Frizzled-4

Overview
NameFrizzled-4
Smed IDSMED30010183
Length (bp)2472
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Frizzled-4 (SMED30010183) t-SNE clustered cells

Violin plots show distribution of expression levels for Frizzled-4 (SMED30010183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Frizzled-4 (SMED30010183) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Frizzled-4 (SMED30010183) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30010183SMESG000014322.1 dd_Smed_v4_7210_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010183SMESG000014322.1 SmedASXL_005695SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30010183SMESG000014322.1 dd_Smed_v4_7210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010183SMESG000014322.1 dd_Smed_v4_7210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010183SMESG000014322.1 dd_Smed_v4_7210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010183SMESG000014322.1 dd_Smed_v6_7210_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010183SMESG000014322.1 OX_Smed_1.0.00971ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD4 (frizzled class receptor 4 [Source:HGNC Symbol;Acc:HGNC:4042])

HSP 1 Score: 447.973 bits (1151), Expect = 2.154e-148
Identity = 232/468 (49.57%), Postives = 310/468 (66.24%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE +++ F   WP +LNCS+FP +N    MCMEGPG      P     +  +       N   +I++ R+  CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   +  S  + N+ V MLKIFMS +VGITSG+W+WS KTL +WQ
Sbjct:   41 EERRCDPIRISM--CQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQ 505          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 410.609 bits (1054), Expect = 2.294e-133
Identity = 224/517 (43.33%), Postives = 308/517 (59.57%), Query Frame = 2
Query:  338 SIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG-----PSVKST-------------------ENFQTMCGGMKNPRLFIFINRTQKCVPKCS--ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW--------------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFC 1750
            S+ +E     KC P  I +P C+++ YN T MPNL+  E Q EA  QL  F  L++Y C  +L FFLCS+Y PMC    +  I  C+ +CE+ R  C  IM  FN  WP +L+C + P +N    +CME P      P+  S                    ++     GG  NP  F  + ++  C P C+   ++ ++ +DK  A +WL + A LCF SS FT+LTFLI+  RF+YPERP+IFL++CY +YSV + I L    +S AC+RD  SGQ  + QEGL++T C ++FL+ ++F  AS +WWV+LT+ W LAAG KW  EAI   S YFHLAAW I ++ T+ +LV+R V  DEL G+C VG  +V+ L  FV+IP   +LVIG  F+L G VAL  +RR +K  G  T+KLE LMVRIGLFSVL+ VP++ V+ C FYE  N D+W                    L + + P +E++M+KIFM  VVGITSG+W+W+ KTL+SWQ  C
Sbjct:   23 SMDMERPGDGKCQP--IEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRD--SGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVC 535          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD9 (frizzled class receptor 9 [Source:HGNC Symbol;Acc:HGNC:4047])

HSP 1 Score: 396.356 bits (1017), Expect = 9.285e-128
Identity = 220/551 (39.93%), Postives = 313/551 (56.81%), Query Frame = 2
Query:  293 DGITLDSQRFPRDTHSIVLEPVQTRKCLP-KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP-----GPS---------------VKSTENFQTMCGGM---KNPRLFIFINRTQKCVPKCSANI--LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW----------------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKM--------CCRKP 1777
             G  L+  RF         +P + R   P + + +P C+ + YN T MPNL+   +Q EA ++L  F  L++Y C  +L FFLCS+Y PMC    +  I  C+P+CE+ R  C  IM  FN  WP +L+C+R P RN   ++CME P     GP+                +   +     GG    +NP  F ++ +++ C P+C   +   ++  DK  A +W+ V ++LCF S+ FT+LTFL+   RF+YPERP+IFL++CY++YS++  I      QS AC+++  +G   + QEGL+NT C ++FLL ++F  AS +WWV+LT+ W LAAG KW  EAI     YFH+AAW + +L T+ +L LR V  DEL GLC V   + + L  FV++P   +LV+G  FLL G VAL  +R+ +K  G  TEKLE LMV+IG+FS+L+ VP++ V+ C  YE  N D W                      L  G+ P + V+MLKIFMS VVGITSGVWVWS KT ++WQ  C  K+         CR P
Sbjct:   19 GGAALEIGRF---------DPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQE--AGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAP 558          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 355.525 bits (911), Expect = 4.094e-112
Identity = 205/519 (39.50%), Postives = 288/519 (55.49%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPV--RNAEGSMCMEG-------------------PGPSVKSTENFQTMCGG-------------MKNPRLFIFINRTQKCVPKCSANIL---FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGT-------------NPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRS 1786
            ++I VP C+ + YN T MPN  N +TQ EA  ++  F  L++ +CS +L FFLCS+Y P+C P  +  + PC+ +CE  +  C  +MR +   WP  ++C R PV  R+AE  +CM+                    PGP        +   GG             +K         RT + VP C+       F+ D++  A  W+ + + LCFIS+  T+ TFLI+ +RF+YPERP+IFL+ CY   S+   + L     S AC+R+       +  E     LC I+FLL +FF  AS IWWVIL++ W LAAG KW  EAI   + YFHLAAWLI S+ ++  L L SVD D + G+C VG QN+++L  FV+ P +++L++G  FLL G V+L R+R  +K  G KT+KLE LM+RIG+F++L+ VP+S V+ C  YE   R+ W  + T              P   V MLK FM  VVGITSGVW+WS KT+ESW+ F     CC +P R 
Sbjct:   34 QEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAE-VLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQ-VPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE----HNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRF--TSRCCCRPRRG 544          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD2 (frizzled class receptor 2 [Source:HGNC Symbol;Acc:HGNC:4040])

HSP 1 Score: 330.872 bits (847), Expect = 5.305e-103
Identity = 189/515 (36.70%), Postives = 276/515 (53.59%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAE----GSMCMEGPGPSVKSTE-----------------------NFQTMCGGMKNPRL--------FIFINRTQKCVPKCS-----ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS-------------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            + I +P C ++ YN T MPNL+    Q +A  ++  F  L+K +CS  L FFLCS+Y P+C  +    I PC+ +CE  R  CE +M  F   WP  L C  FP   AE    G    E   P++ +T                         + T+      PR+        + F+   + C   C       ++ F+ ++   A++W+   + LC  S+ FT+ T+L++  RF+YPERP+IFL+ CY++ SV++       ++   CN       +    +G     C I+F++ +FFS AS IWWVIL++ W LAAG KW  EAI   S YFHLAAW + ++ T+ +L +  +D D L G+C VG  ++  L  FV+ P  ++L IG  FLL G V+L R+R  +K+DG KTEKLE LMVRIG+FSVL+ VP++ V+ C FYE A R+HW +S                     +P+  VYM+K  M+ +VGITSG W+WS KTL SW+ F
Sbjct:   40 QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQ-AIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGE-RDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFV-LQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKF 551          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 272.707 bits (696), Expect = 1.317e-81
Identity = 177/525 (33.71%), Postives = 267/525 (50.86%), Query Frame = 2
Query:  323 PRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRL------------------FIFINR---TQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLK--------SG-----TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIE 1795
            P  T SI  + V+  KC+P  I +  C++L YN+T  PN +    Q   Q+  + F+ L+K KC  ++ FF+CSV+ PMC       +  C+ +CE+V+  C  I+  F + WP  LNC++FP          + P   +K TE+  T  GG   PRL                   + ++       C   C +N++F+ D+K + + W    A+     ++F+ LTF I+  RF++PER V +L++C  I S+ +   L       +C+    +G+  L+    DN+ C   FLLN+FFSTA+ +WW++ +    L+ G KW  E I   S Y H  AW +SSL T+ VL+   VDA EL  LCSVG  N   LL FVI+P  I +VIG  F++GG  ++ R R   +  G  T KLE LMV++G F  LF++P+   L C  Y++     W +        SG     T P  E+YM  +  S   G +  +WV S KT+ +W+ F    MC   P ++ IE
Sbjct:   13 PLATGSIFDQAVKG-KCIPIDIEL--CKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP----------DPPELCMKPTEDEIT--GGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALG-NGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIE 521          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 272.707 bits (696), Expect = 1.317e-81
Identity = 177/525 (33.71%), Postives = 267/525 (50.86%), Query Frame = 2
Query:  323 PRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRL------------------FIFINR---TQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLK--------SG-----TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIE 1795
            P  T SI  + V+  KC+P  I +  C++L YN+T  PN +    Q   Q+  + F+ L+K KC  ++ FF+CSV+ PMC       +  C+ +CE+V+  C  I+  F + WP  LNC++FP          + P   +K TE+  T  GG   PRL                   + ++       C   C +N++F+ D+K + + W    A+     ++F+ LTF I+  RF++PER V +L++C  I S+ +   L       +C+    +G+  L+    DN+ C   FLLN+FFSTA+ +WW++ +    L+ G KW  E I   S Y H  AW +SSL T+ VL+   VDA EL  LCSVG  N   LL FVI+P  I +VIG  F++GG  ++ R R   +  G  T KLE LMV++G F  LF++P+   L C  Y++     W +        SG     T P  E+YM  +  S   G +  +WV S KT+ +W+ F    MC   P ++ IE
Sbjct:   13 PLATGSIFDQAVKG-KCIPIDIEL--CKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP----------DPPELCMKPTEDEIT--GGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALG-NGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIE 521          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 272.707 bits (696), Expect = 1.317e-81
Identity = 177/525 (33.71%), Postives = 267/525 (50.86%), Query Frame = 2
Query:  323 PRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRL------------------FIFINR---TQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLK--------SG-----TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIE 1795
            P  T SI  + V+  KC+P  I +  C++L YN+T  PN +    Q   Q+  + F+ L+K KC  ++ FF+CSV+ PMC       +  C+ +CE+V+  C  I+  F + WP  LNC++FP          + P   +K TE+  T  GG   PRL                   + ++       C   C +N++F+ D+K + + W    A+     ++F+ LTF I+  RF++PER V +L++C  I S+ +   L       +C+    +G+  L+    DN+ C   FLLN+FFSTA+ +WW++ +    L+ G KW  E I   S Y H  AW +SSL T+ VL+   VDA EL  LCSVG  N   LL FVI+P  I +VIG  F++GG  ++ R R   +  G  T KLE LMV++G F  LF++P+   L C  Y++     W +        SG     T P  E+YM  +  S   G +  +WV S KT+ +W+ F    MC   P ++ IE
Sbjct:   13 PLATGSIFDQAVKG-KCIPIDIEL--CKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP----------DPPELCMKPTEDEIT--GGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALG-NGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIE 521          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 271.552 bits (693), Expect = 4.063e-81
Identity = 179/549 (32.60%), Postives = 272/549 (49.54%), Query Frame = 2
Query:  323 PRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRL------------------FIFINRTQ---KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLK--------SG-----TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISID 1867
            P  T SI  + V+  KC+P  I +  C++L YN+T  PN +    Q   Q+  + F+ L+K KC  ++ FF+CSV+ PMC       +  C+ +CE+V+  C  I+  F + WP  LNC++FP          + P   +K TE+  T  GG   PRL                   + ++       C   C +N++F+ D+K + + W    A+     ++F+ LTF I+  RF++PER V +L++C  I S+ +   L       +C+    +G+  L+    DN+ C   FLLN+FFSTA+ +WW++ +    L+ G KW  E I   S Y H  AW +SSL T+ VL+   VDA EL  LCSVG  N   LL FVI+P  I +VIG  F++GG  ++ R R   +  G  T KLE LMV++G F  LF++P+   L C  Y++     W +        SG     T P  E+YM  +  S   G +  +WV S KT+ +W+ F    MC   P +       N    +    +AT+   I  +
Sbjct:   13 PLATGSIFDQAVKG-KCIPIDIEL--CKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP----------DPPELCMKPTEDEIT--GGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALG-NGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKVKPNRAINTSIARATNCSATTTTGIHAN 545          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 271.552 bits (693), Expect = 4.063e-81
Identity = 179/549 (32.60%), Postives = 272/549 (49.54%), Query Frame = 2
Query:  323 PRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRL------------------FIFINRTQ---KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLK--------SG-----TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISID 1867
            P  T SI  + V+  KC+P  I +  C++L YN+T  PN +    Q   Q+  + F+ L+K KC  ++ FF+CSV+ PMC       +  C+ +CE+V+  C  I+  F + WP  LNC++FP          + P   +K TE+  T  GG   PRL                   + ++       C   C +N++F+ D+K + + W    A+     ++F+ LTF I+  RF++PER V +L++C  I S+ +   L       +C+    +G+  L+    DN+ C   FLLN+FFSTA+ +WW++ +    L+ G KW  E I   S Y H  AW +SSL T+ VL+   VDA EL  LCSVG  N   LL FVI+P  I +VIG  F++GG  ++ R R   +  G  T KLE LMV++G F  LF++P+   L C  Y++     W +        SG     T P  E+YM  +  S   G +  +WV S KT+ +W+ F    MC   P +       N    +    +AT+   I  +
Sbjct:   13 PLATGSIFDQAVKG-KCIPIDIEL--CKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP----------DPPELCMKPTEDEIT--GGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALG-NGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKVKPNRAINTSIARATNCSATTTTGIHAN 545          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0075743)

HSP 1 Score: 302.753 bits (774), Expect = 1.795e-92
Identity = 198/570 (34.74%), Postives = 291/570 (51.05%), Query Frame = 2
Query:  245 RNLLYMLGFLLY-IKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKK-----ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEG----------PGPSVK--STENFQTMCGGMKNPR--------------------LFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVS-----GQF----ILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWL----------------------KSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            R +L++L  L+  ++  D   LD+  + R    ++         LP       I +  C+N+ YN T MPNL+    Q EA  ++  F  L+K  CS +L  FLCS+Y+P+C  I    I PC+ LCE  R  CE++M+ +N  WP  L CS+FPV   E     E           P  SV   +T   QT   G+++P                     L +       C   C A + F   ++ + + W+   A++C  S +FT+LTFLI++ RF+YPER ++FLAVCY +   ++   L     S +C R+P       G+      +TQ     T C ++F+  +F   A+  WW  L  AW LAAG KW  EAI  +S  FHL AW + +L T++VL L  V+ D L G+C VGQ +  +L  F+I+P  I+L IG  FLL G ++L R+R  +K DG +T+KLE LM+RIG FS LF++P+  +LGC FYEY N D W+                           P  +++M+K   S +VG+TS VW++S KT+ SW+ F
Sbjct:    3 RQILFILPTLIQGVQRYDQSPLDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCT-ILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQT---GVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGL-GAGDSVSC-REPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVSWRNF 564          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0330102)

HSP 1 Score: 303.138 bits (775), Expect = 3.024e-92
Identity = 198/570 (34.74%), Postives = 291/570 (51.05%), Query Frame = 2
Query:  245 RNLLYMLGFLLY-IKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKK-----ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEG----------PGPSVK--STENFQTMCGGMKNPR--------------------LFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVS-----GQF----ILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWL----------------------KSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            R +L++L  L+  ++  D   LD+  + R    ++         LP       I +  C+N+ YN T MPNL+    Q EA  ++  F  L+K  CS +L  FLCS+Y+P+C  I    I PC+ LCE  R  CE++M+ +N  WP  L CS+FPV   E     E           P  SV   +T   QT   G+++P                     L +       C   C A + F   ++ + + W+   A++C  S +FT+LTFLI++ RF+YPER ++FLAVCY +   ++   L     S +C R+P       G+      +TQ     T C ++F+  +F   A+  WW  L  AW LAAG KW  EAI  +S  FHL AW + +L T++VL L  V+ D L G+C VGQ +  +L  F+I+P  I+L IG  FLL G ++L R+R  +K DG +T+KLE LM+RIG FS LF++P+  +LGC FYEY N D W+                           P  +++M+K   S +VG+TS VW++S KT+ SW+ F
Sbjct:    3 RQILFILPTLIQGVQRYDQSPLDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCT-ILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQT---GVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGL-GAGDSVSC-REPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVSWRNF 564          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 268.085 bits (684), Expect = 2.360e-78
Identity = 146/326 (44.79%), Postives = 201/326 (61.66%), Query Frame = 2
Query:  827 VPKCS---ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKND-----GIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS-----------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            VP C        F+ D+K  A +W+ + + LCF S++ T+ TF+I+T+RFKYPERP++FL+ CY + +V +        +  AC+        +L +       C ++FLL +FF  AS IWWVIL+  W LAAG KW  EAI + S YFHLAAWLI ++ +VAVL+L +VD D +LG+C VG  N   L  FV+ P  ++LVIG  FL+ G V+L R+R  +K       G+K +KLE LM+RIG+FSVL+ VP++ V+GC  YE A  + W+K+           G  P   V MLK FM+  VGITSGVW+WS KTLESW+ F
Sbjct:  297 VPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACD------GLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRF 616          

HSP 2 Score: 97.0561 bits (240), Expect = 2.563e-20
Identity = 43/117 (36.75%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP 730
            ++I +P C+ + YN T  PN +N ETQ EA  ++  F  L++ KCS +L FFLCS+Y P+C    +  +  C+ +CE  R  C  IM+ ++  WP  + C   P+     ++CME P
Sbjct:   65 EEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQP 181          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 268.085 bits (684), Expect = 2.360e-78
Identity = 146/326 (44.79%), Postives = 201/326 (61.66%), Query Frame = 2
Query:  827 VPKCS---ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKND-----GIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS-----------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            VP C        F+ D+K  A +W+ + + LCF S++ T+ TF+I+T+RFKYPERP++FL+ CY + +V +        +  AC+        +L +       C ++FLL +FF  AS IWWVIL+  W LAAG KW  EAI + S YFHLAAWLI ++ +VAVL+L +VD D +LG+C VG  N   L  FV+ P  ++LVIG  FL+ G V+L R+R  +K       G+K +KLE LM+RIG+FSVL+ VP++ V+GC  YE A  + W+K+           G  P   V MLK FM+  VGITSGVW+WS KTLESW+ F
Sbjct:  297 VPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACD------GLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRF 616          

HSP 2 Score: 97.0561 bits (240), Expect = 2.563e-20
Identity = 43/117 (36.75%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP 730
            ++I +P C+ + YN T  PN +N ETQ EA  ++  F  L++ KCS +L FFLCS+Y P+C    +  +  C+ +CE  R  C  IM+ ++  WP  + C   P+     ++CME P
Sbjct:   65 EEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQP 181          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 268.085 bits (684), Expect = 2.360e-78
Identity = 146/326 (44.79%), Postives = 201/326 (61.66%), Query Frame = 2
Query:  827 VPKCS---ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKND-----GIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS-----------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            VP C        F+ D+K  A +W+ + + LCF S++ T+ TF+I+T+RFKYPERP++FL+ CY + +V +        +  AC+        +L +       C ++FLL +FF  AS IWWVIL+  W LAAG KW  EAI + S YFHLAAWLI ++ +VAVL+L +VD D +LG+C VG  N   L  FV+ P  ++LVIG  FL+ G V+L R+R  +K       G+K +KLE LM+RIG+FSVL+ VP++ V+GC  YE A  + W+K+           G  P   V MLK FM+  VGITSGVW+WS KTLESW+ F
Sbjct:  297 VPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACD------GLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRF 616          

HSP 2 Score: 97.0561 bits (240), Expect = 2.563e-20
Identity = 43/117 (36.75%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP 730
            ++I +P C+ + YN T  PN +N ETQ EA  ++  F  L++ KCS +L FFLCS+Y P+C    +  +  C+ +CE  R  C  IM+ ++  WP  + C   P+     ++CME P
Sbjct:   65 EEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQP 181          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 427.172 bits (1097), Expect = 6.719e-140
Identity = 227/526 (43.16%), Postives = 317/526 (60.27%), Query Frame = 2
Query:  338 SIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP----------------------GPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSA--NILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN--------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFC---LVKMCCRK 1774
            S  LE  +  KC P  I++P CQ + YN T MPN ++ + Q EA  +L  F  L++Y C  +L FFLCS+Y PMC    +  I  C+P+CE+ R  C  IM  FN  WP +LNCS+ P RN   ++CME P                       P   +  +  TM G  +NP  F ++ +++ C P+CS+  ++ ++  DK  A IW+ V ++LCF+S+ FT+LTFL++  RF+YPERP+IFL++CY++YSV+  I      ++ AC+R+  +G+  + QEGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I +L T+ +L +R V  DEL GLC VG  +V  L  FV++P   +LVIG  F+L G VAL  +R+ +K +G  TEKLE LMV+IG++S+L+ VP++ V+ C FYE  N D+W   G                      P + V+MLKIFMS VVGITSGVWVWS KTL++WQ  C   L    CRK
Sbjct:   27 SYDLERGRPAKCEP--IVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDTKTETKKGEGMLPVPPRPRQPGAGNARSGGTM-GVCENPEKFQYVEKSETCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVALFHIRKVMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIICYFYERLNMDYWKFRGLQSKCTTFPGRRNEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLTDRTCRK 547          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 427.172 bits (1097), Expect = 6.719e-140
Identity = 227/526 (43.16%), Postives = 317/526 (60.27%), Query Frame = 2
Query:  338 SIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP----------------------GPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSA--NILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN--------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFC---LVKMCCRK 1774
            S  LE  +  KC P  I++P CQ + YN T MPN ++ + Q EA  +L  F  L++Y C  +L FFLCS+Y PMC    +  I  C+P+CE+ R  C  IM  FN  WP +LNCS+ P RN   ++CME P                       P   +  +  TM G  +NP  F ++ +++ C P+CS+  ++ ++  DK  A IW+ V ++LCF+S+ FT+LTFL++  RF+YPERP+IFL++CY++YSV+  I      ++ AC+R+  +G+  + QEGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I +L T+ +L +R V  DEL GLC VG  +V  L  FV++P   +LVIG  F+L G VAL  +R+ +K +G  TEKLE LMV+IG++S+L+ VP++ V+ C FYE  N D+W   G                      P + V+MLKIFMS VVGITSGVWVWS KTL++WQ  C   L    CRK
Sbjct:   27 SYDLERGRPAKCEP--IVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDTKTETKKGEGMLPVPPRPRQPGAGNARSGGTM-GVCENPEKFQYVEKSETCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVALFHIRKVMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIICYFYERLNMDYWKFRGLQSKCTTFPGRRNEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLTDRTCRK 547          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: BX322606.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_52:56018527:56021879:1 gene:ENSDARG00000102815.2 transcript:ENSDART00000169635.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX322606.1)

HSP 1 Score: 415.231 bits (1066), Expect = 4.735e-135
Identity = 220/511 (43.05%), Postives = 315/511 (61.64%), Query Frame = 2
Query:  347 LEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP----GPSVKSTENF----------QTMCGGM-------KNPRLFIFINRTQKCVPKCS--ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW-LKSGTN-------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFC 1750
            LE  +  KC P  I +P CQ + YN T MPNL+N E+Q EA  +L  F  L+KY C  +L FFLCS+Y+PMC    +  I  C+P+CE+ R  C  IM  F+  WP +L+CS+ P  N   ++C+E P     P  K  E             T+ G +       +NP  F ++++++ C P+C+   ++ ++  DK  A IW+ V ++LCF+S+ FT+LTFL++  RF+YPERP+IFL++CY+IYSV+  I      ++ AC+R+  +G+  + +EGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L +R V  DEL GLC VG  + S L  FV+IP   +L++G  F+L G VAL  +R+ +K  G  TEKLE LMV+IG+FS+L+ VP++ V+ C FYE  N ++W  ++  N                   P + V+MLKIFMS VVGITSGVWVWS KTL++WQ  C
Sbjct:   41 LEHGRPGKCEP--ITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVPPRSRQPTTVSGRISSISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRE--NGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWKFRALENKCVSFPGRRSDDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLC 547          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd4 (frizzled class receptor 4 [Source:ZFIN;Acc:ZDB-GENE-990415-217])

HSP 1 Score: 410.994 bits (1055), Expect = 2.008e-134
Identity = 217/490 (44.29%), Postives = 302/490 (61.63%), Query Frame = 2
Query:  386 ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG----------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKK 1822
            I +  CQ+L YN T MPNLV    Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC       IGPC  +C  V+  C  +++ F   WP  LNCS FP  N +  MCMEGPG          P     E    +  G++    + ++ R+  C  +C  +  L+    K    +W+ V A LCFIS+ FT+LTFL+++ RF YPERP+IFL++C +IYSV+  + L   R+  +C+ +  +   +L QEGL NT CAI+FLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDAD+L G+C VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   + ++  +  +   ML+IFMS +VGITSG+WVWS KTL +WQ          + +  ++   +NN  K+
Sbjct:   32 IRISMCQDLGYNVTKMPNLVGNVLQSDAELQLTTFTPLIQYGCSSQLKFFLCSVYVPMCTEKVPIPIGPCGSMCMSVKRKCLPVLQEFGFVWPELLNCSLFPPTNDQNHMCMEGPGDEDPPFHAVRPVAPQEEECIALGAGVEQ---YAWVKRSGSCSLQCGYDTGLYRRQAKVFTDVWMAVWAVLCFISTTFTVLTFLVDSSRFSYPERPIIFLSMCCNIYSVAFIVRLTVGRERISCDLEEAAVP-VLVQEGLKNTGCAIVFLLTYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADDLAGMCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWADFRQTARDSYMAAEMLRIFMSLLVGITSGMWVWSAKTLHTWQ----------RCSHRLVHTGRNNRVKR 507          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 412.535 bits (1059), Expect = 2.755e-134
Identity = 219/508 (43.11%), Postives = 314/508 (61.81%), Query Frame = 2
Query:  347 LEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP----GPSVKSTENF----------QTMCGGM-------KNPRLFIFINRTQKCVPKCS--ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW-LKSGTN-------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            LE  +  KC P  I +P CQ + YN T MPNL+N E+Q EA  +L  F  L+KY C  +L FFLCS+Y+PMC    +  I  C+P+CE+ R  C  IM  F+  WP +L+CS+ P  N   ++C+E P     P  K  E             T+ G +       +NP  F ++++++ C P+C+   ++ ++  DK  A IW+ V ++LCF+S+ FT+LTFL++  RF+YPERP+IFL++CY+IYSV+  I      ++ AC+R+  +G+  + +EGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L +R V  DEL GLC VG  + S L  FV+IP   +L++G  F+L G VAL  +R+ +K  G  TEKLE LMV+IG+FS+L+ VP++ V+ C FYE  N ++W  ++  N                   P + V+MLKIFMS VVGITSGVWVWS KTL++WQ
Sbjct:   28 LEHGRPGKCEP--ITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVPPRSRQPTTVSGRISSISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRE--NGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWKFRALENKCVSFPGRRSDDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQ 531          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: FZD4 (frizzled class receptor 4 [Source:NCBI gene;Acc:100497693])

HSP 1 Score: 442.58 bits (1137), Expect = 1.448e-146
Identity = 229/468 (48.93%), Postives = 309/468 (66.03%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMK------NPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE +++ F   WP +LNCS+FP +N    MCMEGPG       +   +  G        N   + ++ R+  CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N + +  +  + N+ V ML IFMS +VGITSG+W+WS KTL +WQ
Sbjct:   27 EERRCDPIRISM--CQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEVPVHSKTPVLPGEDCNSFGPNSDQYTWVKRSMNCVLKCGYDSGLYSRLSKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEE-AAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWNVFRYTADDSNMAVEMLNIFMSLLVGITSGMWIWSAKTLHTWQ 491          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 390.963 bits (1003), Expect = 5.720e-126
Identity = 210/508 (41.34%), Postives = 293/508 (57.68%), Query Frame = 2
Query:  347 LEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGM---------------------KNPRLFIFINRTQKCVPKC--SANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN--------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            +E  +  KC P  I +P CQ + YN T MPN V  E+Q EA ++LQ F  L++Y C  +L FFLCS+Y PMC    +  I  C+P+CE  R  C  IM  F   WP +L+C R P +N   ++CME P     +  +  T   GM                      NP  F+++ R+  C P+C    ++ ++  DK  A +W+   + LCFIS+ FT+ TFL++  RF+YPE+P+IFL++CY++YS +  I  A    S AC+R+   G   L +EGL+++ C ++FL+ ++F  AS +WWV+LT+ W LAA  KW  EAI     YFHLAAW I ++ T+ +L +R V  DEL GLC VG  + S L  FV++P   +LV G  FLL G VAL  +RR +K  G  TEKLE LMV+IG+FS+L+ VP++ ++ C FYE  N  HW                          P++ V+MLKIFMS  VGITSGVWVWS KTL++WQ
Sbjct:   20 VERGREAKCEP--IQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQVSTSIPACKPMCEAARQKCAPIMESFQYVWPESLDCDRLPSKNDPHALCMEAP--ENATNGDPPTNGHGMLPVAPRPPRPSGSGIGISSRCANPDKFMYVERSGVCAPRCIPGVDVYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQRFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDRE--GGAPYLIREGLESSGCTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRRVMKTGGTNTEKLEKLMVKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAREESCRTVPGSARPDCNLPHSIPSVAVFMLKIFMSLAVGITSGVWVWSSKTLQAWQ 521          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 369.392 bits (947), Expect = 7.633e-118
Identity = 214/523 (40.92%), Postives = 293/523 (56.02%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCME---------GPGPSVKSTENFQTMCGGM---KNPRLFI------FINRTQKC-VPKCSANIL---FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGT----------NPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCR--KP-TRSMIEEKKNNFPKKIGYVAAT 1843
            ++I VP C+ + YN T MPN  N +TQ EA  ++  F  L+  +CS +L FFLCS+Y P+C P     + PC+ +CE  +  C  +MR +   WP  +NC R P      ++CM+          P       +   + C G+   + P L I        NR +   VP C+       FT D+K  A  W+ + + LCFIS+  T+ TFLI+ +RF+YPERP+IFL+ CY   S+ + + L    ++ ACN+D +        E     LC ++FLL +FF  AS IWWVILT  W LAAG KW  EAI   S YFH+AAWLI S+ ++AVL L SVD D + G+C VG QN+  L  FV+ P +++L  G  FLL G V+L R+R  +K  G KT+KLE LM+RIG+FSVL+ VP++ V+ C  YE   R+HW K+             P+  V+MLK FM  VVGITSGVW+WS KTLESW+ F     CCR  KP   S   E       + G  ++T
Sbjct:   34 QEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDTLCMDYNWTETTTTPPPTHPPKVKTPSSDCDGVCKCREPFLSITRESHPLYNRIKTGQVPNCAMPCFQPYFTQDEKTFATFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVACNKDHIH------YETTGPALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKAHNCSCPGDKKRYRPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWKRF--TGRCCRNSKPINASAYSEASRALTARTGLSSST 548          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:NCBI gene;Acc:100038274])

HSP 1 Score: 355.91 bits (912), Expect = 2.685e-112
Identity = 200/516 (38.76%), Postives = 283/516 (54.84%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQT----------------------------------MCGG----MKNPRLFIFINRTQKCVPKCS---ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCC 1768
            ++I VP C+++ YN+T MPN  N +TQ EA  ++  F  L+   CS +L FFLCS+Y P+C       + PC+ +CE  R  C  +MR +   WP  + C R P +    ++CM+    + ++T                                        C      + N R  ++       +P C+    N  F+ +++   + W+ + + LCF S+  T+ TFLI+ +RFKYPERP+IFL+ CY + S  + + L    +  AC+R  +  + I+  E     LC ++FLL +FF  AS IWWVIL++ W LAAG KW  EAI   S YFHLAAWL+ S+ ++AVL L SVD D + G+C VG QN+  L  FV+ P +I+L IG  FLL G V+L R+R  +K  G KT+KLE LM+RIG+FSVL+ VP++ V+ C FYE  NR  W            +     P+  V+MLK FM  VVGITSGVW+WS KTLESW+ FC    CC
Sbjct:   28 QEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRTEQTTAAPSHPEPPKPPARSAPKGRTRVEPPRPRPRAPGCEPGCQCRAPMVPVTNERHPLYNRVRTGQIPNCAMPCHNPYFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSAGYLVRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEVAQPRRPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRAFC--TRCC 541          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 340.502 bits (872), Expect = 8.130e-107
Identity = 192/501 (38.32%), Postives = 275/501 (54.89%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAE----GSMCMEGPGPSVKSTEN----------FQTMCGGMKNPRL--------FIFINRTQKCVP----KCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN-------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            + I +P C ++ YN T MPNL+    Q +A  ++  F  L+K +CS  L FFLCS+Y P+C  +    I PC+ +CE  R  CE +M  F   WP  L C  FP   AE    G    E  GP++ +T            + T+      PR+        + F+       P    K    + F+ D+   A++W+ + + LC  S+ FT+ T+L++  RF+YPERP+IFL+ CY++ SV++            CN +     +    +G     C I+F++ +FFS AS IWWVIL++ W LAAG KW  EAI   S YFHLAAW + ++ T+ +L +  +D D L G+C VG  N+  L  FV+ P  ++L IG  FLL G V+L R+R  +K+DG KTEKLE LMVRIG+FSVL+ VP++ V+ C FYE A R+HW +S  +                   P+  VYM+K  M+ +VGITSG W+WS KTL SW+ F
Sbjct:   41 QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVCTVLEQ-AIPPCRSICERARHGCEALMNKFGFQWPERLRCENFPRHGAEQICVGQNHSEDGGPTLLTTSPPHHGTPGPPIYATLDHPFHCPRVLKVPSYLNYRFLGEKDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFV-LGDKVVCNENFSEDGYKTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQNCKSLAIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKF 539          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd4 (frizzled class receptor 4 [Source:MGI Symbol;Acc:MGI:108520])

HSP 1 Score: 451.44 bits (1160), Expect = 7.367e-150
Identity = 234/468 (50.00%), Postives = 310/468 (66.24%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE ++R F   WP TLNCS+FP +N    MCMEGPG      P     +  +       N   +I++ R+  CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   +  S  + N+ V MLKIFMS +VGITSG+W+WS KTL +WQ
Sbjct:   41 EERRCDPIRIAM--CQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQ 505          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd9 (frizzled class receptor 9 [Source:MGI Symbol;Acc:MGI:1313278])

HSP 1 Score: 410.609 bits (1054), Expect = 2.644e-133
Identity = 226/570 (39.65%), Postives = 318/570 (55.79%), Query Frame = 2
Query:  236 MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLP-KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP-GPSVKSTENFQTMC----------------------GGMKNPRLFIFINRTQKCVPKCSANI--LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW----------------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKM--------CCRKP 1777
            MA+  LL     L  + +  G  L+  RF         +P + R   P + + +P C+ + YN T MPNL+   +Q EA +QL  F  L++Y C  +L FFLCS+Y PMC    +  I  C+P+CE+ R  C  IM  FN  WP +L+C+R P RN   ++CME P   +   TE  + +                       G   NP  F ++ +++ C P+C   +   ++  DK  A +W+ V ++LCF S+ FT+ TFL+   RF+YPERP+IFL++CY++YS++  I      QS AC+++  +G   + QEGL+NT C ++FLL ++F  AS +WWV+LT+ W LAAG KW  EAI     YFH+AAW + +L T+ VL LR V  DEL GLC V   + + L  FV++P   +LV+G  FLL G VAL  +R+ +K  G  TEKLE LMV+IG+FS+L+ VP++ V+ C  YE  N D W                      L  G+ P + V+MLKIFMS VVGITSGVWVWS KT ++WQ  C  KM         CR P
Sbjct:    1 MAVPPLLRGALLLWQLLATGGAALEIGRF---------DPERGRGPAPCQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQE--AGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKMAAGRARAKACRTP 559          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd10 (frizzled class receptor 10 [Source:MGI Symbol;Acc:MGI:2136761])

HSP 1 Score: 408.683 bits (1049), Expect = 1.100e-132
Identity = 229/547 (41.86%), Postives = 314/547 (57.40%), Query Frame = 2
Query:  338 SIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMC------------------------GGMKNPRLFIFINRTQKCVPKCS--ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW--------------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFC---LVKMCCRKPTRSMIEE---KKNNFPKK 1822
            S+ LE     KC P +I  P C+++ YN T MPNL+  E Q EA  QL  F  L++Y C  +L FFLCS+Y PMC    +  I  C+ +CE+ R  C  IM  F   WP +L+CS+ P +N    +CME P            M                          G  NP  F  + +++ C P C+   ++ ++ DDK  A +WL + + LCF SS FT+LTFLI+  RF+YPERP+IFL++CY +YSV + I L    +S AC+RD  SGQ  + QEGL++T C ++FL+ ++F  AS +WWV+LT+ W LAAG KW  EAI   S YFHLAAW I ++ T+ +LV+R V  DEL G+C VG  +V+ L  FV++P   +LVIG  F+L G VAL  +RR +K  G  T+KLE LMVRIG+FS+L+ VP++ V+ C FYE  N D+W                    L + + P +EV+M+K+ M  VVGITSGVWVW+ KTL+SWQ  C   L +   RKP   +      KK   P+K
Sbjct:   24 SMDLERPGDGKCQPVEI--PMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRD--SGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQK 566          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 350.517 bits (898), Expect = 2.082e-110
Identity = 200/512 (39.06%), Postives = 283/512 (55.27%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGS-MCMEG-------------------PGPSVKSTENFQTMCGG-------------MKNPRLFIFINRTQKCVPKCSANIL---FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGT-------------NPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCC 1768
            ++I VP C+ + YN T MPN  N +TQ EA  ++  F  L++  CS +L FFLCS+Y P+C P  +  + PC+ +CE  +  C  +MR +   WP  ++C R PV   +   +CM+                    PGP    +   +   GG             +K         RT + VP C+       F+ D++  A  W+ + + LCFIS+  T+ TFLI+ +RF+YPERP+IFL+ CY   S+   + L     S AC+R+       +  E     LC ++FLL +FF  AS IWWVIL++ W LAAG KW  EAI   + YFHLAAWLI S+ ++  L L SVD D + G+C VG QN+++L  FV+ P +++L++G  FLL G V+L R+R  +K  G KT+KLE LM+RIG+F++L+ VP+S V+ C  YE   R+ W  + T              P   V MLK FM  VVGITSGVW+WS KTLESW+ F   + CC
Sbjct:   34 QEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQ-VPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE----HSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRF-TSRCCC 539          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 350.517 bits (898), Expect = 2.082e-110
Identity = 200/512 (39.06%), Postives = 283/512 (55.27%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGS-MCMEG-------------------PGPSVKSTENFQTMCGG-------------MKNPRLFIFINRTQKCVPKCSANIL---FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGT-------------NPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCC 1768
            ++I VP C+ + YN T MPN  N +TQ EA  ++  F  L++  CS +L FFLCS+Y P+C P  +  + PC+ +CE  +  C  +MR +   WP  ++C R PV   +   +CM+                    PGP    +   +   GG             +K         RT + VP C+       F+ D++  A  W+ + + LCFIS+  T+ TFLI+ +RF+YPERP+IFL+ CY   S+   + L     S AC+R+       +  E     LC ++FLL +FF  AS IWWVIL++ W LAAG KW  EAI   + YFHLAAWLI S+ ++  L L SVD D + G+C VG QN+++L  FV+ P +++L++G  FLL G V+L R+R  +K  G KT+KLE LM+RIG+F++L+ VP+S V+ C  YE   R+ W  + T              P   V MLK FM  VVGITSGVW+WS KTLESW+ F   + CC
Sbjct:   34 QEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQ-VPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE----HSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRF-TSRCCC 539          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q61088|FZD4_MOUSE (Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 5.153e-149
Identity = 234/468 (50.00%), Postives = 310/468 (66.24%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE ++R F   WP TLNCS+FP +N    MCMEGPG      P     +  +       N   +I++ R+  CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   +  S  + N+ V MLKIFMS +VGITSG+W+WS KTL +WQ
Sbjct:   41 EERRCDPIRIAM--CQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQ 505          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9IA05|FZD4_CHICK (Frizzled-4 OS=Gallus gallus OX=9031 GN=FZD4 PE=1 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.414e-148
Identity = 234/468 (50.00%), Postives = 310/468 (66.24%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPS---VKSTENFQ--TMCGGM-KNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C    I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE +++ F   WP +LNCS+FP +N    MCMEGPG     + S  + Q    C  M  N   +I++ R   CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   +  S  + N+ V MLKIFMS +VGITSG+W+WS KTL +WQ
Sbjct:   29 EERRC--DAIRIAMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLHSKTSLQPGEECHSMGSNSDQYIWVKRNLDCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWAVFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQ 493          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9ULV1|FZD4_HUMAN (Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV=2)

HSP 1 Score: 447.973 bits (1151), Expect = 1.035e-147
Identity = 232/468 (49.57%), Postives = 310/468 (66.24%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE +++ F   WP +LNCS+FP +N    MCMEGPG      P     +  +       N   +I++ R+  CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   +  S  + N+ V MLKIFMS +VGITSG+W+WS KTL +WQ
Sbjct:   41 EERRCDPIRISM--CQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQ 505          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9QZH0|FZD4_RAT (Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 3.376e-147
Identity = 231/468 (49.36%), Postives = 310/468 (66.24%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R+C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE +++ F   WP +LNCS+FP +N    MCMEGPG      P     +  +       N   +I++ R+  CV KC  +  L++   K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG Q++  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N   +  S  + N+ V MLKIFMS +VGITSG+W+WS KTL +WQ
Sbjct:   42 EERRCDPIRIAM--CQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQSLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQ 506          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9PT62|FZD4_XENLA (Frizzled-4 OS=Xenopus laevis OX=8355 GN=fzd4 PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.094e-145
Identity = 229/468 (48.93%), Postives = 307/468 (65.60%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMK------NPRLFIFINRTQKCVPKCSANI-LFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + R C P +I +  CQNL YN T MPNLV  E Q +A+ QL TF  LI+Y CS  L FFLCSVY+PMC    N  IGPC  +C  V+  CE +++ F   WP +LNCS+FP +N    MCMEGPG       +   +  G        N   + ++ R+  CV KC  +  L+    K    IW+ V ASLCFIS+ FT+LTFLI++ RF YPERP+IFL++CY+IYS+++ + L   R+  +C+ +  + + +L QEGL NT CAIIFLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDADEL GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FYE +N + +  +  + N+ V ML IFMS +VGITSG+W+WS KTL +WQ
Sbjct:   27 EERSCDPIRITM--CQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEVPAHSKTPVLPGEDCNSFGPNSDQYTWVKRSMNCVLKCGYDSGLYNRLSKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEE-AAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEVSNWNVFRYTADDSNMAVEMLNIFMSLLVGITSGMWIWSAKTLHTWQ 491          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1D110 (Fzd-4-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1167.91 bits (3020), Expect = 0.000e+0
Identity = 586/586 (100.00%), Postives = 586/586 (100.00%), Query Frame = 2
Query:  236 MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI 1993
            MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHVKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI
Sbjct:    1 MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHVKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI 586          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1E1E8 (Fzd-4-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 440/586 (75.09%), Postives = 505/586 (86.18%), Query Frame = 2
Query:  236 MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI 1993
            M    ++     + + + I  +  D+ R+PR+    V +P+QT+KC PK+I+V ECQ+LFYNFT MPNL+N ETQIEAQ+QL TFQSLIKYKCS  LLFFLC+VYIPMCDP S+YLIGPC+PLCEEVRDSCE+IM+PF+L WPV LNCSRFP  N EGSMCM GPGPS K  E  +  C  MKNP  F++INRTQKCVPKC ANILF  DDKYIAKIWL VL+SLCFISS+FTILTFLINTDRFKYPERPVIFLAVCYS+YSVSHFI L + R+ ++CNRDPV+GQ+ILTQEGL+NT+CAIIFLLN+FF+ ASQIWWVILT+ WLLAAGFKWSEEAIYQRSGYFHL AWLISSLLTV+VLVLRSVDADELLGLCSVGQQ  S+LLIFVIIPNIIFLVIGC FLL GL+ALVRVRRHVKNDGIKT+KLEILMVRIGLFSVLFL+PSSTVL CN YEY N+D WL SGT PNIE++MLKIFM+SVVGITSGVWVWSIKTL+SW+WF +VK+C R+P+RS+IE KKNNF K IGY+ ATSRENI+++    RNCWS N QKIPLQ+FSSSGYT+PQ SSNG+YKT+IN+
Sbjct:    1 MKSEKMILFYSIIFFSQLIFSLKSDNARYPRN----VWDPIQTKKCQPKRIIVQECQHLFYNFTAMPNLINHETQIEAQTQLLTFQSLIKYKCSAKLLFFLCAVYIPMCDPNSHYLIGPCRPLCEEVRDSCEKIMKPFSLSWPVNLNCSRFPKSNTEGSMCMVGPGPSEK-VEEVKVNCEKMKNPSSFVYINRTQKCVPKCMANILFNSDDKYIAKIWLAVLSSLCFISSMFTILTFLINTDRFKYPERPVIFLAVCYSLYSVSHFIRLLHNRKGSSCNRDPVTGQYILTQEGLENTMCAIIFLLNYFFAIASQIWWVILTLTWLLAAGFKWSEEAIYQRSGYFHLFAWLISSLLTVSVLVLRSVDADELLGLCSVGQQTASSLLIFVIIPNIIFLVIGCMFLLSGLIALVRVRRHVKNDGIKTDKLEILMVRIGLFSVLFLIPSSTVLACNIYEYVNKDFWLTSGTTPNIEIFMLKIFMASVVGITSGVWVWSIKTLDSWKWFFVVKLCRRQPSRSVIENKKNNFNKTIGYMPATSRENIALEANNNRNCWSGNMQKIPLQEFSSSGYTHPQTSSNGEYKTEINM 581          
BLAST of Frizzled-4 vs. TrEMBL
Match: A0A210QQD6 (Frizzled-4 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07476 PE=3 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 1.399e-168
Identity = 252/497 (50.70%), Postives = 341/497 (68.61%), Query Frame = 2
Query:  365 RKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG-----PSVKSTENF---------QTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN--PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKN 1807
            R+C P  I +  C+ L YN TGMPN V  E Q++AQ QLQTF  LI+Y CS  L FFLCSVY+PMC       IGPC+PLCE V++ C+ ++  F  PWPV LNCS+FP +N +  MCM+GPG     P++K   +          +  C   +N   +IFINRT++C  KC  N  FT +DK    IW+++   LCFIS++FT+LTFLI++ RF+YPERP+IFL++C++IYS+++ + L   R+S AC+ D  S   IL QEGL+NT CAI+FLL ++F +AS +WWVILT+ W LAAG KW  EAI   S YFHL AW + ++ T+ +LV+R VDADEL+ +C VG QN  TLL+F I+P +++LVIG  FL+ G V+L R+R  +K+DG+KT+KLE+LMVRIG+FSVL+ VP++ V+GC FYEY  RD W +  +   P IE++MLKIFMS VVGITSG+W+WS KT+ SW  F   +  C K  R   + +KN
Sbjct:   32 RQCDP--IQIEMCKGLGYNVTGMPNFVGHEIQLDAQLQLQTFTPLIQYGCSSRLKFFLCSVYVPMCTEKVRVPIGPCRPLCENVKERCQPVLIEFGYPWPVALNCSKFPPKNDQNHMCMDGPGEETEEPTLKPPPSIPHRVIPRPEKKKCNEYRNSNKYIFINRTERCAMKCGTNDAFTAEDKKFTDIWMSIWTGLCFISTLFTVLTFLIDSQRFRYPERPIIFLSMCFNIYSIAYVVRLIAGRESIACDTDGQSNIRILIQEGLENTDCAIVFLLLYYFGSASALWWVILTLTWFLAAGLKWGHEAIQLHSSYFHLVAWAVPAVKTIVILVMRDVDADELVEICYVGNQNTKTLLVFAIVPLLVYLVIGVSFLVAGFVSLYRIREQIKSDGVKTDKLEVLMVRIGIFSVLYTVPATCVVGCLFYEYVYRDTWYRKDSTSLPKIEIFMLKIFMSLVVGITSGMWIWSTKTVNSWSNF--ARKLCFKCFRKQRDRQKN 524          
BLAST of Frizzled-4 vs. TrEMBL
Match: V4AZI8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_201339 PE=3 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 5.805e-168
Identity = 254/484 (52.48%), Postives = 332/484 (68.60%), Query Frame = 2
Query:  365 RKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTM-----CGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW--LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIE 1795
            R C P  I    C+ L YN TGMPNLV    Q +A  QLQTF  LI+Y CS+ L FFLCSVY+PMC       IGPC+P+CE VR  C+ ++  F  PWP  LNCS+FP RN +  MCM+GPG  ++    +        C   +NP  +IFINRT++C   CS N  FT  DK  A +W+ + A LCF+S+ FT+LTFLI++ RFKYPERP+IFL++CY+IYS+++ + L   RQS AC+ D  SG+ IL QEGL+NT CAI+FLL +FF TAS +WWV+LT  W L+AG KW  EAI   S YFHL AW + ++ T+ +LV+R VDADEL G+C VG Q+   LL F + P I++L++G  FL+ G VAL R+R+ V+ DG+KT+KLE+LMVRIG+FSVL+ VP++ V+GC  YEY NR  W      T+PNIE++MLK+FMS VVGITSG+W+WS KT+ SW+ F   K+C RK  R  IE
Sbjct:   35 RTCEP--IRFEMCKGLGYNVTGMPNLVAHTDQQDAGLQLQTFTPLIQYGCSKQLKFFLCSVYVPMCTEKVMDPIGPCRPMCESVRSRCQPVLNEFGYPWPAALNCSKFPARNDQTHMCMDGPGDEIEDDLPYPRKPNVPNCEKFRNPSKYIFINRTERCALLCSENDAFTSKDKLFADVWMAIWAGLCFVSTFFTVLTFLIDSQRFKYPERPIIFLSMCYNIYSIAYIVRLLAGRQSIACDTDSQSGKSILIQEGLENTDCAIVFLLLYFFGTASSLWWVVLTFTWFLSAGLKWGHEAIQLHSSYFHLFAWALPAIKTIVILVMRDVDADELTGICYVGNQSTQMLLGFGVAPLIVYLILGTAFLIAGFVALFRIRKQVRCDGVKTDKLEVLMVRIGIFSVLYTVPATCVIGCLLYEYLNRSSWYLYSPQTSPNIEIFMLKLFMSLVVGITSGMWIWSAKTVSSWKNF-FKKICVRKRDRKNIE 515          
BLAST of Frizzled-4 vs. TrEMBL
Match: A0A1S3KAW5 (frizzled-4-like OS=Lingula unguis OX=7574 GN=LOC106180365 PE=3 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 6.085e-164
Identity = 271/547 (49.54%), Postives = 354/547 (64.72%), Query Frame = 2
Query:  299 ITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG---------------------PSVKS--------------TENFQTMCGGM-------------KNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGT--NPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSM 1789
            +TL    F RD   +  + V  R C P KI +  C+ L YN TGMPNLV    Q +A+ QLQTF  LI+Y CS  L FFLCSVY+PMC       IGPC+ LCE VR  C+ ++  F   WP  LNCS+FP +N +  MCM+GPG                     P V+S              T   Q   GG+             ++P  +++INRT KC   C+A+ LF+ DDKY A IW++V A LCF+S++FT+LTFLI++ RF+YPERP+IFL++CY+IYS++  + L   RQ+ AC+ +PV+ Q I+ QEGL NT CAI+FLL +FF TASQIWW+IL++ W LAAG KWS EAI   + YFHLAAW I ++ T+ +LV+R+VD+DEL GLC VG QN+ +LL FVI PN  +LVIG  FLL G VAL R+R+HVKNDG+KT+KLE+LMVRIG+FSVL+ VP++ V+    YEY NR+ W       +PNIE++MLKIFMS VVGITSG+W+WS KTL SW+ F       R P +S+
Sbjct:   12 VTLQVVIFYRDQSVLATDIV--RSCDPIKIKM--CKGLGYNVTGMPNLVGHNLQGDAELQLQTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVIQPIGPCRTLCESVRSRCKPVLEEFGFLWPAALNCSQFPPKNNQDHMCMDGPGEQSSTEPRKPDQTQSDPNYNVPQVESGAPSGQWPPPIPQPTSGRQNPVGGLPSPPQVLENCYHVRHPDKYVYINRTNKCALLCNADHLFSKDDKYFADIWMSVWAGLCFVSTLFTVLTFLIDSQRFRYPERPIIFLSMCYNIYSIAFIVRLIAGRQAVACDTEPVTHQSIIIQEGLQNTDCAIVFLLLYFFGTASQIWWIILSLTWFLAAGLKWSHEAIELHTSYFHLAAWSIPAVKTIVILVMRNVDSDELTGLCYVGNQNLESLLGFVIGPNCAYLVIGTSFLLAGFVALFRIRKHVKNDGVKTDKLEVLMVRIGIFSVLYTVPATCVIASYVYEYTNRNLWYLPNLTYSPNIEIFMLKIFMSLVVGITSGMWIWSSKTLTSWRKFISRLTGRRSPRKSL 554          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 421.779 bits (1083), Expect = 7.206e-138
Identity = 222/521 (42.61%), Postives = 315/521 (60.46%), Query Frame = 2
Query:  338 SIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP----GPSVKSTENF-----------------QTMCGGMKNPRLFIFINRTQKCVPKCSA--NILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSG--------------------TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCR 1771
            S   E  +  KC P  I++P CQ + YN T MPN ++ ++Q EA  +L  F  L++Y C  +L FFLCS+Y PMC    +  I  C+P+CE+ R  C  IM  FN  WP +L+CS+ P RN   ++CME P     P  K  E                       G  +NP  F ++ +++ C P+CS+  ++ ++  DK  A IW+ V ++LCF+S+ FT+LTFL++  RF+YPERP+IFL++CY++YSV+  I      ++ AC+R+  +G+  + QEGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I +L T+ +L +R V  DEL GLC VG  +V  L  FV++P   +LV+G  F+L G VAL  +R+ +K +G  TEKLE LMV+IG++S+L+ VP++ V+ C FYE  N D+W   G                    + P + V+MLKIFMS VVGITSGVWVWS KTL++WQ  C  K+  R
Sbjct:   31 SYDFERGRPAKCEP--IVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQRCSPIMEKFNYAWPESLDCSKLPTRNDPNALCMEAPENDTKPEPKKGEGMLPVPPRPRQPGSGGGRPGGSVGACENPEKFQYVEKSESCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVALFHIRKVMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKFRGLESKCVTFPGRRNEDCSLDASMPAVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLADR 547          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:103039803])

HSP 1 Score: 416.772 bits (1070), Expect = 9.736e-137
Identity = 221/498 (44.38%), Postives = 307/498 (61.65%), Query Frame = 2
Query:  359 QTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG---------PSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCS-ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKK 1822
            +  +C P ++ +  C +L YN T MPNLV    Q +A+ QLQTF  LI+Y CS  L FFLC+VY PMC       IGPC  +C  V+  C  +++ F   WP  LNCS FP  N +  MCMEGP          P     E   TM GG   P  + +  R+  CV +C   + L+    K    +W+ V A LCFIS+ FT+LTFL+++ RF YPERP++FL++CY++YSV+  + L   R+  +C+ D  +   +L QEGL NT CA++FLL +FF  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I ++ T+ +L++R VDAD+L GLC VG QN+  L  FV+ P   +LVIG  F+  GLVAL ++R +++ DG KT+KLE LMV+IG+FSVL+ VP++ V+ C FY+ +N   + ++  +  +   ML+IFMS +VGIT G+WVWS KTL +WQ   L  +  R+ +R+    +    P K
Sbjct:   28 EDARCEPIRMAM--CLDLGYNQTRMPNLVGNVLQADAELQLQTFTPLIQYGCSSQLKFFLCAVYAPMCTEKVPVTIGPCGSMCLAVKRKCLPVLQEFGFVWPELLNCSLFPPTNDQNHMCMEGPAEDDLFHPNKPVAPHEEECVTMGGG--GPEQYAWAKRSGSCVLQCGYESGLYRRQAKMFTDVWMAVWAVLCFISTSFTVLTFLLDSARFSYPERPIMFLSMCYNVYSVAFLVRLTAGRERISCDLDEAAVP-VLAQEGLKNTGCAVVFLLAYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADDLTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYQISNWADFHQTARDSYMAAEMLRIFMSLLVGITCGMWVWSAKTLHTWQRCSLRLLHSRRSSRAHQSGEGWAKPGK 520          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 406.371 bits (1043), Expect = 1.084e-131
Identity = 219/536 (40.86%), Postives = 314/536 (58.58%), Query Frame = 2
Query:  293 DGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGP-GPSVKSTENFQTM--------------------CGGMKNPRLFIFINRTQKCVPKCS--ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN--------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCR 1771
            DG +LD   +         E  +  KC P  I +P CQ + YN T MPN +  E+Q EA  +L  F  L++Y C  +L FFLCS+Y+PMC    +  I  C+ +C + R  C  IM  F+  WP +L+CS+ P  N   ++C+E P   +V  T+  + M                     G  +N   F ++ +++ C P+CS   ++ ++  DK  A IW+ V ++LCF+S+ FT+LTFL++  RF+YPERP+IFL++CY++YSV+  I      ++ AC+R+  +GQ  + QEGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+ AW I ++ T+ +L +R V  DEL GLC VG  + + L  F+IIP   +L+IG  F+L G VAL  +R+ +K  G  TEKLE LMV+IG+FS+L+ VP++ V+ C FYE  N D+W    +                     P + V+MLKIFMS VVGITSGVWVWS KTL++WQ  C  K+  R
Sbjct:   32 DGSSLDIGAYDG-------ERGRPAKCEP--ITIPMCQGIGYNMTRMPNFMKYESQEEASIKLNEFAPLVEYGCDVHLRFFLCSLYVPMCTDQVSTTIPACRAMCVQARQKCSPIMEQFSFGWPDSLDCSKLPTNNDPNALCIEAPENDTVPPTKKGEGMLPVPARPRPPGTGAGRPSGGSGSCENHEKFQYVEKSESCAPRCSPTVDVFWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGQLYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMVAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDTNALTGFIIIPLSCYLIIGTSFILTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIICYFYERLNMDYWKFRASESKCVSFPGRRTEDCTLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCARKLAMR 556          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd10 (frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GENE-990415-220])

HSP 1 Score: 388.267 bits (996), Expect = 9.385e-126
Identity = 213/483 (44.10%), Postives = 290/483 (60.04%), Query Frame = 2
Query:  431 MPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTE----------------NFQTM----------CGGMKNPRLFIFINRTQKCVPKC--SANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW---------LKSGTN---------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            MPNL+  E Q EA  +L  F  LI++ C  +L FFLCS+Y PMC    +  I  C+ +CE+ R  C  IM  FN  WP +L+CSR P +N    +CME P      T                 N Q +          CG   NP  F F+ +++ C PKC    ++ ++  DK  + +W+ + + LCFISS FT+LTFLI+  RFKYPERP+IFL++ Y +YSV + I L    ++ AC+RD  SG   + QEGL++T C I+FL+ ++F  AS +WWVILT+ W LAAG KW  EAI   S YFHLAAW I ++ T+ +LV+R V  DEL G+C VG  +V  L  FV+IP   +L+IG  FLL G VAL  +R+ +K +G  T+KLE LMVRIG+FSVL+ VP++ V+ C FYE  N D+W         L+ G           P +E++M+KIFM  VVGITSG+W+W+ KTL+SWQ
Sbjct:    1 MPNLMGHEDQGEAAIKLHEFAPLIEFGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARQKCSPIMEQFNFHWPDSLDCSRLPNKNDPNFLCMEAPNNGSDDTSKGSHTQPPDSRPPRSGNSQELPVKERMGKDTCG---NPGKFHFVQKSESCAPKCYSKVDVYWSHADKRFSLVWIAIWSILCFISSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGYLIRLFVGAENVACDRD--SGVQYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAIKTILILVMRRVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMKTEGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKVLAGEQRCLEGGGGEECMMKSSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQ 478          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: ENSAMXT00000026985.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:27065879:27070162:-1 gene:ENSAMXG00000026259.2 transcript:ENSAMXT00000026985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 347.436 bits (890), Expect = 2.304e-109
Identity = 200/533 (37.52%), Postives = 285/533 (53.47%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEG------------PGPSVKSTENFQTMCGGM-----------KNPRLFI------FINRTQ-KCVPKCS---ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCC--RKP---TRSMIEEKKNNFPKKIG 1828
            + I VP C+ + YN T MPN  N +TQ E   ++  F  L++ +CS +LLFFLCS+Y P+C P     + PC+ +CE  +  C  +M  +   WP  ++C + P+      +CM+             P P+ + +   +                 + P + I        NR Q   +P C+       F+ D++     W+ + + LCF+S++ T+ TFLI+ +RFKYPERP+IFLA CY   S+ + + L    +  AC         +    G    LC ++FLL +FF  AS IWWV+L+  W LAAG KW  EAI   S YFHLAAWL+ S+ ++AVL L SVD D + G+C VG Q++ +L  FV+ P +++L  G  FLL G V+L R+R  +K  G KT+KLE LM+RIGLF+VL+ VP++ V+ C  YE   R  W ++            G  P+  V+MLK FM  VVGITSGVW+WS KTLESW+ F      C  RKP     SM  E       + G
Sbjct:   38 EPITVPMCKGIGYNLTYMPNQFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDPDRLCMDQNSSETTTLSPSFPKPTPRGSSRHRATSKSAVPQKCDRECRCREPLVPIKKESHPLYNRVQTGSLPNCALPCHQPYFSQDERAFTTFWIGLWSVLCFVSTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHEKVACGGSGDQRHILYDTTG--PALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLESLRGFVLAPLVVYLFSGSLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPEWEQALGCSCASERQQQGLGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFVARCFPCRARKPPASASSMYSEASTALTARAG 568          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 349.362 bits (895), Expect = 1.527e-110
Identity = 203/537 (37.80%), Postives = 291/537 (54.19%), Query Frame = 2
Query:  356 VQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCME-------GPGPSVKST----------------------------ENFQTMCGGMKNPRLFIFINRTQ-----------KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKND-GIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS------------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCR 1771
            V  R+ L + I VP C+ + YN T MPN  N ++Q EA  ++  F  L++ KCS +L FFLCS+Y P+C       + PC+ +CE  R  C  +MR +   WP  + C R PV   +  +CM+          P VK T                            E  ++ C   + P + I  +R              C   C  +  FT D++  A  W+ + + LCF+S+  T++TFLI+ +RFKYPERP+IFL+ CY+  S+ + + L        CN++     +    E     LC ++FLL +FF  AS IWWVIL++ W +AAG KWS EAI   S Y+HLAAWL+ S+ +VAVL   SVDAD L G+CSVG Q++  L  FV++P  ++L +G  FLL G  +LVR+R  +K   G KT+KLE LMVRIG+FS+L+ VP+  V+ C FYE  +RD W ++                     P+  ++MLK FM  VVGITSGVW+WS KT+++W+     ++CCR
Sbjct:    2 VSCREMLCQNITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKQPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNRLCMDYNKSDTTPQPPEVKPTAPVRSFNPSKNRATTRVGGGGGGGGGSGEACESGCA-CRAPMVAIGSDRHPLYNRVRTGSVLNCAMPCH-DPYFTQDERTFASFWIGLWSILCFVSTFTTVVTFLIDMERFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICNQEHRHVHY----ETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQGGTKTDKLEKLMVRIGIFSMLYTVPAIAVVACYFYEERSRDGWARALICPSCQGDEEPGSQQQQQQRPDYGIFMLKYFMCLVVGITSGVWIWSGKTVDTWK-----RLCCR 527          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 320.087 bits (819), Expect = 4.676e-100
Identity = 190/516 (36.82%), Postives = 276/516 (53.49%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAE----GSMCMEGPGPSV-----------------KSTENFQT-------------MCGGMK------NPRLFIFINRTQKCVPKCSANIL-FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS-------------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            + I +P C ++ YN T MPNL+    Q +A  ++  F  L+K +CS +L FFLCS+Y P+C  +    I PC+ LC+  R  CE +M  F   WP  L C  FPV+ ++    G    +  GP+                      +F T             MC  +       N +LF   N    C PK    ++ F+ ++   +++W+ + + LC  S++FT+ T+L++  RF+YPERP+IFL+ CY + +V++            CN       +    +G     C I+F+L +FFS AS IWWV+L + W LAAG KW  EAI   S YFHLAAW I ++ T+ +L +  VD D L G+C VG  +V+ L  FV+ P  ++L +G  FLL G V+L R+R  +K+DG KTEKLE LMVRIG+FSVL+ VP++ V+ C FYE A R+ W K+                      P+  V+M+K  M+ +VGITSG W+WS KTL SW+ F
Sbjct:   14 QPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLEK-AIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDEICVGQNHTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTHPFMCPRVLKVPPYLNAQLFRERNCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQRFRYPERPIIFLSGCYFMVAVAYVAGFL-LDDKVVCNEQFSEDIYRTVTQGTKKEGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFREQWEKTWVSQSCKGFAIPCPLNHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLHSWRKF 527          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 259.61 bits (662), Expect = 6.626e-77
Identity = 141/328 (42.99%), Postives = 206/328 (62.80%), Query Frame = 2
Query:  824 CVPKCSANIL-FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS---------------GTNPNIE----VYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            C P  S  ++ F  D+ + A++W+ V + LC  S++FT+LT+L++ +RF+YPERP+IFL+ CY++ S+++ +      +   CN+      +    +G     C I+F++ +FFS AS IWWVIL++ W L+AG KW  EAI   S YFHLAAW + ++ T+ +L +  VD D L G+C VG  ++  L  FV+ P  ++L IG  FLL G V+L R+R  +K+DG KTEKLE LMVRIG+FSVL+ VP++ V+ C FYE A R  W KS               G  PN++    V+M+K  M+ +VGITSG W+WS KTL+SW+ F
Sbjct:  256 CEPSKSNGLMYFDADELWFARMWVGVWSILCCASTLFTVLTYLVDMERFRYPERPIIFLSGCYAVVSIAYIVGFF-FEEKIVCNKF-FEDSYSTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRAQWEKSWVAHTCKSFAVQCPQGHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLQSWRNF 581          

HSP 2 Score: 95.9005 bits (237), Expect = 1.035e-20
Identity = 45/109 (41.28%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAE 706
            + I +P C ++ YN T MPNL+    Q +A  ++  F  L+K +CS +L FFLCS+Y P+C  +    I PC+ LCE  R  CE +M  F   WP  L C  FPV+ +E
Sbjct:   58 QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLEE-AIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGSE 165          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 248.054 bits (632), Expect = 5.989e-75
Identity = 145/377 (38.46%), Postives = 217/377 (57.56%), Query Frame = 2
Query:  779 MKNPRLFIF----INRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKND--GIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS----------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMC----CRKPTRSMIEEKK--NNFPKKI 1825
            + NPR  ++      + + C   C +  L   + +  A  W+ + +SLCF ++  T+ TFLI+ +RFKYPERP+IFL++C  + S+ + + +    ++ AC+ D      +    G    LC  +FLL +FF  A  +WWVIL++ W +AAG KW  EAI   S Y+HLAAWL+ S+  +A L + +VD D + G+CSVG Q++  L  FV+ P + +L++G  FLL GLVAL R+R  +  +  G KTEKLE LMVRIG+F+VL+ VP++  + C+ YE  +RD W ++                G  P+  V+MLK F+  V GITSG W+WS KT  SW+ F   K C      K  RS I   +   ++PK++
Sbjct:   14 ISNPRHVLYDRVRTGQVRNCATPCHSPFL-GREQRTFASFWIGLWSSLCFAATFATVSTFLIDMERFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACSAD--WHHVLYASSG--PALCTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGGAKTEKLERLMVRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGARPDFAVFMLKYFVCLVGGITSGAWIWSGKTAGSWKRF--YKRCRAWRAGKRHRSPIGAGRGSGSYPKQL 383          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd3b (frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GENE-070122-1])

HSP 1 Score: 176.407 bits (446), Expect = 4.849e-48
Identity = 124/350 (35.43%), Postives = 187/350 (53.43%), Query Frame = 2
Query:  824 CVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVS--GQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS--------------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKN 1807
            C P C  N+ F+  +  + +  + V++ +C +++ FT LTFL++  RF+YPERP+IF A CY   S+S  +       +AACN   ++      +TQ   +N  C  +F+L +F + A  +WWV+LT+ W LAAG KW  EAI +R+  FH  AW   + LTVA+L L  V+ D L G+C  G  +V+TL  FV+ P       G   LL G+V+L RVR  +++DG    KL   MVRIG+FSVL+LVP   ++ C  YE A+R  W  +                       P + ++++K F + VVGI    WV S KT   W  F    +  R+  ++++ E + 
Sbjct:   30 CSPPCP-NMYFSSGELELTRYLVGVMSVVCLVATTFTFLTFLLDRKRFRYPERPIIFYATCYVAVSLSFLVGFLLDDSAAACNAPGLAPGAAGTVTQGSRNNKACTAVFMLLYFSAMAGALWWVVLTITWFLAAGLKWGREAIEKRAAAFHALAWGPPAALTVALLALNKVEGDNLSGVCYAGLYDVTTLRYFVLAPLGACAAAGLSLLLAGIVSLNRVRLEMRHDGRNQTKLVKFMVRIGVFSVLYLVPQLALVACLVYEQASRAAWEATWLRDRCTEYRIPCPYQANQPKQRPALVLFLVKYFTTLVVGIPPAFWVGSRKTCLGWAAF----LSGRRHKQAVVNESRR 374          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 394.815 bits (1013), Expect = 6.707e-129
Identity = 218/501 (43.51%), Postives = 310/501 (61.88%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCS-QNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG-------------PSVKSTEN----FQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDG-IKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWL---KSG--TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNN 1810
            +KI +  C+++ YN T MPNL+  ETQ EA+SQL+ F  LI+Y C+ + L+FFLCS Y PMC    + +I  C+PLCE VR SC  ++  F +PWP  LNC+RF VRN E +MCM GP              P   +TE         C   KN + + ++  T+ C  +C+ + +F   DK    IW+T+ +  CFIS+  T+ TFLI T RFKYPER +I+LA+CY+ YS+S+ I L   RQ+ +C+ DP +      Q+GL NT CAI+FL+ +FF  A+ IWWV+L + W LAAG KW  EAI   +  FH+ AW++  + T+ +L+ R VD DEL GLC VG Q++  L  FV+ P   +L+IG  FL+ G VAL R+R  V+  G  KT+KLE L+VRIG+FSVL  VP++ V+ C FYEYAN+++W    + G    PN  ++MLK+FMS   G+ +G+W+WS KT+ +W+ F   K+  ++P R +      N
Sbjct:    5 EKISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMCTDKVDVVITSCRPLCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNNERNMCMPGPNFTESPEKPRPDFKPINDTTEKPPSTGSEQCRRFKNSKNYFYVQSTESCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETGRFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCDTDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVALFRIRTTVQRGGQAKTDKLERLIVRIGIFSVLSTVPATAVIACYFYEYANKEYWYYGQRDGAVAEPNFSIFMLKVFMSLFTGVITGMWIWSHKTMNTWRAF-YYKVSGKRPPRKLERNGNGN 504          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 374.785 bits (961), Expect = 6.348e-120
Identity = 207/582 (35.57%), Postives = 329/582 (56.53%), Query Frame = 2
Query:  356 VQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFP------VRNAEGSMCMEGPGPSVKST---------ENFQTMCGGMKN-------PRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGL---DNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW-LKSGTN---------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSREN----ISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSN 1966
            V   KC P  I +P C  + YN T  PN +  E+Q EA  ++  F+ LI   C+  L FFLCSV++PMC    N  I  C+ +CE  RD C  +M+ F   WP TL+C R P       ++    +CM  P  ++K T          NF+++    K           + ++ +  +CVP+C ++++F+ ++K  A +W++V + LCFIS+  T+LTF+I+T RFKYPERP+IFL++CY++YS+ + + +   R    C+    +  F++ + G+   D+  C+++FLL ++F  AS +WWV+LT AW LAAG KW +EAI +++ YFH  AW + ++ T+  L++R VDADEL GLC VG  +   L  +V+ P  ++L++G FFLL G V+L R+R  +KN    T+KLE L+VRIG+FSVL+ +P S V+ C+FYEY N D W +++  N               P+IEV+++K FM  ++GITS +W+WS KT +SW+ F               + K     KK+ Y A ++       + + P +V+  + + +   P+    ++      P+ N
Sbjct:   27 VPNSKCTP--ITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVPIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLPKKGDPQAKSDPTKLCMAAP--NIKQTAPLNESDIWSNFESLGPEFKKINNTGPLRYKYTYVEKYDQCVPQCKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTSRFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVICDE---TESFVI-RAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSLFRIRTVLKNKETNTDKLEKLIVRIGVFSVLYTIPVSAVIACSFYEYNNMDVWKVRAPFNTYICRGDQACLENYGPSIEVFIVKYFMLLIIGITSNMWIWSTKTFKSWRKF-------------YSKRKGGEAKKKVDYSAGSAPPKNSLQVHMPPPSVQPVYHHTSAFAPIAPSPATRSVGSSPAPN 587          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 347.051 bits (889), Expect = 4.024e-110
Identity = 200/523 (38.24%), Postives = 297/523 (56.79%), Query Frame = 2
Query:  347 LEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCM---------------EGPGPSVKSTE----------NFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDG-IKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLK----SG-----TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNN 1810
            L  V T++   ++I +P C+ + YN T MPN+ N +TQ EA  ++  F  L++ +CS +L FFLCS+Y P+C+   +  + PC+ +CE  R  C  +MR +   WP  + C  FP    E ++CM                 P PS  +             F ++ G    P   I +    +C   C+    FT D    A  W+ + A LCFIS++ T LTFL++  RFKYPERP+IFL+ CY + SV + I L    +  AC+ +      ++  +      C I+FLL +FF  AS +WWVIL   W L+AG KWS EAI   S YFH  AWL+ ++  +AVL + ++D D + G+C VG  N+ +L++FVI+P +++LV G  FL+ G  +LVR+R+ ++  G  KT+KLE LM+RIG+FSVL+ VP++ V+ C +YE  NR+ W +    SG       P+  V+++K FM+ VVGITSG W+WS KT+ESW+ FC  ++   + TR  I  KK N
Sbjct:   19 LNYVLTKEMKCEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGDENTLCMGRNSSGESTPKPSQSPQPAPSPDTAAISANCCSCRPPFVSIAGKNIKPTRAISVGGVPQCAMACN-RTYFTHDQDSFASFWIGLWAILCFISTLVTTLTFLVDMHRFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIACDSNG-----LMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQHGSTKTDKLEKLMIRIGVFSVLYTVPATIVVACYYYELVNRETWERTINCSGCGVTRVKPDHSVFIIKYFMALVVGITSGFWIWSGKTIESWRNFC-ARLSGTQNTRRAIPPKKAN 534          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 340.502 bits (872), Expect = 1.442e-107
Identity = 205/517 (39.65%), Postives = 288/517 (55.71%), Query Frame = 2
Query:  365 RKCLPKK----ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKN---------------------PRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQ-EGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSG------------------------------TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWF 1747
            R CLP K    + +P C  L YN T  PN +   TQ EA  ++  F  L+K  CS++L FFLCSVY P+C  +   L  PC+ LC  VR  CE +M+ F   WP +L+C RFP    E  +C+     +  S ++     GG+ N                     P      +  ++C   C  N+ FT  ++ IA++W  + A LC +S++FTILTFLI+  RF+YPERP+IFL+ CY + S++ FI         ACN +P+   F  T  +G  +  C +IF++ +FFS AS IWWVILTV W LAAG KW +EAI   S +FHLAAW I ++ T+A+L++  VD DEL G+C VG  +VS L  +V+ P  ++ +IG  FLL G ++L RVR  +K+D  K EK+E LM+RIG+FS+L+ VP+  V+GC +YE +NR+ W  S                                 P+  V+M+K  M  +VGITSG W+WS KTL SW+ F
Sbjct:   21 RPCLPLKRCEPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCTVLETPL-PPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDE--ICVGENTTTPTSDQD-----GGINNNTYPDVDMSTMRYRCPESQKIPNDQYTFHGEKRCAATCR-NVFFTKREREIARMWTGIWAILCAVSTLFTILTFLIDMRRFRYPERPIIFLSGCYFMVSIA-FITGYVAGDKIACN-EPIKKGFPKTLVQGTKHEGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISLFRVRSVLKDDYSKREKIEKLMIRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSKTLNSWRRF 526          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO40119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S829])

HSP 1 Score: 138.658 bits (348), Expect = 1.435e-34
Identity = 115/434 (26.50%), Postives = 209/434 (48.16%), Query Frame = 2
Query:  350 EPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKY--KCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLIN-TDRFKYPERPVIFLAVCYSIYSVSHFINLA-NTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLA-AGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKN--DGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS 1630
            EP++ + CL +K        L Y++T    + +  +Q + +  L+ ++ L K+  KC + L  FLC +Y P C   S  L  PC+  C   R  C  ++  +   WP  L C + P  N  G++       S       +T       P  +  I   + C  +C  N +F+ ++      ++    +L  + ++FT++TFL+    + +YP   + F+  C+ + SV   I  + + R+   C RD        T+   D+ LC + F+L ++FS A   W+V+L  +W +       + +    ++GYFH+ +W + ++LT  VL+++ VDA+ + G+C VG +N S    F++ P  + LVIG  FL  GL  L ++R+   N      + K++  ++R+G F+ +          C+ YEY N++ W +S
Sbjct:   27 EPLKEQTCLGEK--------LDYHYTTTELVTDSSSQDQVKKNLEKWEGL-KFLPKCWEVLQPFLCQIYKPKCKNGSVEL--PCREQCFATRKPCS-VVESYR-RWPEFLRCDKLPEGNCNGTLKKLHLNESACKAPLVETA----YKPSWYEGI---EGCGIQC-MNPIFSEEEHTRIHRFVAAFGTLTTVCTLFTVVTFLVGWKSQNRYPSVILFFMNACFCVASVGFLIQFSSDARRKVVCRRDDTMRLGEPTES--DSFLCVLTFVLVYYFSLAGMTWFVMLAYSWCICFKTLGSTRDNFAGKTGYFHIISWSLPAVLTGCVLLVKQVDANSISGICFVGYKNPSMRAGFLLAPLGLDLVIGGMFLAKGLFTLFKLRKSNPNFLSNRASIKIKETIMRVGFFAFVAFAFVFITFACHVYEYYNQERWERS 437          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 418.698 bits (1075), Expect = 1.458e-136
Identity = 223/525 (42.48%), Postives = 312/525 (59.43%), Query Frame = 2
Query:  347 LEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG---------------------PSVKSTENFQTMCGGM----KNPRLFIFINRTQKCVPKCS--ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN-------------------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTR 1783
            LE  +  KC P  I++P C  + YN T MPN ++ + Q EA  +LQ F  L+ Y C  +L FFLCS+Y PMC    +  I  C+P+CE+ RD C  IM+ F+  WP +L+CS+ P RN   ++CME P                      P  +  +   +   G     +NP  F F+ ++Q C P+CS   ++ ++  DK  A IW+TV + LCF+S+ FT+LTFL+   RF+YPERP+IFL++CY +YS++  I      ++ AC+R+   G+  + QEGL++T C I+FL+ ++F  AS IWWVILT+ W LAAG KW  EAI   S YFH+AAW I +L T+ +L +R V  DEL GLC VG  +   L  FV+IP   +L+IG  F+L G VAL  +R+ +K +G  TEKLE LMV+IG++S+L+ VP++ V+ C FYE  N D+W   G                     P + V+MLKIFMS VVGITSGVWVWS KTL++WQ  C  K+  R  +R
Sbjct:   33 LERDRPAKCEP--IVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMCTDKVSTSIPACRPMCEQARDKCAPIMKKFSYTWPDSLDCSKLPTRNDPNALCMEAPENETRTEGKKDKKKGEGMLPVPPRPRQPDTPSSRLPGSGNSCENPDKFQFVEKSQSCAPRCSPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPHRFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDRE--HGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVALFHIRKVMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKLRGLQEECDSFSSHNSKCSLETSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLSDRTSSR 553          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd10 (frizzled class receptor 10 [Source:NCBI gene;Acc:101161314])

HSP 1 Score: 404.06 bits (1037), Expect = 4.948e-131
Identity = 219/499 (43.89%), Postives = 307/499 (61.52%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG------PSVKSTE--NF---QTMCG--------GMK----NPRLFIFINRTQKCVPKC--SANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW--------------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + I +P C+++ YN T MPNL+  + Q+EA  +LQ F SLI+  C  +L FFLCS+Y PMC    +  I  C+ +CE+V+  C  I+  F  PWP +L+CSR P +N   ++CME P       P V  T+  +F   Q + G        G K    NP  F F+ +++ C PKC    ++ ++  DK  + +W+ + + LCF+SS FT+LTFLI+  RFKYPERP+IFL++ Y +YSV + I L       AC+RD  +G   + QEGL++T C I+FL+ ++F  AS +WWVILT+ W LAAG KW  EAI   S YFHLAAW I ++ T+ +LV+R V  DEL G+C VG  +V  L  FV+IP   +L+IG  FLL G VAL  +R+ +K +G  T+KLE LMVRIG+FSVL+ VP++ V+ C FYE  N D+W                    +   + P IE++M+KIFM  VVGITSG+W+W+ KTL+SWQ
Sbjct:   33 QHITIPLCKDIGYNMTRMPNLMGHDDQLEAAIKLQEFASLIQCGCHSHLKFFLCSLYAPMCTEQVSNPIPACRVMCEQVKVKCSPILEKFQFPWPDSLDCSRLPTKNDPNNLCMEAPNNSSDEPPKVPHTQPPDFRPQQPLSGQDLHPKDIGEKQTCSNPGKFHFVEKSESCAPKCYPKVDVFWSQGDKQFSLVWMAIWSILCFVSSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGYLIRLFVGADGIACDRD--NGVQYIIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRKVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMKTEGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWRILAWKQKCVDGSRPESDECVMKASIPAIEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQ 529          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:101169962])

HSP 1 Score: 385.956 bits (990), Expect = 8.750e-125
Identity = 213/470 (45.32%), Postives = 298/470 (63.40%), Query Frame = 2
Query:  350 EPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPG---PSVKSTENFQTM-CGGMKN-PRLFIFINRTQKCVPKCS-ANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            + ++   C P +I +  CQ L YN T MPNLV    Q +A+ QL TF  LI+  CS  L FFLCSVY+PMC       IGPC  +C  V+  C  ++  F   WP  LNCSRFP +N    MCMEGPG   P  +S  +     C  + + P  + ++ +T+ CV +C   N L+    K     W+ V A LCF+S+  T+LTFL+++ RF YPERP+IFL++C ++YSV++ + L   R+  +C+ D V G  +L QEGL +T CAI+FLL +FF  AS +WWVILT+ W LAAG KW  EAI   S YFH+AAW I +  T+ +L++R VDAD+L GLC VG Q    L  FV+ P   +L++G  F+  GL+AL ++R +++ DG KT+KLE LMV+IG+FS+L+ VP+STV+GC  Y+ ++   +  S  +  +   ML+IFMS +VGITSG+W+WS KTL +WQ
Sbjct:   28 DEMEEMTCDPIRISM--CQGLGYNVTKMPNLVGNMLQSDAELQLTTFTPLIQCGCSSQLKFFLCSVYVPMCTDKVPIPIGPCGSMCLSVKRKCLPVLLEFGYTWPEALNCSRFPPQNDHNHMCMEGPGDEDPPYQSVHHPSDQDCQALDSTPDQYTWLKQTESCVLQCGYDNGLYRRGAKVFTDAWMAVWAVLCFLSTTLTVLTFLLDSQRFSYPERPIIFLSMCCNLYSVAYLVRLTLGRERVSCDLDAV-GVPVLVQEGLKSTGCAIVFLLLYFFGMASSLWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAAKTIVILIMRLVDADDLTGLCYVGNQQQEALTGFVVAPLATYLLVGTLFICAGLMALFKIRSNLQKDGTKTDKLERLMVKIGVFSILYTVPASTVIGCYLYQLSHWGEFKTSTHDSYVTSEMLRIFMSLLVGITSGMWIWSAKTLHTWQ 494          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 365.925 bits (938), Expect = 1.516e-116
Identity = 211/547 (38.57%), Postives = 292/547 (53.38%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCME------------------GPGPSVKSTENFQTMCGGMKNP-------------------RLFIFINRTQ-----KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW-------------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCC---RKPTRSMIEEKKNNFPKKIGYVAATS 1846
            + I VP C+ + YN+T MPN  N +TQ EA  ++  F  L++ +CS +L FFLCS+Y P+C       + PC+ +CE  R  C  +MR +  PWP  + C   PV+    ++CM+                   PG S KS        G  K P                         NR +      C   C  N  FT D++     W+ + + LCF+S+  T+ TFLI+ +RFKYPERP+IFL+ CY   SV + + L    +  ACNRD       +  E     LC I+FLL +FF  AS IWWVIL++ W LAAG KW  EAI   + +FHLAAWLI S+ ++AVL L SVD D + G+C VG QN+  L  FV+ P +I+L IG  FLL G V+L R+R  +K  G KT+KLE LM+RIG+F+VL+ VP++ ++ C FYE  NR  W              ++ + P+  V+MLK FM  +VGITSGVW+WS KTL+SW+ FC    CC   +    SM  +       + G  ++ S
Sbjct:   22 QGIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDLLPVQGNPDTLCMDYNRNDSTTASPVLSKPTNHPGRSPKSKPGRAGAPGKYKPPAAPCEPGCRCLEPMVAVTTERHPLYNRVKTGQVTNCAMPCH-NPYFTHDERAFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLIAGHEKVACNRDFDVEH--IHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTVLYTVPATVIVACYFYEQHNRQDWEMTHNCSSCLMERERARSGPDYAVFMLKYFMCLLVGITSGVWIWSGKTLDSWRTFC--TRCCWGSKGTGGSMYSDASTGLTWRSGTASSVS 563          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: ENSORLT00000002667.2 (pep primary_assembly:ASM223467v1:17:316235:318512:1 gene:ENSORLG00000002147.2 transcript:ENSORLT00000002667.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.91 bits (912), Expect = 1.091e-112
Identity = 205/544 (37.68%), Postives = 289/544 (53.12%), Query Frame = 2
Query:  380 KKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPS-------VKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSA-----------------------------------NILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHW----------LKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCC---RKPTRSMIEEKKNNFPKKIGYVAATS 1846
            ++I VP C+ + YN+T MPN  + +TQ EA  ++  F  L++ KCS +L FFLCS+Y P+C       + PC+ +CE  +  C  +MR +  PWP  + C   P +    S+CM+    +        K T          K P    F  + +     C A                                   N  FT +++     W+ + + LCFIS+  T+ TFLI+ +RFKYPERP+IFL+ CY   SV + + L    +  ACN    +G   +  E     LC I+FLL +FF  AS IWWVIL++ W LAAG KW  EAI   S +FHLAAWLI S+ ++AVL L SVD D + G+C VG QN+ +L  FV+ P +I+LVIG  FLL G V+L R+R  +K  G KT+KLE L++RIG+F+VL+ VP++ ++ C FYE  NR  W            S   PN  V+MLK FM  +VGITSG W+WS KTL++W+ FC  + CC   +    SM  +       + G  ++ S
Sbjct:   25 QEISVPLCKGIGYNYTHMPNKFHHDTQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKKPLPPCRGVCERAKAGCAPLMRQYGFPWPDRMRCDLLPEQGNHDSLCMDYSSQTTTVSPALAKPTNRPLKPYNKRKGPYGRTFPGKHKPAGSPCEAACSCRAPMVPVSSEGHPLHNRVRTGQIVNCAVPCYNPYFTQEERTFTSFWIGLWSILCFISTFTTVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLVAGHEEVACNM--WNGAGYIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIGSYSQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGVCYVGNQNLDSLRGFVLAPLVIYLVIGTMFLLAGFVSLFRIRSVIKQGGTKTDKLERLIIRIGVFTVLYTVPATVIVACYFYEQHNRQAWEITHNCTCATEPSKQRPNYAVFMLKYFMCLLVGITSGAWIWSGKTLDTWRTFC--RRCCWGSKASASSMYSDVSTGLTWRSGTASSVS 564          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000014322.1 (SMESG000014322.1)

HSP 1 Score: 1166.76 bits (3017), Expect = 0.000e+0
Identity = 584/586 (99.66%), Postives = 586/586 (100.00%), Query Frame = 2
Query:  236 MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI 1993
            MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFP+RNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFL+IGCFFLLGGLVALVRVRRHVKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI
Sbjct:    1 MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPIRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLIIGCFFLLGGLVALVRVRRHVKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRNCWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI 586          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000037982.1 (SMESG000037982.1)

HSP 1 Score: 384.8 bits (987), Expect = 3.537e-124
Identity = 199/495 (40.20%), Postives = 302/495 (61.01%), Query Frame = 2
Query:  344 VLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGP-------------------SVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDGI-KTEKLEILM---VRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            +++ ++  KC PK I + +CQN FYNFT +      + + E Q  ++T++SL+   CS++L F LCSVY+P CD  +   + PC+ +CE+V+  CE I++  NL WP  LNCSRFP+ ++    CM                        ++   + ++  C  M+N   ++FINRT +C  KCS N  F+ + K IA+IW+ V+ SL F+S++FT +TF  N  R +YPE+P+IFL   Y+IYS+S  + L   R+  +C+ DPVSGQ IL QEGL+NT CAI FLLNFFFSTA+ +WW++L + W L      S  ++ + SG FHL  WL++S+LTV+VL+LRSVDADEL GLCSVG+Q    LL F IIP +I L+IG  FLL G        +   N  +   +K+  L+    R+GLFS+++++  +T++ C  Y+Y N  +W ++        +  + V++LK FM+ VVGI S +W+ S+ ++ +W+
Sbjct:   17 IVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQ----DQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHELKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSAMSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQLICLIIGFIFLLSGFFFFKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSIIYIIAIATMICCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 506          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000037981.1 (SMESG000037981.1)

HSP 1 Score: 350.903 bits (899), Expect = 2.609e-111
Identity = 200/518 (38.61%), Postives = 296/518 (57.14%), Query Frame = 2
Query:  365 RKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGP-------------------SVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKND-------GIKTEKLEIL---MVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGTN------PNIEVYMLKIFMSSVVGITSGVWVWSIKTLESW-QWFCLVKMCCRKPTRSMIEEKKNN 1810
            RKC  +      C+N F++ +    L+  +  ++ + Q++T++S   +KC + L+  LC +  P+CDPI+N  +GPC+  CE+V+  CE I++  NL WP  LNCSRFP++N+    CM                        ++   + ++  C  M+N   ++FINRT +C  KCS N  F+ + K IA+IW+ V+ SL F+S++FT +TF  N  R +YPE+P+IFL   Y+IYS+S  + L   R+  +C+ DPVSGQ IL QEGL+NT CAI FLLNFFFSTA+ +WW++L + W L      S  ++ + SG FHL  WL++S+LTV+VL+LRSVDADEL GLCSVG+Q    LL+F IIP I  LV+G  FL  GL         +            ++E+L  L    +RI  F  ++ V  S  + C+ Y++ N   WL +  N      P   VY+LK+F++ VVGI S +W  S+ +  +W + F       RK T+    EKK +
Sbjct:   23 RKCTKESKKHFYCRNDFFDLSSSKELIAEDYLLKFKIQIKTYKSFQNHKCIKTLITLLCLIQDPLCDPITNIRLGPCRKACEKVQFDCEPILKLVNLSWPEKLNCSRFPLKNSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHELKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLLFSIIPKISCLVLGLTFLTIGLAIHAGRSDKLSGKVQILTCLNQQSEQLMDLSPMKLRIKTFLFIYCVTISLSICCDAYQFNNYASWLVNNPNTLNLTFPIFTVYLLKMFVNQVVGIYSAIWFLSLDSRGAWVELF-------RKITKKWDSEKKTS 532          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000005043.1 (SMESG000005043.1)

HSP 1 Score: 325.094 bits (832), Expect = 1.575e-100
Identity = 179/489 (36.61%), Postives = 267/489 (54.60%), Query Frame = 2
Query:  350 EPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQ----------KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIG-CFFXXXXXXXXXXXXXXXKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSG--------------TNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 1741
            E  +  KC+P  I +P C+N+ YN T MPN  + ETQ EA   +  F  L++  CS NL  FLCS+Y P+C P     I  C+ +CE  RD C  +M  +   WP +++C +      E   C++    +V    +    C   ++P  +I+ N+ Q           C   C +    ++D  ++   WL + A LC +SS  T+LTFL++  RFKYPERP++FL+ CY + S+ + I +A   +  AC+ D       L         C+I+FLL +FF  A+ +WWVILT+ W L+AG KW  EAI + S  FH  AW +S + ++  L L ++D D + G+C +G  N   L +F+I+P  ++L+IG CF L G +  +   +        KT+KLE LM+RIG+F +L+ VP++ V+GC+ YE  NR+ W KS               + P   V+MLK FM  VVGITSG W+W+ KTL+SW 
Sbjct:   52 ENFRPNKCVP--IAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDTKNVTKPPSKGCECK-CRSP--YIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVT-FWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK------LRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 524          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000031852.1 (SMESG000031852.1)

HSP 1 Score: 316.235 bits (809), Expect = 1.381e-97
Identity = 192/524 (36.64%), Postives = 287/524 (54.77%), Query Frame = 2
Query:  317 RFPRDTHSIVLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPS-VKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANIL--------------------------FTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTL-CAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFXXXXXXXXXXXXXXXKNDG-IKTEKLEILMVRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKSGT--------NPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESW-QWFCLVKMCCRK 1774
            R    + SI    ++   C+P  I +  C+ + YN T +PN +N  +  EA  ++Q F +L++  CS++L  FLCS+Y P+C P     I  C+ LC   R+ C R+M  +   WP  +NC + P  NA    C+     +    T NF +     + P L     +++KC   C + ++                          F   DK  +  WL + A +C IS+  TILTF I+  RF+YPERP+IFL++CY + SV + I +A   ++ AC  D +       + G    + C+I+FL  +FF  AS IWWV+LT  W LAAG KW  EAI   +  +H  AW I  + ++ +L + SVD D + G+C VG  N   LL FVIIP I++L++G  FLL G +AL+++R+ +K  G  KT+KLE LM+RI +F +++ VP+ TV+ C+ YE+  RD W +S T         P   V+MLK FM+ VVG T+G W+W+ KTL+SW + FC + +CCRK
Sbjct:   17 RICGQSFSISKPDLRPSTCIP--IEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLRKDNKTRSNKTANFVS-----ERPYLL----KSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAI-------RYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL-LCCRK 517          
The following BLAST results are available for this feature:
BLAST of Frizzled-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD42.154e-14849.57frizzled class receptor 4 [Source:HGNC Symbol;Acc:... [more]
FZD102.294e-13343.33frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD99.285e-12839.93frizzled class receptor 9 [Source:HGNC Symbol;Acc:... [more]
FZD54.094e-11239.50frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD25.305e-10336.70frizzled class receptor 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-171.317e-8133.71Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-171.317e-8133.71Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-171.317e-8133.71Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-174.063e-8132.60Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-174.063e-8132.60Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz1.795e-9234.74gene:FBgn0001085 transcript:FBtr0075743[more]
fz3.024e-9234.74gene:FBgn0001085 transcript:FBtr0330102[more]
fz22.360e-7844.79gene:FBgn0016797 transcript:FBtr0112890[more]
fz22.360e-7844.79gene:FBgn0016797 transcript:FBtr0075029[more]
fz22.360e-7844.79gene:FBgn0016797 transcript:FBtr0332735[more]
back to top
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd9b6.719e-14043.16frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b6.719e-14043.16frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
BX322606.14.735e-13543.05pep chromosome:GRCz11:CHR_ALT_CTG5_1_52:56018527:5... [more]
fzd42.008e-13444.29frizzled class receptor 4 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd9a2.755e-13443.11frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD41.448e-14648.93frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
FZD95.720e-12641.34frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
zdhhc97.633e-11840.92zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
fzd82.685e-11238.76frizzled class receptor 8 [Source:NCBI gene;Acc:10... [more]
ntrk18.130e-10738.32neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd47.367e-15050.00frizzled class receptor 4 [Source:MGI Symbol;Acc:M... [more]
Fzd92.644e-13339.65frizzled class receptor 9 [Source:MGI Symbol;Acc:M... [more]
Fzd101.100e-13241.86frizzled class receptor 10 [Source:MGI Symbol;Acc:... [more]
Fzd52.082e-11039.06frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd52.082e-11039.06frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Frizzled-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61088|FZD4_MOUSE5.153e-14950.00Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 S... [more]
sp|Q9IA05|FZD4_CHICK2.414e-14850.00Frizzled-4 OS=Gallus gallus OX=9031 GN=FZD4 PE=1 S... [more]
sp|Q9ULV1|FZD4_HUMAN1.035e-14749.57Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV... [more]
sp|Q9QZH0|FZD4_RAT3.376e-14749.36Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 P... [more]
sp|Q9PT62|FZD4_XENLA1.094e-14548.93Frizzled-4 OS=Xenopus laevis OX=8355 GN=fzd4 PE=2 ... [more]
back to top
BLAST of Frizzled-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1D1100.000e+0100.00Fzd-4-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
T1E1E80.000e+075.09Fzd-4-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A210QQD61.399e-16850.70Frizzled-4 OS=Mizuhopecten yessoensis OX=6573 GN=K... [more]
V4AZI85.805e-16852.48Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3KAW56.085e-16449.54frizzled-4-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd9b7.206e-13842.61frizzled-9 [Source:NCBI gene;Acc:103027133][more]
fzd49.736e-13744.38frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd9a1.084e-13140.86frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd109.385e-12644.10frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000026985.22.304e-10937.52pep primary_assembly:Astyanax_mexicanus-2.0:19:270... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011009.11.527e-11037.80pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd24.676e-10036.82frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd7a6.626e-7742.99frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8a5.989e-7538.46frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd3b4.849e-4835.43frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Frizzled-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308656.707e-12943.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385676.348e-12035.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429324.024e-11038.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357511.442e-10739.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401191.435e-3426.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd9b1.458e-13642.48frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
fzd104.948e-13143.89frizzled class receptor 10 [Source:NCBI gene;Acc:1... [more]
fzd48.750e-12545.32frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd8a1.516e-11638.57frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSORLT00000002667.21.091e-11237.68pep primary_assembly:ASM223467v1:17:316235:318512:... [more]
back to top
BLAST of Frizzled-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014322.10.000e+099.66SMESG000014322.1[more]
SMESG000037982.13.537e-12440.20SMESG000037982.1[more]
SMESG000037981.12.609e-11138.61SMESG000037981.1[more]
SMESG000005043.11.575e-10036.61SMESG000005043.1[more]
SMESG000031852.11.381e-9736.64SMESG000031852.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010183 ID=SMED30010183|Name=Frizzled-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2472bp
AATGTTTACACACAAGAGTCTACAAAAGTAAGTCTGATTGCAAATATAAA
CAACCAATCAAAATCGAGAATGTTGACAAGTGAAAAATCGTGAAAAAATC
TCTATACAAACTGTTCATTGAAAAGCGCGACAAAATTAAGGAAATTTTTG
AAAAAAATAAAATTCCAGACAATCCAACCTAAGACTATGGATTTCAAATT
AATTATTTAATTAAACTTCAGAAAAAAGAAAAGAAATGGCCATCAGAAAT
TTGCTCTATATGCTTGGATTTTTATTATATATCAAATCAATTGATGGAAT
AACATTGGATTCCCAGAGATTTCCGAGAGACACTCATTCTATAGTCCTGG
AACCAGTTCAAACTAGAAAATGTTTACCAAAAAAAATTTTAGTTCCCGAA
TGTCAGAATTTGTTTTATAATTTTACTGGAATGCCTAACTTAGTGAATCT
TGAAACCCAAATTGAAGCTCAAAGTCAATTGCAAACATTTCAATCATTAA
TAAAGTATAAATGCTCTCAGAATCTGTTGTTTTTCTTGTGTTCTGTTTAT
ATTCCAATGTGCGATCCGATTTCGAATTATCTAATTGGTCCATGTCAACC
GTTATGCGAAGAAGTTCGTGATAGTTGTGAGAGAATCATGAGACCTTTTA
ATTTACCATGGCCAGTCACTTTGAATTGTTCCAGATTTCCCGTACGAAAT
GCAGAAGGCAGTATGTGTATGGAAGGACCTGGACCTTCAGTAAAATCCAC
AGAAAACTTTCAAACCATGTGCGGCGGAATGAAGAATCCAAGGTTGTTTA
TTTTTATCAATCGTACTCAAAAATGCGTTCCAAAATGTTCGGCTAATATT
CTATTTACAGTAGATGACAAATATATAGCAAAAATTTGGTTAACTGTTCT
TGCAAGCCTTTGTTTTATCTCATCGGTTTTCACGATTTTGACTTTTTTAA
TTAATACCGACAGATTTAAATATCCCGAAAGACCAGTGATTTTTTTGGCC
GTATGCTATAGTATATATAGTGTTTCGCACTTCATTAATCTTGCAAACAC
CAGACAATCGGCAGCATGCAACAGAGACCCGGTAAGTGGGCAATTTATTC
TTACTCAAGAAGGTCTTGACAATACATTGTGTGCTATTATCTTTTTGTTA
AATTTCTTTTTTTCTACAGCTAGTCAAATTTGGTGGGTAATTCTGACTGT
TGCCTGGTTATTAGCGGCCGGTTTTAAATGGAGTGAAGAAGCAATATATC
AAAGATCTGGCTATTTTCATTTGGCCGCTTGGCTTATCTCATCTTTATTG
ACTGTAGCTGTTCTTGTTTTACGGAGCGTGGATGCTGATGAGTTGTTAGG
ACTTTGTTCAGTTGGTCAACAAAATGTATCAACTTTATTAATATTTGTTA
TAATTCCCAACATTATTTTTCTTGTTATTGGTTGCTTTTTCTTATTAGGA
GGTTTAGTAGCGTTGGTTAGAGTTCGACGTCACGTTAAGAATGATGGAAT
TAAAACGGAGAAATTGGAAATTCTAATGGTTCGAATTGGACTGTTTAGCG
TTCTTTTTCTTGTTCCTTCGTCAACTGTATTAGGGTGTAATTTTTACGAA
TATGCTAATCGAGACCATTGGTTGAAATCGGGAACTAATCCAAACATTGA
AGTATACATGTTGAAAATATTCATGTCATCAGTGGTTGGTATTACTAGTG
GCGTTTGGGTTTGGTCAATAAAAACCTTAGAAAGCTGGCAATGGTTTTGC
CTTGTTAAGATGTGTTGTAGAAAACCAACAAGATCCATGATAGAAGAAAA
GAAAAATAATTTCCCCAAAAAGATTGGATATGTAGCAGCAACTAGTCGTG
AAAATATATCAATTGACCCACTTGCAGTTCGAAATTGTTGGAGCAATAAC
GCTCAAAAAATACCTCTACAAGACTTTTCATCAAGTGGTTACACAAATCC
TCAACCGAGCTCAAATGGAGATTACAAAACAGATATCAATATATAATTAG
ATAATGAACGTGGAGAAATACAAGCCAACAATTTGAATAAACACCGAAAG
CTTTTCTTAAAAAAATAACCGGTTTTTTGTTTTAAACACTTTATCATGGT
TTAATTGTTACTAATGATGATAATGATGATGATAAAATGCATTATGCCGA
GATTATTGTAATGTTTTAAATTTGTTTAAATGCATATAGAATTATTTTAA
ACAAAACAAACAGGGTGACTGTTTTGCACTTTTGATCTCAGATATCACTA
TAAACTATTGATTTGTCATATTGTGCATCGTCTTTTCAATTTCTACAATG
ACTGTGTAAGTGTGCGTGTGTGCGCGAGTGTATGTGTGTGTGTACGTGTC
TGTGTGCTTTGACGATTTTATCGCAGTTTGATAATCTAAAAAGGCGGTCA
TTTTTTGTACAGGTTTTTATTTTAAATGACAGAATTGTCAATTTGCAAAT
AAATAATACGATGATAAAAAAA
back to top

protein sequence of SMED30010183-orf-1

>SMED30010183-orf-1 ID=SMED30010183-orf-1|Name=SMED30010183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=587bp
MAIRNLLYMLGFLLYIKSIDGITLDSQRFPRDTHSIVLEPVQTRKCLPKK
ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFF
LCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSR
FPVRNAEGSMCMEGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQKCVPK
CSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERP
VIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCA
IIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWL
ISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGC
FFLLGGLVALVRVRRHVKNDGIKTEKLEILMVRIGLFSVLFLVPSSTVLG
CNFYEYANRDHWLKSGTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLES
WQWFCLVKMCCRKPTRSMIEEKKNNFPKKIGYVAATSRENISIDPLAVRN
CWSNNAQKIPLQDFSSSGYTNPQPSSNGDYKTDINI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
GO:0042813Wnt-activated receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 344..367
score: 45.17
coord: 218..240
score: 38.96
coord: 301..325
score: 49.76
coord: 246..268
score: 46.78
coord: 389..411
score: 37.57
coord: 430..451
score: 54.73
coord: 473..493
score: 51.62
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 205..512
e-value: 2.0E-148
score: 509.1
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 206..505
e-value: 6.3E-107
score: 357.4
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 45..166
e-value: 2.5E-40
score: 150.0
IPR020067Frizzled domainPFAMPF01392Fzcoord: 51..153
e-value: 1.0E-24
score: 87.3
IPR020067Frizzled domainPROSITEPS50038FZcoord: 41..164
score: 23.235
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 178..509
e-value: 9.9E-111
score: 371.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 567..586
NoneNo IPR availablePANTHERPTHR11309:SF99FRIZZLED-3coord: 55..513
NoneNo IPR availableCDDcd150387tmF_FZD4coord: 205..504
e-value: 1.33031E-135
score: 395.285
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.715
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
NoneNo IPR availableTMHMMTMhelixcoord: 298..320
NoneNo IPR availableTMHMMTMhelixcoord: 429..451
NoneNo IPR availableTMHMMTMhelixcoord: 251..270
NoneNo IPR availableTMHMMTMhelixcoord: 341..363
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 37..163
e-value: 7.4E-35
score: 122.0
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 45..164
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 55..513
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 215..500
score: 32.831