Nucleobindin-2

Overview
NameNucleobindin-2
Smed IDSMED30010171
Length (bp)1568
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleobindin-2 (SMED30010171) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleobindin-2 (SMED30010171) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleobindin-2 (SMED30010171) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleobindin-2 (SMED30010171) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010171

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30010171h1SMcG0008180 dd_Smed_v4_1728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010171h1SMcG0008180 dd_Smed_v4_1728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010171h1SMcG0008180 dd_Smed_v4_1728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010171h1SMcG0008180 dd_Smed_v6_1728_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleobindin-2 vs. Ensembl Human
Match: NUCB1 (nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043])

HSP 1 Score: 186.037 bits (471), Expect = 2.386e-52
Identity = 123/294 (41.84%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   47 TGLYYHRYLQEVIDVLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRML--------LKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 331          
BLAST of Nucleobindin-2 vs. Ensembl Human
Match: NUCB1 (nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043])

HSP 1 Score: 186.037 bits (471), Expect = 2.386e-52
Identity = 123/294 (41.84%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   47 TGLYYHRYLQEVIDVLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRML--------LKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 331          
BLAST of Nucleobindin-2 vs. Ensembl Human
Match: NUCB1 (nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043])

HSP 1 Score: 171.4 bits (433), Expect = 1.191e-48
Identity = 114/284 (40.14%), Postives = 168/284 (59.15%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQ 1178
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E                                      EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q
Sbjct:   47 TGLYYHRYLQEVIDVLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEF-------------------------------------EHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQ 292          
BLAST of Nucleobindin-2 vs. Ensembl Human
Match: NUCB2 (nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044])

HSP 1 Score: 167.548 bits (423), Expect = 6.072e-46
Identity = 125/315 (39.68%), Postives = 197/315 (62.54%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVI-SFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y EYL ++I  LE+DK+F E+++ A     ++  +++ L  V H +R++LDE+KR+E+ RL +L        ++AK   +       ++++  FD  HL+H N   FE +DL+ LIK    DL   DK + ++F+ +EM KEH +++ L+T+ +  +RK+ E + +E + +H+NH KV+ PGS++QLKEVW++ D LDP +F+PK FF LHDVN DG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +M  +D NKD LV+ +EFL+ ++   F E    +T   D Q+ ++E E K +E
Sbjct:   50 TGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRML--------IKAKLDSLQDIGMDHQALLKQFD--HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTL-NEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETL--DQQQFFTEEELKEYE 351          
BLAST of Nucleobindin-2 vs. Ensembl Human
Match: NUCB2 (nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044])

HSP 1 Score: 167.548 bits (423), Expect = 6.325e-46
Identity = 125/315 (39.68%), Postives = 197/315 (62.54%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVI-SFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y EYL ++I  LE+DK+F E+++ A     ++  +++ L  V H +R++LDE+KR+E+ RL +L        ++AK   +       ++++  FD  HL+H N   FE +DL+ LIK    DL   DK + ++F+ +EM KEH +++ L+T+ +  +RK+ E + +E + +H+NH KV+ PGS++QLKEVW++ D LDP +F+PK FF LHDVN DG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +M  +D NKD LV+ +EFL+ ++   F E    +T   D Q+ ++E E K +E
Sbjct:   50 TGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRML--------IKAKLDSLQDIGMDHQALLKQFD--HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTL-NEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETL--DQQQFFTEEELKEYE 351          
BLAST of Nucleobindin-2 vs. Ensembl Celegans
Match: nucb-1 (NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ51])

HSP 1 Score: 165.236 bits (417), Expect = 3.410e-45
Identity = 121/317 (38.17%), Postives = 186/317 (58.68%), Query Frame = 3
Query:  342 YKEYLDEIIKELESDKNFAERIK-----DAQAHNRTEHIAQSLQFVHHRI-RSRLDEIKRREIERLNVLENEIERR-RLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKP-YSESEFKNFE 1268
            Y +YL+E++K LESD  F ER+K     D +A N  +HI    Q V  ++ +++ DEI+R        L  +IE + + +   + +  PD            HLD   +  F   DL KLI+K   D++ +D++++  F+ +EMKK+  +  KL  +  P ER+K + + +ES  RH +H K+  PGS++QL+EVW+++DHL+  +++PK FF LHD+NGDG  +  E+ESL Q EL K+Y   N DDDM+E+  EM RMR  +MK ID N+D ++S  EFL  S   N    P+ +  E+ GQK  Y++ E + FE
Sbjct:   71 YTKYLEEVVKILESDPKFNERLKNMKEEDIKAGNIADHIDDLPQEVFDKLHKAKFDEIER--------LRKQIEEQIKADGGAHNIKMPD------------HLDVQELEKFHKEDLRKLIQKTVADMNVMDEQRKDDFKQYEMKKQAEEDHKLAQMT-PEEREKAKSEHEESLKRHNDHEKLKHPGSKDQLQEVWEESDHLEKDQYDPKTFFALHDLNGDGFWNDFELESLFQLELEKMYNETNPDDDMKERAEEMYRMREHVMKQIDVNQDRMISMQEFLNDSDNQN-SNPPKQEEWEDLGQKKVYTDEELQQFE 365          
BLAST of Nucleobindin-2 vs. Ensembl Celegans
Match: nucb-1 (NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ51])

HSP 1 Score: 165.236 bits (417), Expect = 4.958e-45
Identity = 121/317 (38.17%), Postives = 186/317 (58.68%), Query Frame = 3
Query:  342 YKEYLDEIIKELESDKNFAERIK-----DAQAHNRTEHIAQSLQFVHHRI-RSRLDEIKRREIERLNVLENEIERR-RLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKP-YSESEFKNFE 1268
            Y +YL+E++K LESD  F ER+K     D +A N  +HI    Q V  ++ +++ DEI+R        L  +IE + + +   + +  PD            HLD   +  F   DL KLI+K   D++ +D++++  F+ +EMKK+  +  KL  +  P ER+K + + +ES  RH +H K+  PGS++QL+EVW+++DHL+  +++PK FF LHD+NGDG  +  E+ESL Q EL K+Y   N DDDM+E+  EM RMR  +MK ID N+D ++S  EFL  S   N    P+ +  E+ GQK  Y++ E + FE
Sbjct:   71 YTKYLEEVVKILESDPKFNERLKNMKEEDIKAGNIADHIDDLPQEVFDKLHKAKFDEIER--------LRKQIEEQIKADGGAHNIKMPD------------HLDVQELEKFHKEDLRKLIQKTVADMNVMDEQRKDDFKQYEMKKQAEEDHKLAQMT-PEEREKAKSEHEESLKRHNDHEKLKHPGSKDQLQEVWEESDHLEKDQYDPKTFFALHDLNGDGFWNDFELESLFQLELEKMYNETNPDDDMKERAEEMYRMREHVMKQIDVNQDRMISMQEFLNDSDNQN-SNPPKQEEWEDLGQKKVYTDEELQQFE 365          
BLAST of Nucleobindin-2 vs. Ensembl Celegans
Match: nucb-1 (NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ51])

HSP 1 Score: 165.236 bits (417), Expect = 4.958e-45
Identity = 121/317 (38.17%), Postives = 186/317 (58.68%), Query Frame = 3
Query:  342 YKEYLDEIIKELESDKNFAERIK-----DAQAHNRTEHIAQSLQFVHHRI-RSRLDEIKRREIERLNVLENEIERR-RLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKP-YSESEFKNFE 1268
            Y +YL+E++K LESD  F ER+K     D +A N  +HI    Q V  ++ +++ DEI+R        L  +IE + + +   + +  PD            HLD   +  F   DL KLI+K   D++ +D++++  F+ +EMKK+  +  KL  +  P ER+K + + +ES  RH +H K+  PGS++QL+EVW+++DHL+  +++PK FF LHD+NGDG  +  E+ESL Q EL K+Y   N DDDM+E+  EM RMR  +MK ID N+D ++S  EFL  S   N    P+ +  E+ GQK  Y++ E + FE
Sbjct:   71 YTKYLEEVVKILESDPKFNERLKNMKEEDIKAGNIADHIDDLPQEVFDKLHKAKFDEIER--------LRKQIEEQIKADGGAHNIKMPD------------HLDVQELEKFHKEDLRKLIQKTVADMNVMDEQRKDDFKQYEMKKQAEEDHKLAQMT-PEEREKAKSEHEESLKRHNDHEKLKHPGSKDQLQEVWEESDHLEKDQYDPKTFFALHDLNGDGFWNDFELESLFQLELEKMYNETNPDDDMKERAEEMYRMREHVMKQIDVNQDRMISMQEFLNDSDNQN-SNPPKQEEWEDLGQKKVYTDEELQQFE 365          
BLAST of Nucleobindin-2 vs. Ensembl Fly
Match: NUCB1 (gene:FBgn0052190 transcript:FBtr0075171)

HSP 1 Score: 185.652 bits (470), Expect = 9.608e-52
Identity = 126/319 (39.50%), Postives = 201/319 (63.01%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERI-KDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENE-------IERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
            L Y+ YL E+++ LE+D  F +++ K  +A  R+  IAQ L +V+H +R++LDEIKRRE+ERL  L N+       I+R+ L+                     +HLDH+N HTFE+ DL KLI+K  DDL++ D+++  +F+ +EM+KE  ++ + + + D   RKK E ++KE E +HK+H K+H PG++ QL++VW+K DH+D  +F+PK FF +HDV+ +G+ D  E+++L   EL KVY+++  +DDM+E+  EM RMR    +  D N D L+S DEF+  +    F++DPE +T   D Q+ Y+  E+  +E
Sbjct:   49 LEYERYLREVVEALEADPEFRKKLDKAPEADIRSGKIAQELDYVNHHVRTKLDEIKRREVERLRELANQAYELSNDIDRKHLKVS-------------------QHLDHDNEHTFEIEDLRKLIQKTSDDLAEADRKRRGEFKEYEMQKEFEREAQKKEM-DEESRKKFETELKEKEEKHKDHEKLHHPGNKAQLEDVWEKQDHMDKNDFDPKTFFSIHDVDSNGYWDEAEVKALFVKELDKVYQSDLPEDDMRERAEEMERMREHYFQETDMNHDGLISIDEFMVQTNKEEFQKDPEWETI--DRQQQYTHEEYLEYE 345          
BLAST of Nucleobindin-2 vs. Ensembl Zebrafish
Match: nucb2a (nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-14])

HSP 1 Score: 185.267 bits (469), Expect = 5.476e-52
Identity = 129/303 (42.57%), Postives = 189/303 (62.38%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVL---ENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEED 1226
              LHY  YL E+I  LE D++F E++ +    + +   +A+ L FV H +RS+LDE+KR+E+ RL  L   + +IE     A  ++       LK       E+L+H N HTFE+ DL++LIK    DL   DKE+ ++F+ +EM KEH +++ L+T+ D + RKK EE  +E + +H +H KV+ PGS++QLKEVW++ D LDP++F+PK FF+LHD NGDG  D  E+ESL   EL K+Y+  N +DDM E   E +RMR  +M  +D NKD LVS DEFL  ++   F E    +T E++
Sbjct:   49 TGLHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRSKLDELKRQEVSRLRTLIKAKQDIEGGNDIAVDHQA-----LLKQF-----EYLNHMNPHTFEVEDLDRLIKSATKDLENYDKERHEEFKKYEMMKEHERREHLKTL-DEDGRKKEEEHYEEMKKKHADHPKVNHPGSKDQLKEVWEEADGLDPEDFDPKTFFNLHDTNGDGFFDEQELESLFTKELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDSNKDRLVSLDEFLVATKKKEFLEPDSWETLEQN 340          
BLAST of Nucleobindin-2 vs. Ensembl Zebrafish
Match: nucb2a (nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-14])

HSP 1 Score: 185.267 bits (469), Expect = 5.476e-52
Identity = 129/303 (42.57%), Postives = 189/303 (62.38%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVL---ENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEED 1226
              LHY  YL E+I  LE D++F E++ +    + +   +A+ L FV H +RS+LDE+KR+E+ RL  L   + +IE     A  ++       LK       E+L+H N HTFE+ DL++LIK    DL   DKE+ ++F+ +EM KEH +++ L+T+ D + RKK EE  +E + +H +H KV+ PGS++QLKEVW++ D LDP++F+PK FF+LHD NGDG  D  E+ESL   EL K+Y+  N +DDM E   E +RMR  +M  +D NKD LVS DEFL  ++   F E    +T E++
Sbjct:   49 TGLHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRSKLDELKRQEVSRLRTLIKAKQDIEGGNDIAVDHQA-----LLKQF-----EYLNHMNPHTFEVEDLDRLIKSATKDLENYDKERHEEFKKYEMMKEHERREHLKTL-DEDGRKKEEEHYEEMKKKHADHPKVNHPGSKDQLKEVWEEADGLDPEDFDPKTFFNLHDTNGDGFFDEQELESLFTKELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDSNKDRLVSLDEFLVATKKKEFLEPDSWETLEQN 340          
BLAST of Nucleobindin-2 vs. Ensembl Zebrafish
Match: nucb2a (nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-14])

HSP 1 Score: 184.882 bits (468), Expect = 8.497e-52
Identity = 129/303 (42.57%), Postives = 189/303 (62.38%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVL---ENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEED 1226
              LHY  YL E+I  LE D++F E++ +    + +   +A+ L FV H +RS+LDE+KR+E+ RL  L   + +IE     A  ++       LK       E+L+H N HTFE+ DL++LIK    DL   DKE+ ++F+ +EM KEH +++ L+T+ D + RKK EE  +E + +H +H KV+ PGS++QLKEVW++ D LDP++F+PK FF+LHD NGDG  D  E+ESL   EL K+Y+  N +DDM E   E +RMR  +M  +D NKD LVS DEFL  ++   F E    +T E++
Sbjct:   60 TGLHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRSKLDELKRQEVSRLRTLIKAKQDIEGGNDIAVDHQA-----LLKQF-----EYLNHMNPHTFEVEDLDRLIKSATKDLENYDKERHEEFKKYEMMKEHERREHLKTL-DEDGRKKEEEHYEEMKKKHADHPKVNHPGSKDQLKEVWEEADGLDPEDFDPKTFFNLHDTNGDGFFDEQELESLFTKELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDSNKDRLVSLDEFLVATKKKEFLEPDSWETLEQN 351          
BLAST of Nucleobindin-2 vs. Ensembl Zebrafish
Match: nucb1 (nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-222])

HSP 1 Score: 180.259 bits (456), Expect = 1.652e-50
Identity = 127/314 (40.45%), Postives = 192/314 (61.15%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKP-YSESEFKNFE 1268
            L+Y  YL E+I+ LE+D +F E+++ A   + +   +++ L  V H +R+RLDE+KR+E+ RL +L        L+AK         ++       + EHLD +N +TFE  DLE LI     DL   D E+ ++F+ +EM KEH +++ L+++ D  +R+K E++M E + +H+ H KV+ PGS +QL+EVW++ D LDP+EFNPK FF LHD N DG LD+ E+E+L   EL KVY+  N +DDM E   E +RMR  +M+ +D N D LVS +EFL+ ++        E +T   D  KP Y+E E + FE
Sbjct:   42 LYYDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRLRML--------LKAKLDSTNAQSVQMDHASLLKQFEHLDPHNQNTFEAKDLELLIATATKDLENYDAERHEEFKRYEMLKEHERREYLKSL-DQEKREKEEKRMDELKEKHRQHPKVNSPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNSDGVLDVQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMQNVDVNHDRLVSLEEFLKSTEKRELNNQKEWETL--DDTKPVYTEEELQRFE 344          
BLAST of Nucleobindin-2 vs. Ensembl Zebrafish
Match: nucb1 (nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-222])

HSP 1 Score: 180.259 bits (456), Expect = 1.652e-50
Identity = 127/314 (40.45%), Postives = 192/314 (61.15%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKP-YSESEFKNFE 1268
            L+Y  YL E+I+ LE+D +F E+++ A   + +   +++ L  V H +R+RLDE+KR+E+ RL +L        L+AK         ++       + EHLD +N +TFE  DLE LI     DL   D E+ ++F+ +EM KEH +++ L+++ D  +R+K E++M E + +H+ H KV+ PGS +QL+EVW++ D LDP+EFNPK FF LHD N DG LD+ E+E+L   EL KVY+  N +DDM E   E +RMR  +M+ +D N D LVS +EFL+ ++        E +T   D  KP Y+E E + FE
Sbjct:   42 LYYDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRLRML--------LKAKLDSTNAQSVQMDHASLLKQFEHLDPHNQNTFEAKDLELLIATATKDLENYDAERHEEFKRYEMLKEHERREYLKSL-DQEKREKEEKRMDELKEKHRQHPKVNSPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNSDGVLDVQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMQNVDVNHDRLVSLEEFLKSTEKRELNNQKEWETL--DDTKPVYTEEELQRFE 344          
BLAST of Nucleobindin-2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 189.119 bits (479), Expect = 8.612e-54
Identity = 136/336 (40.48%), Postives = 199/336 (59.23%), Query Frame = 3
Query:  285 LCQHLCFKINVLKF*NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-------EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
            +   L   +NVL F   L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        ++AK       D  ++  +  D        EHLD  N HTFE  DLE LI+    DL   D  + ++F+ +EM KEH +++ L+++ D  +RK  E   +E + +HK H KV+ PGS +QLKEVW++ D LDP EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +MK +D N D LV+ DEFL+ ++   F E    +T +E   + Y+E E + FE
Sbjct:    8 MAALLIPVLNVL-FDTGLYYDRYLREVIDVLETDGHFREKLQAANADDIKSGKLSKELDFVSHHVRTKLDELKRQEVSRLRML--------IKAK------MDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSL-DEEKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDE--TQVYTEEELRKFE 325          
BLAST of Nucleobindin-2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 184.882 bits (468), Expect = 1.380e-52
Identity = 129/315 (40.95%), Postives = 192/315 (60.95%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        ++AK       + ++  +    + EHLD  N HTFE  DLE LI+    DL   D  + ++F+ +EM KEH +++ L+++ D  +RK  E   +E + +HK H KV+ PGS +QLKEVW++ D LDP EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +MK +D N D LV+ DEFL+ ++   F E    +T +E   + Y+E E + FE
Sbjct:   40 TGLYYDRYLREVIDVLETDGHFREKLQAANADDIKSGKLSKELDFVSHHVRTKLDELKRQEVSRLRML--------IKAKMDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSL-DEEKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDE--TQVYTEEELRKFE 343          
BLAST of Nucleobindin-2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 186.037 bits (471), Expect = 1.406e-52
Identity = 131/321 (40.81%), Postives = 192/321 (59.81%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-------EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        ++AK       D  ++  +  D        EHLD  N HTFE  DLE LI+    DL   D  + ++F+ +EM KEH +++ L+++ D  +RK  E   +E + +HK H KV+ PGS +QLKEVW++ D LDP EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +MK +D N D LV+ DEFL+ ++   F E    +T +E   + Y+E E + FE
Sbjct:   10 TGLYYDRYLREVIDVLETDGHFREKLQAANADDIKSGKLSKELDFVSHHVRTKLDELKRQEVSRLRML--------IKAK------MDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSL-DEEKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDE--TQVYTEEELRKFE 313          
BLAST of Nucleobindin-2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 186.037 bits (471), Expect = 1.907e-52
Identity = 131/321 (40.81%), Postives = 192/321 (59.81%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-------EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        ++AK       D  ++  +  D        EHLD  N HTFE  DLE LI+    DL   D  + ++F+ +EM KEH +++ L+++ D  +RK  E   +E + +HK H KV+ PGS +QLKEVW++ D LDP EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +MK +D N D LV+ DEFL+ ++   F E    +T +E   + Y+E E + FE
Sbjct:   40 TGLYYDRYLREVIDVLETDGHFREKLQAANADDIKSGKLSKELDFVSHHVRTKLDELKRQEVSRLRML--------IKAK------MDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSL-DEEKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDE--TQVYTEEELRKFE 343          
BLAST of Nucleobindin-2 vs. Ensembl Xenopus
Match: nucb1 (nucleobindin 1 [Source:NCBI gene;Acc:407884])

HSP 1 Score: 186.037 bits (471), Expect = 1.907e-52
Identity = 131/321 (40.81%), Postives = 192/321 (59.81%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-------EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        ++AK       D  ++  +  D        EHLD  N HTFE  DLE LI+    DL   D  + ++F+ +EM KEH +++ L+++ D  +RK  E   +E + +HK H KV+ PGS +QLKEVW++ D LDP EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +MK +D N D LV+ DEFL+ ++   F E    +T +E   + Y+E E + FE
Sbjct:   40 TGLYYDRYLREVIDVLETDGHFREKLQAANADDIKSGKLSKELDFVSHHVRTKLDELKRQEVSRLRML--------IKAK------MDATMEENVQIDHMSLLKQFEHLDPQNQHTFEARDLELLIQAATKDLENYDAARHEEFKRYEMMKEHERREYLKSL-DEEKRKMEEAHFEEMKKKHKEHPKVNVPGSIDQLKEVWEETDGLDPNEFNPKTFFKLHDTNGDGVLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREHVMKNVDANHDRLVTLDEFLKSTERKEFNEADGWETVDE--TQVYTEEELRKFE 343          
BLAST of Nucleobindin-2 vs. Ensembl Mouse
Match: Nucb1 (nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388])

HSP 1 Score: 188.734 bits (478), Expect = 1.532e-53
Identity = 124/294 (42.18%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  ++Q L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   46 TGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSQELDFVSHNVRTKLDELKRQEVSRLRML--------LKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 330          
BLAST of Nucleobindin-2 vs. Ensembl Mouse
Match: Nucb1 (nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388])

HSP 1 Score: 188.348 bits (477), Expect = 1.872e-53
Identity = 124/294 (42.18%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  ++Q L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   46 TGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSQELDFVSHNVRTKLDELKRQEVSRLRML--------LKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 330          
BLAST of Nucleobindin-2 vs. Ensembl Mouse
Match: Nucb2 (nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179])

HSP 1 Score: 176.792 bits (447), Expect = 1.917e-49
Identity = 124/315 (39.37%), Postives = 195/315 (61.90%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y EYL ++I+ LE+D +F E+++ A     R+  ++Q L  V H++R+RLDE+KR+E+ RL +L     + +L+A        D  +   +   + EHL+H N +TFE  DL+ LIK    DL Q D+ + ++F+ +EM KEH +++ L+T+ +   +++  +  +    +H++H KV+ PGS++QLKEVW++ D LDP +F+PK FF LHDVN DG LD  E+E+L   EL KVY   N++DDM E   E +RMR  +M  ID NKD LV+ +EFL+ ++   F E    +T   D Q+ ++E E K +E
Sbjct:   50 TGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELKRQEVGRLRMLI----KAKLDALQ------DTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEESKFEEMKR-KHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTRELEKVYNPQNAEDDMIEMEEERLRMREHVMSEIDNNKDRLVTLEEFLRATEKKEFLEPDSWETL--DQQQLFTEDELKEYE 351          
BLAST of Nucleobindin-2 vs. Ensembl Mouse
Match: Nucb2 (nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179])

HSP 1 Score: 176.407 bits (446), Expect = 2.169e-49
Identity = 124/315 (39.37%), Postives = 195/315 (61.90%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y EYL ++I+ LE+D +F E+++ A     R+  ++Q L  V H++R+RLDE+KR+E+ RL +L     + +L+A        D  +   +   + EHL+H N +TFE  DL+ LIK    DL Q D+ + ++F+ +EM KEH +++ L+T+ +   +++  +  +    +H++H KV+ PGS++QLKEVW++ D LDP +F+PK FF LHDVN DG LD  E+E+L   EL KVY   N++DDM E   E +RMR  +M  ID NKD LV+ +EFL+ ++   F E    +T   D Q+ ++E E K +E
Sbjct:   50 TGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELKRQEVGRLRMLI----KAKLDALQ------DTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEESKFEEMKR-KHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTRELEKVYNPQNAEDDMIEMEEERLRMREHVMSEIDNNKDRLVTLEEFLRATEKKEFLEPDSWETL--DQQQLFTEDELKEYE 351          
BLAST of Nucleobindin-2 vs. Ensembl Mouse
Match: Nucb1 (nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388])

HSP 1 Score: 121.709 bits (304), Expect = 7.677e-31
Identity = 79/173 (45.66%), Postives = 115/173 (66.47%), Query Frame = 3
Query:  687 KVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
            K   DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   26 KATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 197          
BLAST of Nucleobindin-2 vs. UniProt/SwissProt
Match: sp|Q0P569|NUCB1_BOVIN (Nucleobindin-1 OS=Bos taurus OX=9913 GN=NUCB1 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.891e-57
Identity = 127/302 (42.05%), Postives = 189/302 (62.58%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDG 1229
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ +L  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N DDDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E   Q + G
Sbjct:   44 TGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRML--------LKAKMDAQQEPNIQLDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEDDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWEQGKAG 336          
BLAST of Nucleobindin-2 vs. UniProt/SwissProt
Match: sp|Q63083|NUCB1_RAT (Nucleobindin-1 OS=Rattus norvegicus OX=10116 GN=Nucb1 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.382e-53
Identity = 125/294 (42.52%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  ++Q L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F E  E
Sbjct:   46 TGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSQELDFVSHNVRTKLDELKRQEVSRLRML--------LKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGETAE 330          
BLAST of Nucleobindin-2 vs. UniProt/SwissProt
Match: sp|Q02819|NUCB1_MOUSE (Nucleobindin-1 OS=Mus musculus OX=10090 GN=Nucb1 PE=1 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 1.310e-52
Identity = 124/294 (42.18%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  ++Q L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   46 TGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSQELDFVSHNVRTKLDELKRQEVSRLRML--------LKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLQEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 330          
BLAST of Nucleobindin-2 vs. UniProt/SwissProt
Match: sp|Q02818|NUCB1_HUMAN (Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4)

HSP 1 Score: 186.037 bits (471), Expect = 1.146e-51
Identity = 123/294 (41.84%), Postives = 186/294 (63.27%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+ +EFL  +Q   F +  E
Sbjct:   47 TGLYYHRYLQEVIDVLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRML--------LKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGE 331          
BLAST of Nucleobindin-2 vs. UniProt/SwissProt
Match: sp|Q5R4U1|NUCB1_PONAB (Nucleobindin-1 OS=Pongo abelii OX=9601 GN=NUCB1 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.595e-51
Identity = 123/294 (41.84%), Postives = 185/294 (62.93%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPE 1205
              L+Y  YL E+I  LE+D +F E+++ A A + ++  +++ L FV H +R++LDE+KR+E+ RL +L        L+AK      P+ ++  +    + EHLD  N HTFE  DLE LI+    DL+Q D    ++F+ +EM KEH +++ LE++ +  +RK+ E +++E + RH+ H KV+ PGS+ QLKEVW++ D LDP  FNPK FF LHD+N DG LD  E+E+L   EL KVY+  N +DDM+E   E +RMR  +MK +D N+D LV+  EFL  +Q   F +  E
Sbjct:   47 TGLYYHRYLQEVIDVLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRML--------LKAKMDAEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGE-EQRKEAERRLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLGEFLASTQRKEFGDTGE 331          
BLAST of Nucleobindin-2 vs. TrEMBL
Match: A0A267G7U2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034413g5 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 7.907e-68
Identity = 153/359 (42.62%), Postives = 222/359 (61.84%), Query Frame = 3
Query:  252 LYLAHIFI*IYLCQHLC-------------FKINVLKF*NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIE-RRRLEAKGYKVPPPDPK--LKSV--ISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEA-NNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEE-DGQKPYSESEFKNFE 1268
            L+L   F+ I  C H                  NVL    D+ Y++YL E+I  +ESDK FA R++   + N ++ +A  L+F  H +R+RLDEIKR+E+ERLN LE  +E +  L+A   K      +  L+S+   +  + HLDH+N HTFE++DL+KLI +V  D+ Q+D+ +E +++ +EM KEH ++ +L  IKD   R+  E+QM+    RH+ H +VH+PGS EQLKE W+K D +D   F+PKAFF LHD+NGDGH+D+NEIE+L   EL KVY   N++  D  E+ HEM RMR  ++  +DKNKD +VS +EF  +  +    +D E KT EE D  KP++E E + FE
Sbjct:    9 LFLTSAFLLIS-CTHSVPVSKEEKKAESERLPDNVLP---DVSYRQYLSEVISAMESDKEFANRLR---SMNDSDEMANQLEFASHSVRNRLDEIKRQEVERLNELEKALEDKLALKANPGKASRAKFRFGLQSLDEATIKRAHLDHSNPHTFEIADLQKLINQVTQDIDQVDQAREAEYKRYEMGKEHSRRARLRRIKDKKAREAAEQQMRAERERHRRHERVHQPGSREQLKEAWEKGDRMDRDSFDPKAFFMLHDINGDGHMDVNEIEALFWKELDKVYSKENDTTVDRVERQHEMERMRRAVLMRLDKNKDRMVSWEEFNAWISSQEANKDEEWKTAEESDEDKPFNEEELRQFE 360          
BLAST of Nucleobindin-2 vs. TrEMBL
Match: A0A267DJS5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034413g1 PE=4 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.159e-67
Identity = 144/319 (45.14%), Postives = 211/319 (66.14%), Query Frame = 3
Query:  333 DLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIE-RRRLEAKGYKVPPPDPK--LKSV--ISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEA-NNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEE-DGQKPYSESEFKNFE 1268
            D+ Y++YL E+I  +ESDK FA R++   + N ++ +A  L+F  H +R+RLDEIKR+E+ERLN LE  +E +  L+A   K      +  L+S+   +  + HLDH+N HTFE++DL+KLI +V  D+ Q+D+ +E +++ +EM KEH ++ +L  IKD   R+  E+QM+    RH+ H +VH+PGS EQLKE W+K D +D   F+PKAFF LHD+NGDGH+D+NEIE+L   EL KVY   N++  D  E+ HEM RMR  ++  +DKNKD +VS +EF  +  +    +D E KT EE D  KP++E E + FE
Sbjct:   45 DVSYRQYLSEVISAMESDKEFANRLR---SMNDSDEMANQLEFASHSVRNRLDEIKRQEVERLNELEKALEDKLALKANPGKASRAKFRFGLQSLDEATIKRAHLDHSNPHTFEIADLQKLINQVTQDIDQVDQAREAEYKRYEMGKEHSRRARLRRIKDKKAREAAEQQMRAERERHRRHERVHQPGSREQLKEAWEKGDRMDRDSFDPKAFFMLHDINGDGHMDVNEIEALFWKELDKVYSKENDTTVDRVERQHEMERMRRAVLMRLDKNKDRMVSWEEFNAWISSQEANKDEEWKTAEESDEDKPFNEEELRQFE 360          
BLAST of Nucleobindin-2 vs. TrEMBL
Match: A0A1I8J719 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.167e-67
Identity = 144/319 (45.14%), Postives = 211/319 (66.14%), Query Frame = 3
Query:  333 DLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIE-RRRLEAKGYKVPPPDPK--LKSV--ISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEA-NNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEE-DGQKPYSESEFKNFE 1268
            D+ Y++YL E+I  +ESDK FA R++   + N ++ +A  L+F  H +R+RLDEIKR+E+ERLN LE  +E +  L+A   K      +  L+S+   +  + HLDH+N HTFE++DL+KLI +V  D+ Q+D+ +E +++ +EM KEH ++ +L  IKD   R+  E+QM+    RH+ H +VH+PGS EQLKE W+K D +D   F+PKAFF LHD+NGDGH+D+NEIE+L   EL KVY   N++  D  E+ HEM RMR  ++  +DKNKD +VS +EF  +  +    +D E KT EE D  KP++E E + FE
Sbjct:   43 DVSYRQYLSEVISAMESDKEFANRLR---SMNDSDEMANQLEFASHSVRNRLDEIKRQEVERLNELEKALEDKLALKANPGKASRAKFRFGLQSLDEATIKRAHLDHSNPHTFEIADLQKLINQVTQDIDQVDQAREAEYKRYEMGKEHSRRARLRRIKDKKAREAAEQQMRAERERHRRHERVHQPGSREQLKEAWEKGDRMDRDSFDPKAFFMLHDINGDGHMDVNEIEALFWKELDKVYSKENDTTVDRVERQHEMERMRRAVLMRLDKNKDRMVSWEEFNAWISSQEANKDEEWKTAEESDEDKPFNEEELRQFE 358          
BLAST of Nucleobindin-2 vs. TrEMBL
Match: A0A267G656 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034413g4 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 9.888e-67
Identity = 143/319 (44.83%), Postives = 210/319 (65.83%), Query Frame = 3
Query:  333 DLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIE-RRRLEAKGYKVPPPDPK--LKSV--ISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEA-NNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEE-DGQKPYSESEFKNFE 1268
            D+ Y++YL E+I  +ESDK FA R++   + N ++ +A  L+F  H +R+RLDEIKR+E+ERLN LE  +E +  L+A   K      +  L+S+   +  + HLDH+  HTFE++DL+KLI +V  D+ Q+D+ +E +++ +EM KEH ++ +L  IKD   R+  E+QM+    RH+ H +VH+PGS EQLKE W+K D +D   F+PKAFF LHD+NGDGH+D+NEIE+L   EL KVY   N++  D  E+ HEM RMR  ++  +DKNKD +VS +EF  +  +    +D E KT EE D  KP++E E + FE
Sbjct:   45 DVSYRQYLSEVISAMESDKEFANRLR---SMNDSDEMANQLEFASHSVRNRLDEIKRQEVERLNELEKALEDKLALKANPGKASRAKFRFGLQSLDEATIKRAHLDHSKPHTFEIADLQKLINQVTQDIDQVDQAREAEYKRYEMGKEHSRRARLRRIKDKKAREAAEQQMRAERERHRRHERVHQPGSREQLKEAWEKGDRMDRDSFDPKAFFMLHDINGDGHMDVNEIEALFWKELDKVYSKENDTTVDRVERQHEMERMRRAVLMRLDKNKDRMVSWEEFNAWISSQEANKDEEWKTAEESDEDKPFNEEELRQFE 360          
BLAST of Nucleobindin-2 vs. TrEMBL
Match: A0A267FYX5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009833g1 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.024e-64
Identity = 148/352 (42.05%), Postives = 214/352 (60.80%), Query Frame = 3
Query:  279 IYLCQHLCFKINVLK----------------F*NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKE-----HLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVY-EANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
            ++ C   CF   V+K                  + L Y  Y+ E+ + LES+K FA+R+   Q  +    +A  L+FV H +R+RLDEIKR+E++RLN LE  +E ++  A         P    V + D+E     HLDH N H+FE SDLEKLI++V  D+ ++D+ +++Q++ +EM KEHL+ +KL  I D   R+  E++ +E + +HK H K+H PGS EQL++ W   DH+D   FNPK FF LHDVNGDGHLD+NEIE+L   EL K Y   N++  +  EK HEM RMR E++  +D NKD ++S DEF ++++  +FK+D + KT EED   PY + EFK FE
Sbjct:   15 LFCCLTGCFAPPVVKKPAPTVVAKKPGPADDLLSHLPYANYVREVSQILESNKEFAKRV---QNLSEAGDLASQLEFVDHSVRTRLDEIKRKEVDRLNALEKMLEAKKAAAGNPMREAEVPIHPDVFNMDQETIKKAHLDHENPHSFESSDLEKLIRQVVSDMHRVDEAKQEQYKQYEMMKEHLRLRKLHKINDTKAREVAEKEYQEEKKKHKQHEKIHHPGSSEQLRDAWADEDHMDKDSFNPKTFFLLHDVNGDGHLDVNEIEALFLKELEKAYNRTNDTTVNALEKQHEMERMRQEVLDKVDTNKDMMISWDEFERWTKNPDFKKDDDWKTSEEDDAPPYKDDEFKQFE 363          
BLAST of Nucleobindin-2 vs. Ensembl Cavefish
Match: nucb1 (nucleobindin-2-like [Source:NCBI gene;Acc:103046537])

HSP 1 Score: 176.022 bits (445), Expect = 6.489e-49
Identity = 126/315 (40.00%), Postives = 196/315 (62.22%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y  YL E+I+ LE+D +F E+++ A   + +   +++ L  V H +R+RLDE+KR+E+ RL +L        L+AK         ++  V    + EHLD +N +TFE  DLE LI     DL   D E+ ++F+ +EM KEH +++ L+++ D  +R++ E+++++   +H+ H KV+ PGS +QL+EVW++ D LDP+EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N +DDM E   E +RMR  +MK +D N+D LVS +EF++ ++   F    E +T  +D Q  Y+E+E + FE
Sbjct:   45 TGLYYDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRLRML--------LKAKLDSTNTQSVQMDHVSLLKQFEHLDPHNQNTFEAKDLELLIAAATKDLENYDAERHEEFKRYEMLKEHERREYLKSL-DQEKREREEKRIEDLREKHRQHPKVNAPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNGDGLLDEQELEALFTKELEKVYDPKNEEDDMMEMEEERLRMREHVMKNVDLNRDRLVSLEEFIKSTEKKEFNNAKEWETL-DDKQPVYTEAELQRFE 349          
BLAST of Nucleobindin-2 vs. Ensembl Cavefish
Match: nucb1 (nucleobindin-2-like [Source:NCBI gene;Acc:103046537])

HSP 1 Score: 152.525 bits (384), Expect = 1.375e-40
Identity = 98/244 (40.16%), Postives = 153/244 (62.70%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANN 1055
              L+Y  YL E+I+ LE+D +F E+++ A   + +   +++ L  V H +R+RLDE+KR+E+ RL +L        L+AK         ++  V    + EHLD +N +TFE  DLE LI     DL   D E+ ++F+ +EM KEH +++ L+++ D  +R++ E+++++   +H+ H KV+ PGS +QL+EVW++ D LDP+EFNPK FF LHD NGDG LD  E+E+L   EL KVY+  N
Sbjct:   45 TGLYYDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRLRML--------LKAKLDSTNTQSVQMDHVSLLKQFEHLDPHNQNTFEAKDLELLIAAATKDLENYDAERHEEFKRYEMLKEHERREYLKSL-DQEKREREEKRIEDLREKHRQHPKVNAPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNGDGLLDEQELEALFTKELEKVYDPKN 279          
BLAST of Nucleobindin-2 vs. Ensembl Cavefish
Match: nucb2a (nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-14])

HSP 1 Score: 104.375 bits (259), Expect = 1.111e-23
Identity = 101/303 (33.33%), Postives = 153/303 (50.50%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVL---ENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEED 1226
              LHY  YL E+I  LE D++F E++ +    + +   +A+ L FV H +R++LDE+KR+E+ RL  L   + ++E    E  G  V          +    E+L+H N HTFE+ DL++LIK    DL   DKE+ ++F+ +EM KEH +++ L+T+ D   RKK EE  +E + +H +H KV+ P                    F  K  + L                    EL K+Y+  N +DDM E   E +RMR  +M  +D NKD LVS DEFL  ++   F E    +T E++
Sbjct:   49 TGLHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRTKLDELKRQEVSRLRTLIKAKQDVE----EGNGMAVD------HQALLKQFEYLNHMNPHTFEVEDLDRLIKSATSDLENFDKERHEEFKKYEMMKEHERREHLKTL-DEEGRKKEEEHYEEMKKKHADHPKVNHPVR------------------FILKLIYTL-------------------TELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDANKDRLVSLDEFLTATKKKEFLEPDSWETLEQN 303          
BLAST of Nucleobindin-2 vs. Ensembl Sea Lamprey
Match: nucb2b (nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4775])

HSP 1 Score: 121.324 bits (303), Expect = 1.628e-31
Identity = 85/214 (39.72%), Postives = 135/214 (63.08%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLH 968
              L+Y  YL E+I  LE D +F ++++ A   + +   +++ L FV H +RS+LDE+KR+E+ RL +L   I+ +   A+G  +      L        EHLDHNN H+FE  DLEKLIK    DL   D  + ++F+ +EM KEH +++ L+T+ D   R++ E++  + + +HK+H KV+ PGS++QL+EVW+++D LDP++F PK FF LH
Sbjct:   56 TGLYYDRYLREVIDVLEKDTHFKQKLETADIEDIKNGRLSKELDFVSHHVRSKLDELKRQEVARLRML---IKAKMDAAQGKDLRMDHQSLLKQF----EHLDHNNPHSFEPQDLEKLIKTATKDLENYDAARHEEFKRYEMLKEHERREFLKTL-DEERRQEEEKRFLDMKQKHKDHPKVNHPGSKDQLQEVWEESDGLDPEQFEPKTFFKLH 261          
BLAST of Nucleobindin-2 vs. Ensembl Nematostella
Match: EDO43098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZI2])

HSP 1 Score: 169.474 bits (428), Expect = 1.219e-47
Identity = 119/317 (37.54%), Postives = 194/317 (61.20%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIE--RRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSK-VHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
            +D  Y  YL ++I+ LE D+++  ++ +A   + R+  IA+ +  V H +RS+LDE+KR+E+ER  ++  ++      ++ + Y  P           FD E     N   F   D +KL+ K  +++ + D+E+ ++F+ HEM+KEH +K K++ + D   RK+ EE  +E + +H N SK +H PGS+ QL++VW+++D LD K+F+PK FF LHDVNGDG LD  E+E+L   E++K+Y   + D D +E+  E+ RMR  +M  IDK+KD  VS+DEFLQ S+   F +D   K+ E+  ++PY++ E   FE
Sbjct:   40 DDPEYARYLRQVIEILEKDEDYVRKLMNASDDDLRSGRIAEDIDLVKHDVRSKLDELKRQEVERQRMIRRQMNDHLNGIKEREYWNP----------LFDDE-----NPDFFGADDFKKLLWKHHEEMDKQDRERREEFKKHEMQKEHERKIKMKDM-DEKHRKEAEEHFRELQEKHHNQSKQLHHPGSKAQLEQVWEESDGLDAKDFDPKTFFKLHDVNGDGFLDTGELEALFVKEVTKLYNPKDEDYDPKERDEEISRMREHVMNEIDKDKDGFVSQDEFLQSSKGEEFDKDDGWKSVED--ERPYTDEELAEFE 338          
BLAST of Nucleobindin-2 vs. Ensembl Medaka
Match: nucb2a (nucleobindin-2 [Source:NCBI gene;Acc:101163155])

HSP 1 Score: 192.586 bits (488), Expect = 9.357e-55
Identity = 131/312 (41.99%), Postives = 194/312 (62.18%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
            LHY  YL E+I  LE D++F E++ +    + +   +A+ L FV H +R++LDE+KR+E+ RL  L   I+ ++    G  +      L        E+L+H N HTFE+ DL++LIK    DL   DKE+ ++F+ +EM KEH +++ L+T+ D  ERKK EE  +E   +H +H KV+ PGSE QLKEVW++ D LDP++F+PK FF+LHD NGDG  D  E+E+L   EL K+Y+  N +DDM E   E +RMR  +M  +D NKD LVS DEFL  ++   F E    +T E++  + Y+++E + FE
Sbjct:   61 LHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGKLAKELDFVSHHVRTKLDELKRQEVNRLRTL---IKAKQDIEGGNDIAVDHQALLKQF----EYLNHMNPHTFEVEDLDRLIKSATKDLENYDKERHEEFKRYEMMKEHDRREHLKTLND-EERKKEEEHYEEMRKKHADHPKVNHPGSENQLKEVWEEADGLDPEDFDPKTFFNLHDTNGDGFFDEQELEALFTKELEKIYDPTNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVSMDEFLVATKKKEFLEPDSWETLEQN--QAYTDAEMREFE 362          
BLAST of Nucleobindin-2 vs. Ensembl Medaka
Match: NUCB2 (nucleobindin 2 [Source:NCBI gene;Acc:101162363])

HSP 1 Score: 186.037 bits (471), Expect = 2.474e-53
Identity = 128/313 (40.89%), Postives = 195/313 (62.30%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKP-YSESEFKNFE 1268
            LHY  YL E+I+ LE D +F E++K+A   + +   +++ L FV H  RS+LDE+KR EI RL +L     + + + + +        LK       EHL+H N HTFE+ DL++LI+    DL   DKE+  +F+ +E+ KEH ++++L+ + + + RKK E+  +E + +H NH KV+ PGSE+QLKEVW + D LDP++F+PK FF +HD NGDG  D +E+E+L   EL KVY  +N +DDM E   E +RM+  +M  +D NKD LVS  EF+  ++  +F E  E +T +   Q P Y+E E +++E
Sbjct:   50 LHYDRYLREVIEYLEKDPHFREKLKNADMDDIKQGKLSKELNFVQHNFRSKLDELKREEINRLRMLI----KAKHDTEEHNAMDHQTLLKQF-----EHLNHMNPHTFEVDDLDRLIQSATKDLENFDKERHDEFKKYELLKEHERRERLKGMSEED-RKKAEQHYEEMKKKHANHPKVNHPGSEDQLKEVWQETDGLDPQDFDPKTFFKMHDSNGDGFFDESELEALFTKELEKVYNPDNEEDDMVEMEEERLRMKEHVMNEVDTNKDRLVSFSEFMAATKKEDFAEKDEWETLD---QNPIYTEEELRDYE 349          
BLAST of Nucleobindin-2 vs. Ensembl Medaka
Match: nucb1 (nucleobindin-2 [Source:NCBI gene;Acc:101169036])

HSP 1 Score: 170.629 bits (431), Expect = 4.597e-47
Identity = 125/315 (39.68%), Postives = 191/315 (60.63%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHN-RTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDK-EHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFE 1268
              L+Y  YL E+I+ LE+D +F E+++ A   + +   +++ L  V H +R+RLDE+KR+E+ RL +L        L+AK         ++       + EHLD +N +TFE  DLE LI     DL   D E+ ++F+ +EM KEH +++ L+++ D  +R+K E++++E + +H+ H KV+ PGS +QL+EVW++ D LDP+EFNPK FF LHD N DG LD  E+E+L   EL KVY   N +DDM E   E +RMR  +MK +D N+D LV+ +EFL+ ++   F      +T   D Q  Y+E E + FE
Sbjct:   43 TGLYYDRYLREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEVSRLRML--------LKAKLDSTNTQSLQMDHASLLKQFEHLDPHNQNTFEAKDLELLISAATKDLENYDAERHEEFKRYEMLKEHERREYLKSL-DQEKREKEEKRIQELKEKHRQHPKVNAPGSVDQLREVWEETDGLDPQEFNPKTFFKLHDTNEDGVLDEQELEALFTKELEKVYNPKNEEDDMMEMEEERLRMREHVMKNVDTNRDRLVTLEEFLKSTERKEFNNAKGWETL--DSQPVYTEEELQRFE 346          
BLAST of Nucleobindin-2 vs. Planmine SMEST
Match: SMESG000000846.1 (SMESG000000846.1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 381/381 (100.00%), Postives = 381/381 (100.00%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFEXXXXXXXXXXXXXXXXXXXXXRHIPKQDKNFPVPPSDPNEIKKNEEHKLPPVQSDLKAPNQNAPPPKL 1472
            NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSHEMKKEHLKKKKLETIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFEDDYNMNDLDEDDDFSDQEDSLRHIPKQDKNFPVPPSDPNEIKKNEEHKLPPVQSDLKAPNQNAPPPKL
Sbjct:   52 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSHEMKKEHLKKKKLETIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFEDDYNMNDLDEDDDFSDQEDSLRHIPKQDKNFPVPPSDPNEIKKNEEHKLPPVQSDLKAPNQNAPPPKL 432          

HSP 2 Score: 82.8037 bits (203), Expect = 1.127e-16
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 1
Query:  115 YNIYAAPVRKGEVKSEESNLFKGVFRISQTTNYSLNPS 228
            YNIYAAPVRKGEVKSEESNLFKGVFRISQTTNYSLNPS
Sbjct:   14 YNIYAAPVRKGEVKSEESNLFKGVFRISQTTNYSLNPS 51          
BLAST of Nucleobindin-2 vs. Planmine SMEST
Match: SMESG000000846.1 (SMESG000000846.1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 381/381 (100.00%), Postives = 381/381 (100.00%), Query Frame = 3
Query:  330 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFEXXXXXXXXXXXXXXXXXXXXXRHIPKQDKNFPVPPSDPNEIKKNEEHKLPPVQSDLKAPNQNAPPPKL 1472
            NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSHEMKKEHLKKKKLETIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFEDDYNMNDLDEDDDFSDQEDSLRHIPKQDKNFPVPPSDPNEIKKNEEHKLPPVQSDLKAPNQNAPPPKL
Sbjct:   35 NDLHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSHEMKKEHLKKKKLETIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNFEDDYNMNDLDEDDDFSDQEDSLRHIPKQDKNFPVPPSDPNEIKKNEEHKLPPVQSDLKAPNQNAPPPKL 415          
BLAST of Nucleobindin-2 vs. Planmine SMEST
Match: SMESG000013792.1 (SMESG000013792.1)

HSP 1 Score: 211.846 bits (538), Expect = 1.029e-63
Identity = 128/310 (41.29%), Postives = 188/310 (60.65%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNF 1265
            + Y  YL ++I  LE+D  F ++I+     +    +      V H +R++LDEIKR E+ RLN +E  +E+ +  +             S+   DK+H++ +N   FE  DL +LI K  +  +++D + E++++ ++M+KE  +K +L  IK    R K       SE RHK+H  +H PG+EEQLKEVW+K D LDP  FNP  FF LHD N DGHLDI EIE++MQ EL+KVYE NNSDDD+ E Y+EM+RMR E+ K  D N D ++S  EF++++++  FK D + K Q+E  Q  YS  EF+ F
Sbjct:   23 VEYGNYLKQVIDVLETDPEFKKKIESLGNDSDIMSVVNHFDLVSHHVRTKLDEIKRIELNRLNKMEARLEKLQKSSNF-----------SLSRIDKDHINIHNDLKFEEEDLRRLISKTVEIANKLDAKAEEEYRRYQMEKEIKRKLRLSKIKSKEMRDKQRLLDAASEKRHKSHPAIHYPGTEEQLKEVWEKEDKLDPNSFNPVTFFRLHDTNEDGHLDIAEIEAIMQIELNKVYEVNNSDDDIVEMYNEMLRMRKEVFKEADTNNDRMISFPEFIRWTKSDKFKTDEDWKIQDELNQTIYSPEEFEKF 321          
BLAST of Nucleobindin-2 vs. Planmine SMEST
Match: SMESG000013792.1 (SMESG000013792.1)

HSP 1 Score: 211.846 bits (538), Expect = 1.553e-63
Identity = 128/310 (41.29%), Postives = 188/310 (60.65%), Query Frame = 3
Query:  336 LHYKEYLDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIERRRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFKNF 1265
            + Y  YL ++I  LE+D  F ++I+     +    +      V H +R++LDEIKR E+ RLN +E  +E+ +  +             S+   DK+H++ +N   FE  DL +LI K  +  +++D + E++++ ++M+KE  +K +L  IK    R K       SE RHK+H  +H PG+EEQLKEVW+K D LDP  FNP  FF LHD N DGHLDI EIE++MQ EL+KVYE NNSDDD+ E Y+EM+RMR E+ K  D N D ++S  EF++++++  FK D + K Q+E  Q  YS  EF+ F
Sbjct:   39 VEYGNYLKQVIDVLETDPEFKKKIESLGNDSDIMSVVNHFDLVSHHVRTKLDEIKRIELNRLNKMEARLEKLQKSSNF-----------SLSRIDKDHINIHNDLKFEEEDLRRLISKTVEIANKLDAKAEEEYRRYQMEKEIKRKLRLSKIKSKEMRDKQRLLDAASEKRHKSHPAIHYPGTEEQLKEVWEKEDKLDPNSFNPVTFFRLHDTNEDGHLDIAEIEAIMQIELNKVYEVNNSDDDIVEMYNEMLRMRKEVFKEADTNNDRMISFPEFIRWTKSDKFKTDEDWKIQDELNQTIYSPEEFEKF 337          
BLAST of Nucleobindin-2 vs. Planmine SMEST
Match: SMESG000017142.1 (SMESG000017142.1)

HSP 1 Score: 189.119 bits (479), Expect = 1.760e-55
Identity = 120/300 (40.00%), Postives = 183/300 (61.00%), Query Frame = 3
Query:  354 LDEIIKELESDKNFAERIKDAQAHNRTEHIAQSLQFVHHRIRSRLDEIKRREIERLNVLENEIER---RRLEAKGYKVPPPDPKLKSVISFDKEHLDHNNVHTFEMSDLEKLIKKVEDDLSQIDKEQEKQFQSXXXXXXXXXXXXXXTIKDPNERKKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFFDLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLEMMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYS 1244
            +  ++ EL +D  F  ++ D +     E    +L F     R++LDEIKRREIERLN+ + E++R   R L    Y+    D  ++S+   D  H+   +   F   D EKLI +++ DL  +D+ +EK+++ HE KK+   KKKLE  KDP+ + K  E++K++    +NH  ++ PGSEEQLKE+W  +D LD   FN K FF+LHD+N DGH DI E+ES++  E+ K+YEA N   D +EKYHE+M+MR   M+ +D +KD +V+ +E+L++S+   FK + E K  EE   + YS
Sbjct:    1 MQSVMTELGTDIEFQNKVLDKKGSMSNEDYVGALNFASSSARNKLDEIKRREIERLNLAKLELKRTLKRNLNINKYE---RDKLIRSLTVDDNNHIHSTDNEKFTKEDFEKLISQIQHDLRLVDQAREKEYRRHEWKKDLEIKKKLENEKDPDVKSKRLEELKKARKTPRNHKPLNEPGSEEQLKELWRTDDKLDESYFNLKTFFNLHDINQDGHWDIEEVESMLIPEVLKIYEAGNQTGDPEEKYHEIMKMRKHFMEKMDTDKDEIVTYEEYLEFSKKKEFKINKEWKVTEEQDNEIYS 297          
The following BLAST results are available for this feature:
BLAST of Nucleobindin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUCB12.386e-5241.84nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043][more]
NUCB12.386e-5241.84nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043][more]
NUCB11.191e-4840.14nucleobindin 1 [Source:HGNC Symbol;Acc:HGNC:8043][more]
NUCB26.072e-4639.68nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044][more]
NUCB26.325e-4639.68nucleobindin 2 [Source:HGNC Symbol;Acc:HGNC:8044][more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nucb-13.410e-4538.17NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc... [more]
nucb-14.958e-4538.17NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc... [more]
nucb-14.958e-4538.17NUCleoBindin homolog [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NUCB19.608e-5239.50gene:FBgn0052190 transcript:FBtr0075171[more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nucb2a5.476e-5242.57nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
nucb2a5.476e-5242.57nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
nucb2a8.497e-5242.57nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
nucb11.652e-5040.45nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-22... [more]
nucb11.652e-5040.45nucleobindin 1 [Source:ZFIN;Acc:ZDB-GENE-060825-22... [more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nucb18.612e-5440.48nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb11.380e-5240.95nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb11.406e-5240.81nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb11.907e-5240.81nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
nucb11.907e-5240.81nucleobindin 1 [Source:NCBI gene;Acc:407884][more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nucb11.532e-5342.18nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388][more]
Nucb11.872e-5342.18nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388][more]
Nucb21.917e-4939.37nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179][more]
Nucb22.169e-4939.37nucleobindin 2 [Source:MGI Symbol;Acc:MGI:1858179][more]
Nucb17.677e-3145.66nucleobindin 1 [Source:MGI Symbol;Acc:MGI:97388][more]
back to top
BLAST of Nucleobindin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0P569|NUCB1_BOVIN3.891e-5742.05Nucleobindin-1 OS=Bos taurus OX=9913 GN=NUCB1 PE=1... [more]
sp|Q63083|NUCB1_RAT3.382e-5342.52Nucleobindin-1 OS=Rattus norvegicus OX=10116 GN=Nu... [more]
sp|Q02819|NUCB1_MOUSE1.310e-5242.18Nucleobindin-1 OS=Mus musculus OX=10090 GN=Nucb1 P... [more]
sp|Q02818|NUCB1_HUMAN1.146e-5141.84Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE... [more]
sp|Q5R4U1|NUCB1_PONAB1.595e-5141.84Nucleobindin-1 OS=Pongo abelii OX=9601 GN=NUCB1 PE... [more]
back to top
BLAST of Nucleobindin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G7U27.907e-6842.62Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DJS51.159e-6745.14Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8J7191.167e-6745.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G6569.888e-6744.83Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FYX52.024e-6442.05Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nucb16.489e-4940.00nucleobindin-2-like [Source:NCBI gene;Acc:10304653... [more]
nucb11.375e-4040.16nucleobindin-2-like [Source:NCBI gene;Acc:10304653... [more]
nucb2a1.111e-2333.33nucleobindin 2a [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nucb2b1.628e-3139.72nucleobindin 2b [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleobindin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430981.219e-4737.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleobindin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nucb2a9.357e-5541.99nucleobindin-2 [Source:NCBI gene;Acc:101163155][more]
NUCB22.474e-5340.89nucleobindin 2 [Source:NCBI gene;Acc:101162363][more]
nucb14.597e-4739.68nucleobindin-2 [Source:NCBI gene;Acc:101169036][more]
back to top
BLAST of Nucleobindin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000846.11.127e-16100.00SMESG000000846.1[more]
SMESG000000846.10.000e+0100.00SMESG000000846.1[more]
SMESG000013792.11.029e-6341.29SMESG000013792.1[more]
SMESG000013792.11.553e-6341.29SMESG000013792.1[more]
SMESG000017142.11.760e-5540.00SMESG000017142.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010171 ID=SMED30010171|Name=Nucleobindin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1568bp
GTTTATAATAACATCACAATTAATACTTATTTGAAGTTTATTTTAAACTT
AGACGTGTCATTTAAGATTGTCAAAATGTTTTCTATAATCAAAATTTTAC
TTTTATTTTTTATTTATAATATATATGCAGCACCAGTTAGAAAAGGTGAG
GTTAAATCGGAAGAATCCAATCTTTTTAAGGGTGTTTTTAGAATCTCCCA
AACAACTAATTATAGCTTAAACCCTTCGGTAAATAATATTAAAAACGGTG
TTTATATTTAGCTCACATTTTTATTTGAATATATTTATGCCAACATTTGT
GTTTTAAAATTAATGTTTTAAAATTTTAGAATGATCTTCACTATAAAGAG
TATTTAGACGAAATTATTAAAGAACTGGAAAGTGATAAAAATTTTGCTGA
AAGAATTAAAGATGCTCAAGCTCATAATCGGACAGAACATATTGCTCAAA
GCTTACAGTTTGTTCATCATCGAATTCGCAGTAGGCTTGATGAGATTAAA
AGGCGTGAAATCGAACGCTTGAATGTTTTGGAAAACGAAATAGAGAGACG
AAGATTAGAAGCCAAAGGTTACAAAGTGCCTCCACCAGATCCAAAATTGA
AATCAGTTATTTCGTTTGATAAAGAACATTTGGATCATAACAATGTACAT
ACTTTTGAAATGAGTGATTTAGAAAAATTAATTAAAAAAGTTGAAGATGA
TTTATCACAAATTGACAAAGAACAAGAAAAACAATTTCAAAGCCATGAAA
TGAAAAAAGAACATTTAAAAAAGAAAAAATTAGAAACGATCAAAGACCCA
AATGAAAGGAAAAAAGTAGAAGAACAAATGAAAGAATCAGAAATCCGACA
TAAGAATCACAGTAAAGTCCATCGCCCGGGAAGTGAAGAGCAATTAAAAG
AAGTTTGGGATAAAAATGATCATTTAGATCCGAAAGAGTTCAATCCGAAA
GCATTTTTCGATTTACATGATGTTAACGGGGATGGCCATTTGGATATAAA
TGAGATAGAATCTTTAATGCAAAATGAGTTATCTAAAGTCTACGAAGCTA
ATAATAGTGATGATGACATGCAGGAAAAATATCATGAAATGATGAGAATG
CGCTTAGAAATGATGAAAGTTATAGATAAAAATAAAGATAATTTAGTTTC
CAAAGATGAATTTCTACAATATTCACAAACAACAAATTTCAAAGAAGATC
CAGAATTGAAAACACAAGAAGAAGACGGTCAGAAACCGTATTCAGAAAGT
GAATTTAAGAATTTTGAAGATGATTATAATATGAATGATTTGGACGAGGA
CGATGATTTTTCGGATCAAGAAGACTCTCTGAGACATATTCCAAAGCAAG
ATAAAAACTTTCCCGTTCCTCCTTCAGATCCTAATGAAATCAAAAAGAAT
GAAGAGCATAAACTCCCGCCAGTCCAATCTGATTTAAAAGCGCCAAATCA
AAATGCTCCTCCACCGAAATTATGATAAAATAAACATTTTAAGAATGTCT
TATTTATTATTAATTTATAAAATCAATATTTGTAATATTTTATGATAATA
TATATATGATATATTTGT
back to top

protein sequence of SMED30010171-orf-1

>SMED30010171-orf-1 ID=SMED30010171-orf-1|Name=SMED30010171-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MSDLEKLIKKVEDDLSQIDKEQEKQFQSHEMKKEHLKKKKLETIKDPNER
KKVEEQMKESEIRHKNHSKVHRPGSEEQLKEVWDKNDHLDPKEFNPKAFF
DLHDVNGDGHLDINEIESLMQNELSKVYEANNSDDDMQEKYHEMMRMRLE
MMKVIDKNKDNLVSKDEFLQYSQTTNFKEDPELKTQEEDGQKPYSESEFK
NFEDDYNMNDLDEDDDFSDQEDSLRHIPKQDKNFPVPPSDPNEIKKNEEH
KLPPVQSDLKAPNQNAPPPKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR040250Nucleobindin
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..24
NoneNo IPR availableCOILSCoilCoilcoord: 50..70
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 75..177
e-value: 1.5E-27
score: 97.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 173..271
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 180..206
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..77
IPR002048EF-hand domainSMARTSM00054efh_1coord: 147..175
e-value: 1.4
score: 16.6
coord: 95..123
e-value: 3.4
score: 13.4
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 99..172
e-value: 1.4E-9
score: 38.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 91..126
score: 11.054
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 143..178
score: 9.464
IPR040250NucleobindinPANTHERPTHR19237NUCLEOBINDINcoord: 2..230
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 156..168
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 104..116
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 80..173