACGCACCCAATAT
AAGACGCATCATTAAAAATTGACTGAATTCAAGAAAATATAAGTAACCCA
AATATAAGACGCATGTATAATTATTACCTTACATTAAATTTATTATTAAA
TTTATTTTTTGTTTAAAATTAAAATTTCAGTTACCTAAATTCAAATTTAA
ATTTTTATTTCCCTATAATGTCTTCAAAACGCTGCAGTTATACGACAGGT
TTCAAATTGAAGGTAATTGAAGCAGCCGAACGTATCGGAAATAGAGGAGC
ATCTAGAGAATATGGACTCAGTGAAGCTAATGTAAGGCGTTGGAGAAAAA
ATAAAAATACTTTAAAAGAGTGCAGATCCTCTACAAAGGCCTCTGGCAGA
GGTAGGAAATTATTTTTTCCTGATGTGGAGAAAAAATTAGTTGAATATGT
TCATGAAAGGCGATTTTCAGGTTCCTCAATATCCACTGTAGAAGTTAGGT
TGAAGGCTTTAGAGTTAGTCAAGGAGATGTGTCCTGGTTCAATATTTAAA
GCCTCAGCGCGCTGGTGCCAGCTTTTCATGAAAAGGAATGATATTTCTTT
ATTTCCCTTGCCCATACTGGTTTTTCAGAAAATTTTCTGAGTAGGAAAAA
TATTTCCTGTTATACCCATGTATAAGACGCACCACGATTATCATCCCCAA
AAGTGATGAAAAAAAAGCGTCTTATATTCGGATAATCAATTAAATTTGTT
TATATAAGC
back to top

protein sequence of SMED30010187-orf-1

>SMED30010187-orf-1 ID=SMED30010187-orf-1|Name=SMED30010187-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MSSKRCSYTTGFKLKVIEAAERIGNRGASREYGLSEANVRRWRKNKNTLK
ECRSSTKASGRGRKLFFPDVEKKLVEYVHERRFSGSSISTVEVRLKALEL
VKEMCPGSIFKASARWCQLFMKRNDISLFPLPILVFQKIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR006600HTH_CenpB_DNA-bd_dom
IPR018586Brinker_DNA-bd
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding