Cyclic nucleotide gated channel alpha 3

Overview
NameCyclic nucleotide gated channel alpha 3
Smed IDSMED30010168
Length (bp)2298
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic nucleotide gated channel alpha 3 (SMED30010168) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel alpha 3 (SMED30010168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic nucleotide gated channel alpha 3 (SMED30010168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel alpha 3 (SMED30010168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010168h1SMcG0004190 SmedASXL_015383SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010168h1SMcG0004190 SmedASXL_015384SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30010168h1SMcG0004190 dd_Smed_v4_12825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010168h1SMcG0004190 dd_Smed_v4_12825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010168h1SMcG0004190 dd_Smed_v4_12825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010168h1SMcG0004190 dd_Smed_v6_12825_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010168h1SMcG0004190 OX_Smed_1.0.22394ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 509.22 bits (1310), Expect = 5.877e-171
Identity = 270/525 (51.43%), Postives = 378/525 (72.00%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            VVD SS  YY W+  + L V +N  +L  RA F   Q +Y  LW V DY  D   V+D+++ +R  FLEQGL+V + NRL ++Y +  +FK+D+++++P +L  L +     +Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         I+IP      +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIGKEMYI+  GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  142 VVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKV---GTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP--------NISIP---EHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 651          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 508.449 bits (1308), Expect = 2.275e-170
Identity = 270/525 (51.43%), Postives = 378/525 (72.00%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            VVD SS  YY W+  + L V +N  +L  RA F   Q +Y  LW V DY  D   V+D+++ +R  FLEQGL+V + NRL ++Y +  +FK+D+++++P +L  L +     +Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         I+IP      +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIGKEMYI+  GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  160 VVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKV---GTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP--------NISIP---EHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 669          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 493.426 bits (1269), Expect = 1.252e-164
Identity = 261/524 (49.81%), Postives = 377/524 (71.95%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 2224
            V+D S   YYNW+  +TL V++N  ++  RA F   Q  Y   W + DY+ D   +ID+ + +R  +LEQGLLVKE  +L   Y S ++FK+D+++++P +L    L     +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C F+ IS +IG G+D +VYP             + +P + +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE+EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  157 VIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKL---GWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPD------------INDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 493.426 bits (1269), Expect = 1.252e-164
Identity = 261/524 (49.81%), Postives = 377/524 (71.95%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 2224
            V+D S   YYNW+  +TL V++N  ++  RA F   Q  Y   W + DY+ D   +ID+ + +R  +LEQGLLVKE  +L   Y S ++FK+D+++++P +L    L     +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C F+ IS +IG G+D +VYP             + +P + +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE+EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  157 VIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKL---GWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPD------------INDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 493.426 bits (1269), Expect = 1.252e-164
Identity = 261/524 (49.81%), Postives = 377/524 (71.95%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 2224
            V+D S   YYNW+  +TL V++N  ++  RA F   Q  Y   W + DY+ D   +ID+ + +R  +LEQGLLVKE  +L   Y S ++FK+D+++++P +L    L     +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C F+ IS +IG G+D +VYP             + +P + +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE+EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  157 VIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKL---GWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPD------------INDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-4 (Cyclic nucleotide-gated cation channel [Source:UniProtKB/Swiss-Prot;Acc:Q03611])

HSP 1 Score: 460.685 bits (1184), Expect = 8.089e-152
Identity = 271/618 (43.85%), Postives = 389/618 (62.94%), Query Frame = 2
Query:  584 GNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAF---VIPQRK---------------------------------------------YRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIE-LFSLILPHRNIDYVW-----YRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*EKHFSQFTVI 2275
            G+   +PP K     R+  +   +  D S+  +Y W  V+T+  ++N+L +  R  F   + P  +                                             +R LW  FD ++D   +ID  +N R  +++QGL+V+E  ++ K Y    +++ID I+++P++ +    +P+ N    W      R NRL +  ++   + RT+TR++ PN FR+  ++ +++IIIHWN C +F+IS  IGLG+D +VY    +    ++   +T   D     Y+Y+F+WSTL LTTI EVP PV N E+  +T++L+ GVLIFA+IVGNVGSMISN++A +T+FQ KMDG+K+YME R VSK+LE R+I WFDYLW NKQSL +++VL  LPDKL+AEIA+ VH+ET+R V +FQDCE  LL +L+LKL+LQVFSPGD+IC+KGDIG+EMYIVKRG+L VV +DG KVFVTL EGSVFGELSILNI GSK+GNRRTANVRSVGY+DLF L+K DLW+ L EYPDA+  L+ +G+EIL KDNL+D    EN       +E I   + +++K   +++++LI +    HSS + KL K  + +     EKH S++  +
Sbjct:   89 GSAIEVPPPKESYAVRIRKYLANYTQDPSTDNFYYWTCVVTVAYIYNLLFVIARQVFNDLIGPSSQSLCRFYNGTLNSTTQVECTYNMLTNMKEMPTYSQYPDLGWSKYWHFRMLWVFFDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKVTKAYWQSKQYRIDGISLIPLDYILGWPIPYIN----WRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIIIHWNACLYFWISEWIGLGTDAWVY---GHLNKQSLPDDIT---DTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGVLIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIAMQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGSVFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLD----ENAPEEQKTVEEIAEHLNNAVKVLQTRMARLIVE----HSSTEGKLMKRIEML-----EKHLSRYKAL 683          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-1 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:A8WI01])

HSP 1 Score: 319.316 bits (817), Expect = 1.833e-98
Identity = 217/580 (37.41%), Postives = 326/580 (56.21%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAF--VIP-QRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGS----------DGFVYPPRS-------------NSTDMTIA-IPVTE----------PWDQ---------FPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQS-LDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNG-MENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*E 2248
            F VD  S  +Y W G+++L  L + LV    + F  V P  R    L  + D      N++D+I ++R  ++E G+ VK +++L  + +    F +D+IA++P E   +        + W R NRLTK Y+LF+F  +TDTRT  P+ F +  LI   ++I HWNGC +F+IS      +          D  + P  +             ++ D+ I  +P  E           W+          F   Y  +F+WS LTL T+ E P P   F+      + L G++IFA IVG+VG+M+  +N  K++F+  +DG KR+M +R V   L K+ + +F Y+W +  + +DEEE+   LP +L  EIA+ +H +T++ V +F+ C+  LL +LILKL+L+V+SP DYIC+KGD+G EMYIVK G + VV+EDG  +FVTL  G VFGELSILNIPG+K+ N RTA+VRS GYSDL+ L+K+DLW+ L EYP AK  LIQ+G +IL KD +ID    ++   + NG +E+ +  +E  I      I Q  +    ++  MK +L  +E  +   I E
Sbjct:   71 FTVDEHSNTFYLWTGLVSLVAL-HPLVFTALSVFQDVHPFLRNTGPLNLLLD----LVNILDLIAHTRIEYVENGVAVKNLSKLMHHRLKSTFFILDVIAVVPAESLHIF----GDSFFWSRINRLTKCYRLFDFSTQTDTRTTSPHAFGLFKLIFICVVIFHWNGCLYFYISKVYNYTTARLEHWIFSYDKIINPILATCVTDIPNHRDFCDTDDLLITHLPENEVQFTVTDYMTTWENKTTTIKFANFFRQYALSFYWSALTLVTLGEQPSPCTTFQNAFEIGDTLLGLVIFAVIVGDVGNMVVAINLRKSEFENVLDGCKRFMVYRKVPNLLRKKAVEYFAYVWAHGGAQVDEEEIAEFLPPRLFGEIAVEIHMDTLKKVKLFESCDPRLLYELILKLQLRVYSPMDYICKKGDVGTEMYIVKEGFVEVVSEDGQTIFVTLPAGFVFGELSILNIPGNKNKNLRTASVRSKGYSDLYVLDKEDLWEALHEYPQAKDSLIQKGIQILEKDKMIDPNMVDDEDESFNGPIEDYMEHLEHEILKITKMIDQAEDKIHKSNQKMKTRLFGMEMDLVHEIKE 641          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-2 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:Q9N4C1])

HSP 1 Score: 275.018 bits (702), Expect = 1.894e-80
Identity = 179/574 (31.18%), Postives = 305/574 (53.14%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSD-----GF----VYPPRSNSTDMTIAIPVTEP----------------------WDQ---------FPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMEN-----------IINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 2221
            F V  +S F+Y W  ++++ +L+N+  + V   F      Y + W   +   D   ++D ++ SR  F+ +G  V + +++ KNY      K+DL+ + P + +  I    ++     R  RL K Y+L+EFI  T  RT+FP+  +I  L     I+ HWN C +F  S   GL  D     GF    V+ PR +  D         P                      WD+         F   Y    +WS+LT+T   + P P  + +  +   + L GVL+FA+I+G VGS+++ ++    DF+  MDG+K YM++RGV   ++ R++N F YL  + Q  DEEE+LS LP   +A IA ++H +T+  VS+F  C+Q LL ++++ +K QV+SP DY+CRK +  KEM+IVK+G L V+ +D      +L EG  FGELSI+ + G+  G+RR+ ++RSVGYSD++ L++DD+  +L EYP+ +++L++  + +L    L++      +   D+G+++            +N++E+ I   D+ ++ +I  F     + K +++ +E
Sbjct:  222 FYVTENSTFFYYWTAIISIGILYNMFAM-VIFIFDDVHFGYFNQWLYVNLFFDFCFLLDCLVGSRMTFVSEGNEVSQTDKMFKNYRQSRRCKLDLLCLAPADFYLFIDTKASL----VRAIRLVKAYRLYEFIMLTQRRTDFPHFMKILFLTSSCAILFHWNACVYFLFSLYQGLTEDDPNAFGFSYYKVFDPRFSICDALYDQDCYYPEDTEVLDIRDERPHYMEDMYKFWDKKFNILQIGNFSREYSMTIYWSSLTITKCGQQPWPSKSSQNSLEIFDTLIGVLVFATIIGGVGSVVTQMSQNVNDFREMMDGIKFYMKYRGVQSAIQDRVLNCFLYLNSHNQLYDEEEILSLLPPFFQARIAANLHQDTLSKVSLFYKCDQRLLQEVVMLVKQQVYSPNDYLCRKNEKAKEMFIVKKGLLAVIDDDTGVELDSLKEGHTFGELSIVQVKGNILGDRRSVSLRSVGYSDVYVLHQDDVTRLLQEYPEERVRLMENARRMLHSRGLLETNELGEMCETDDGLDDEAMLEFLSVDEQLNRLENIIDSIDTDLANMITSFSYNSVAYKKRVTALE 790          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: che-6 (pep chromosome:WBcel235:IV:2104056:2111408:-1 gene:WBGene00000487.1 transcript:C23H5.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:che-6)

HSP 1 Score: 243.047 bits (619), Expect = 4.468e-70
Identity = 170/577 (29.46%), Postives = 303/577 (52.51%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYI-SKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSD-----GFVYP-------PRSNS-----------TDMTIAI---------PVTEPWDQ---------FPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLI------------DLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 2221
            F V  +S +YY W   ++  V++N+  + +   F   + +Y   W   + + D   ++DI + SR  +L +G  VK   +LRKNY   K++   D+  +LP++         ++     R  R+ K+ +L +F+ RT  +T FP  F+I  L +  +++ HWN C +F  S   G+  +     GF Y        P   +            D T+ +          + E W           F   Y  + +WS LT+TT  + P P  + +  +   + L GVL+FA+I+G+VGS+++ ++    +F+  MDG+K YM++R V+  +++R ++ F YL  + Q  DEE +LS LP +L+A IA ++H ET++N+ +F  CE   + +++L +K QVFSP DY+CRK +  KE++IVK+GKL V+ +D  +    L EG+ FGELSI+ + G+  G RR  +++SVG+SD++ L +DD+  +L E+P     ++   + +L    L+            D E +++++L +  +   +N++   I G +  ++ +I  F  + S  K K++ +E
Sbjct:   59 FYVPFNSKYYYIWSFFVSFGVMYNMFAMVI-FIFADIKTQYFWNWIFLNVMFDMVFIVDIFVQSRLTYLHEGEEVKNTKKLRKNYFFQKLKVANDIFCLLPLDFLLFFDDSMSL----VRTIRIVKVIRLMDFVQRTQQQTTFPRAFKIILLAVSCIVLFHWNACLYFLFSLYEGITEESQTEFGFSYYKVFEPVFPTCQAYYDENCWFGEDIDHTLDLDDVRDSYKKEMAEYWKDKHYRWTTGNFSREYSMSIYWSALTITTCGQQPWPSTSSQNSLEVFDTLIGVLVFATIIGSVGSVVTQMSQTVNEFRQMMDGIKFYMKYREVNSAIQERALSCFMYLMAHNQLDDEEGILSLLPPRLQANIAANLHMETLQNIQIFALCESRFMHEVVLLVKQQVFSPNDYLCRKNEKAKELFIVKKGKLRVIDDDTGEEMGELTEGATFGELSIVYVKGNLLGTRRCCSLQSVGFSDIYVLYRDDVSRLLQEFPQEYKTIVMNARNLLHSRGLLETTELGEMCDPSDHEEADDLVLEEMSVVEQLNRLNGIIDGLNGNMNVMILSFSNSCSYYKQKITGLE 630          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-2 (TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2])

HSP 1 Score: 233.032 bits (593), Expect = 1.808e-65
Identity = 159/481 (33.06%), Postives = 256/481 (53.22%), Query Frame = 2
Query:  677 FYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXX-RKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGS-----------DGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAED-GIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENV 2080
            FY  W+ ++TL  LFN   +P+R+++          W++ DY  D   VID+++   R  F   G+ VK     +++Y+    FK+D+++ILP +L         I    +R NR+ KI   +   +  D     P   RI+  + +++ IIH N C ++ +S     G            + +VY  + N+                   Y+  F+++    T+    P P    E+I MT   + GV +FA ++G +  ++SN N  + +FQ KMD      +  G+  E   R+ +WF Y W  +++LDE++++  LP KL+ ++A+ VHY T+  V +FQDC+++LL  L+LKL+  +F PGD IC KGD+GKEMYI+ +G L VV  D   K+F  L +G+VFGE+S+L I G+   NRRTA++R+ GY  LF L K+DL DV+  YP A+  L ++   +L  D   D E +E +
Sbjct:  220 FYMTWLSLVTLCFLFNAFCIPLRSSYPYQTADNWMYWFIVDYSCDLVYVIDMLLIKPRLRFTRGGIQVKIYKDTQRHYLMTRTFKLDILSILPTDLMYFFFGKMPI----WRINRVLKINSFWLLFDMLDNSFANPYAIRIARTLSYMIYIIHCNSCVYYKLSALQAFGQIAYLENGKWYLNKWVYNNQGNA-------------------YIRCFYFTAAVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLALGECKKLGLKMETTNRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKVQLFQDCDRALLRDLVLKLRPVIFLPGDMICLKGDVGKEMYIINQGILQVVGGDHNEKIFAELAQGAVFGEISLLAIGGN---NRRTASIRAKGYCTLFVLAKEDLNDVIRYYPQAQTILRRKAAAMLKNDKKSD-EKTEKI 673          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302924)

HSP 1 Score: 455.677 bits (1171), Expect = 1.372e-150
Identity = 242/533 (45.40%), Postives = 355/533 (66.60%), Query Frame = 2
Query:  650 KFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWY------RFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVY---PPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 2221
            +  VD +   +Y W+ +++L VL+NI+ +  RA F    +   + WY  DY+ D   ++D +++  + FL+QGLLV++  RLR++Y     + +D++++LP +L  +  P      ++       R NRL +I +L+E+ +RT+T T +PN FRI  +++ +L++IHWN C +F IS  IG  SD +VY     R+N+                   Y+Y+F+WSTLTLTTI E P P  + E++ +  + L GVLIFA+IVGN+GSMISN+N  + +FQ +MDGVK+YM FR V  ELE R+I WF Y W    +LDEE VL+ LPDKL+AEIAI VH +T++ V +F D E  LL  L+LKLKLQVFSPGDYICRKGD+GKEMYIVKRGKL+VV +DGI V  TL  GSVFGE+S+L I G+++GNRRTANVRS+GYSDLFCL K DLW+ L++YP+A+  L QRG ++L KD L+D +   +     + +E  I K+E S++  + ++++L+ ++  + + +K +L+K+E
Sbjct:   97 RLSVDPTLQSHYRWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNT---------------LQRQYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302925)

HSP 1 Score: 455.292 bits (1170), Expect = 2.977e-148
Identity = 242/533 (45.40%), Postives = 355/533 (66.60%), Query Frame = 2
Query:  650 KFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWY------RFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVY---PPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 2221
            +  VD +   +Y W+ +++L VL+NI+ +  RA F    +   + WY  DY+ D   ++D +++  + FL+QGLLV++  RLR++Y     + +D++++LP +L  +  P      ++       R NRL +I +L+E+ +RT+T T +PN FRI  +++ +L++IHWN C +F IS  IG  SD +VY     R+N+                   Y+Y+F+WSTLTLTTI E P P  + E++ +  + L GVLIFA+IVGN+GSMISN+N  + +FQ +MDGVK+YM FR V  ELE R+I WF Y W    +LDEE VL+ LPDKL+AEIAI VH +T++ V +F D E  LL  L+LKLKLQVFSPGDYICRKGD+GKEMYIVKRGKL+VV +DGI V  TL  GSVFGE+S+L I G+++GNRRTANVRS+GYSDLFCL K DLW+ L++YP+A+  L QRG ++L KD L+D +   +     + +E  I K+E S++  + ++++L+ ++  + + +K +L+K+E
Sbjct:  272 RLSVDPTLQSHYRWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNT---------------LQRQYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE 789          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299573)

HSP 1 Score: 359.377 bits (921), Expect = 2.239e-110
Identity = 197/454 (43.39%), Postives = 301/454 (66.30%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 2014
            FV D +    Y W  V+++  L+N  V+  R AF    R+  ++W+  DY+ D   +IDI+ + R  +LE G+L  +  +LR +Y++   F ID + +LP++   L +   +I     R  RL KIY+ + F++RT+  TN+PN+FR ++LI +LL+I HWNGC +  I  + G GS  +VY   S S D+                Y+ +++W TL LTTI ++P+P    E++ + ++LL G+++FA+++G+V +++++V+A + +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DEE  +S LPDKL+AEIAI+VH +T++ V +FQ+ E   L +L+L+L+  +FSPGDYICRKG++GKEMYIV RG+L VVA++G  V  +L  GS FGE+SILN+    +GNRRTA+VRSVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  296 FVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSI----LRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD-SESADVV-------------KQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 729          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0330241)

HSP 1 Score: 358.992 bits (920), Expect = 2.178e-108
Identity = 198/456 (43.42%), Postives = 302/456 (66.23%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNI--PGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 2014
            FV D +    Y W  V+++  L+N  V+  R AF    R+  ++W+  DY+ D   +IDI+ + R  +LE G+L  +  +LR +Y++   F ID + +LP++   L +   +I     R  RL KIY+ + F++RT+  TN+PN+FR ++LI +LL+I HWNGC +  I  + G GS  +VY   S S D+                Y+ +++W TL LTTI ++P+P    E++ + ++LL G+++FA+++G+V +++++V+A + +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DEE  +S LPDKL+AEIAI+VH +T++ V +FQ+ E   L +L+L+L+  +FSPGDYICRKG++GKEMYIV RG+L VVA++G  V  +L  GS FGE+SILN+   G + GNRRTA+VRSVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  571 FVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSI----LRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD-SESADVV-------------KQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGKELGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1008          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299572)

HSP 1 Score: 358.221 bits (918), Expect = 4.548e-108
Identity = 197/454 (43.39%), Postives = 301/454 (66.30%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 2014
            FV D +    Y W  V+++  L+N  V+  R AF    R+  ++W+  DY+ D   +IDI+ + R  +LE G+L  +  +LR +Y++   F ID + +LP++   L +   +I     R  RL KIY+ + F++RT+  TN+PN+FR ++LI +LL+I HWNGC +  I  + G GS  +VY   S S D+                Y+ +++W TL LTTI ++P+P    E++ + ++LL G+++FA+++G+V +++++V+A + +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DEE  +S LPDKL+AEIAI+VH +T++ V +FQ+ E   L +L+L+L+  +FSPGDYICRKG++GKEMYIV RG+L VVA++G  V  +L  GS FGE+SILN+    +GNRRTA+VRSVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  571 FVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSI----LRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD-SESADVV-------------KQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1004          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 506.908 bits (1304), Expect = 8.937e-171
Identity = 265/525 (50.48%), Postives = 377/525 (71.81%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            VVD +   YYNW+ V+T  V++N + +  RA F   Q  Y  LW+  DY+ D+  ++D++  +R  +LEQGLLVK+  +LR  Y   ++F++DL +++P ++F L   +  ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++IIIHWN C ++  S +IG GSD FVYP  S+             + +    Y Y+ +WSTLTLTTI E P PV N E+  +  + L GVLIFA+IVGNVGSMI+N NA + DFQ ++D +K+YM FR V+K+LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GS++GNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNL+DLE ++    +   ME  + KI   ++   ++ ++L+ + E A   +K +++K+EK++
Sbjct:  113 VVDPAGNMYYNWLFVITCPVMYNWIFIIARACFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYL---YFGMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPE-----------FGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEKKM 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 504.982 bits (1299), Expect = 6.227e-170
Identity = 264/525 (50.29%), Postives = 376/525 (71.62%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            VVD +   YYNW+ V+T  V++N + +  R+ F   Q  Y  LW+  DY+ D+  ++D++  +R  +LEQGLLVK+  +LR  Y   ++F++DL +++P ++F L   +  ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++IIIHWN C ++  S +IG GSD FVYP            P    + +    Y Y+ +WSTLTLTTI E P PV N E+  +  + L GVLIFA+IVGNVGSMI+N NA + DFQ ++D +K+YM FR V+K+LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GS++GNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNL+DLE ++    +   ME  + KI   ++   ++ ++L+ + E A   +K +++K+EK++
Sbjct:  119 VVDPAGNMYYNWLFVITCPVMYNWIFIIARSCFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYL---YFGMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPD-----------PSDPEFGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEKKM 628          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 489.189 bits (1258), Expect = 4.471e-164
Identity = 264/526 (50.19%), Postives = 377/526 (71.67%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D ++  YY+W+ ++ + V +N+++L  RA F   Q  Y  LW V DY  D    +D  + SR  FLEQGLLV+E  +L ++Y    +FK D+ +++P ++  L + + N +    RFNRL K+ +LFE+ +RT+TRTNFPNIFRIS+L++++LIIIHWNGC FF IS ++G GSD +VYP  S+             + +    Y+Y  +WSTLTLTTI E P PV + E+  +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL D L+EYP+AK  L ++G+ ILMKDNLID EA+ N   +   +E  +N + +++    +K ++L+ D+  + S +K +L+ +E ++
Sbjct:   99 WIMDPATDLYYHWLTIVAIPVFYNLMLLVTRACFNELQDDYTILWMVLDYTSDVIYYLDTFVRSRTGFLEQGLLVRESKKLWEHYKKSPQFKFDIFSMIPTDILMLKVGYNNPEL---RFNRLFKMARLFEYFDRTETRTNFPNIFRISNLVLYILIIIHWNGCIFFAISKTLGFGSDSWVYPNISDP-----------EFGRLGRKYIYCLYWSTLTLTTIGETPPPVRDIEYFFVVSDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVVKWFDYLWTEQKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLVELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMDALSEYPEAKKALEEKGRAILMKDNLID-EAAANAGADAKDLEEKVNLLGTNLDVMQTKFARLMADWTASQSRIKQRLTNMEARV 609          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 488.804 bits (1257), Expect = 5.730e-164
Identity = 264/527 (50.09%), Postives = 379/527 (71.92%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D ++  YY+W+ ++ + V +N+++L  RA F   Q  Y  LW V DY  D    +D  + SR  FLEQGLLV+E  +L ++Y    +FK D+ +++P ++  L + + N +    RFNRL K+ +LFE+ +RT+TRTNFPNIFRIS+L++++LIIIHWNGC FF IS ++G GSD +VYP             +++P + +    Y+Y  +WSTLTLTTI E P PV + E+  +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL D L+EYP+AK  L ++G+ ILMKDNLID EA+ N   +   +E  +N + +++    +K ++L+ D+  + S +K +L+ +E ++
Sbjct:   99 WIMDPATDLYYHWLTIVAIPVFYNLMLLVTRACFNELQDDYTILWMVLDYTSDVIYYLDTFVRSRTGFLEQGLLVRESKKLWEHYKKSPQFKFDIFSMIPTDILMLKVGYNNPEL---RFNRLFKMARLFEYFDRTETRTNFPNIFRISNLVLYILIIIHWNGCIFFAISKTLGFGSDSWVYPN------------ISDPEFGRLGRKYIYCLYWSTLTLTTIGETPPPVRDIEYFFVVSDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVVKWFDYLWTEQKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLVELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMDALSEYPEAKKALEEKGRAILMKDNLID-EAAANAGADAKDLEEKVNLLGTNLDVMQTKFARLMADWTASQSRIKQRLTNMEARV 609          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 489.96 bits (1260), Expect = 2.611e-163
Identity = 266/526 (50.57%), Postives = 373/526 (70.91%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D +S  YY W+ ++   V +N+++L  RA F   Q  Y  LW V DY  D    +D  + SR  FLEQGLLVK+  +L  NY +  +FK D+I+++P +LF L +   N +    RFNRL K+ +LFEF +RT+TRTN+PNIFRIS+L++++L+IIHWN C FF IS +IG G+D +VYP         I+ P    + +    Y+Y  +WSTLTLTTI E P PV + E++ + ++ L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R+I WFDYLW  K++ DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK IL KDNL+D EA      +   +E  I+++E ++     K ++L+ ++ +    +K +++ +E ++
Sbjct:  172 WIMDPASDKYYRWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP--------NISHP---EYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMENKV 682          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 516.924 bits (1330), Expect = 2.837e-175
Identity = 273/526 (51.90%), Postives = 383/526 (72.81%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FV+D SS  YY W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF +RT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:   49 FVIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 559          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 517.309 bits (1331), Expect = 5.392e-175
Identity = 273/526 (51.90%), Postives = 383/526 (72.81%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FV+D SS  YY W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF +RT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:   79 FVIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 589          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 518.079 bits (1333), Expect = 1.564e-174
Identity = 273/526 (51.90%), Postives = 383/526 (72.81%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FV+D SS  YY W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF +RT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:  132 FVIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 642          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 518.079 bits (1333), Expect = 1.127e-173
Identity = 273/526 (51.90%), Postives = 383/526 (72.81%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FV+D SS  YY W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF +RT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:  199 FVIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 709          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: amacr (alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:XB-GENE-1009589])

HSP 1 Score: 501.13 bits (1289), Expect = 9.403e-170
Identity = 264/526 (50.19%), Postives = 380/526 (72.24%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FV+D S   YYNW+  +T+ V++N  ++  RA F   Q+ Y  LW+  DY+ D+  + D+ + +R  +LEQGLLV++  +LR  Y   ++FK+D+++I+P ++  L      ++Y   R N+L ++ ++FEF  RT+TRTN+PNIFRIS+LI++++IIIHWN C ++ IS +IG G D +VYP  S+             + +    Y+Y+ +WSTLTLTTI E P PV + EF  +  + L GVLIFA+IVGNVGSMISN+NA + +FQ ++D +K+YM FR VSK+LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LLI+L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+DL+ + N   +   +E  + ++E  ++   +K ++L+ ++++A   +K +++KIEK I
Sbjct:   10 FVIDPSGNLYYNWLFCITMPVMYNWTMIIARACFDELQQDYLELWFFLDYMSDAIYIADMFVRTRTGYLEQGLLVRDEVKLRDKYKMTMQFKLDVLSIIPTDILYL---QFGLNYPELRLNKLLRVARMFEFFQRTETRTNYPNIFRISNLIMYIVIIIHWNACVYYSISKAIGFGEDTWVYPNTSHPE-----------YGRLARKYVYSLYWSTLTLTTIGETPPPVQDSEFWFVVADFLVGVLIFATIVGNVGSMISNMNAARAEFQGRIDAIKQYMHFRKVSKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLIELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDGLLDLDIA-NSGADPKDIEEKVIQMEGLVENLQTKFARLLAEYDSAQQKLKQRVTKIEKII 520          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 509.605 bits (1311), Expect = 5.955e-172
Identity = 275/564 (48.76%), Postives = 391/564 (69.33%), Query Frame = 2
Query:  539 IKKCFVRNNERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +K+   R +   P  G  E  PP  G+     G   +  VVD SS  YY W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:   69 LKEVSTRESNAQPNPG--EQKPPDGGE-----GRKEEPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 509.605 bits (1311), Expect = 5.955e-172
Identity = 275/564 (48.76%), Postives = 391/564 (69.33%), Query Frame = 2
Query:  539 IKKCFVRNNERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +K+   R +   P  G  E  PP  G+     G   +  VVD SS  YY W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:   69 LKEVSTRESNAQPNPG--EQKPPDGGE-----GRKEEPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 510.76 bits (1314), Expect = 8.210e-172
Identity = 275/564 (48.76%), Postives = 391/564 (69.33%), Query Frame = 2
Query:  539 IKKCFVRNNERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +K+   R +   P  G  E  PP  G+     G   +  VVD SS  YY W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:  107 LKEVSTRESNAQPNPG--EQKPPDGGE-----GRKEEPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 648          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 494.967 bits (1273), Expect = 1.777e-165
Identity = 260/524 (49.62%), Postives = 380/524 (72.52%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 2224
            V+D S   YYNW+  +TL V++N  ++  RA F   Q  Y   W +FDY+ D   + D+ + +R  +LEQGLLVK+  +L + Y + ++FK+D+++++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C ++ IS +IG G+D +VYP             V +P + +    Y+Y+ +WSTLTLTTI E P PVL+ E+I + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+D+  + N+  +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  149 VIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYIKF---GWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPD------------VNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIA-NMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 656          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 494.967 bits (1273), Expect = 1.777e-165
Identity = 260/524 (49.62%), Postives = 380/524 (72.52%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 2224
            V+D S   YYNW+  +TL V++N  ++  RA F   Q  Y   W +FDY+ D   + D+ + +R  +LEQGLLVK+  +L + Y + ++FK+D+++++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C ++ IS +IG G+D +VYP             V +P + +    Y+Y+ +WSTLTLTTI E P PVL+ E+I + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+D+  + N+  +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  149 VIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYIKF---GWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPD------------VNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIA-NMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 656          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90980|CNG3_CHICK (Cyclic nucleotide-gated channel rod photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 2.299e-172
Identity = 269/538 (50.00%), Postives = 387/538 (71.93%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*EKHFSQF 2266
            F++D +   YYNW+  +T+ V++N  ++  RA F   Q  Y ++W++ DY+ D   + D+ + +R  +LEQGLLVKE  +L++ Y S ++FK+D ++I+P +L    L    ++Y   R NRL ++ ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C ++ IS +IG G+D +VYP  S+             + +    Y+Y+ +WSTLTLTTI E P PV + E+  + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM FR VSK++EKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH ET++ V +F DCE  LL++L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+D+E + N+  +   +E  +  +E S+    +K ++L+ +++ A   +K +L++IEK I   + E+ F  F
Sbjct:  108 FIIDPAGNMYYNWLFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGLLVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYFKL---GLNYPELRINRLLRVARMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPE-----------FARLTRKYVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARAEFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGKQILMKDGLLDIEVA-NLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEYDAAQQKLKKRLTQIEK-ILKPVMEQEFLDF 629          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q9JJZ8|CNGA3_MOUSE (Cyclic nucleotide-gated cation channel alpha-3 OS=Mus musculus OX=10090 GN=Cnga3 PE=1 SV=2)

HSP 1 Score: 509.605 bits (1311), Expect = 4.165e-171
Identity = 275/564 (48.76%), Postives = 391/564 (69.33%), Query Frame = 2
Query:  539 IKKCFVRNNERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +K+   R +   P  G  E  PP  G+     G   +  VVD SS  YY W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:   69 LKEVSTRESNAQPNPG--EQKPPDGGE-----GRKEEPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90805|CNG1_CHICK (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 5.459e-171
Identity = 270/526 (51.33%), Postives = 383/526 (72.81%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FV+D SS  YYNW+ ++   V +N  +L  RA F   Q  +  LW   DY  D   V D+ +  R  FLEQGLLVK+  +LR +Y   ++FK+D++++LP +L  L L    ++Y   RFNRL +I +LFEF +RT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         ++IP    + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM FR V+K+LE R+I WFDYLW NK+++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKLK  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID EA++    +   +E  I+++E+++    ++ ++L+ ++ ++   +K +L+++E ++
Sbjct:  201 FVIDPSSNMYYNWLTIIAAPVFYNWCMLICRACFDELQIDHIKLWLFLDYCSDIIYVFDMFVRFRTGFLEQGLLVKDEKKLRDHYTQTVQFKLDVLSLLPTDLAYLKL---GLNYPELRFNRLLRIARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKVIGFGTDSWVYP--------NVSIP---EYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKVDSIKQYMHFRKVTKDLEARVIKWFDYLWTNKKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLKPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEEAAK-AGADPKDLEEKIDRLETALDTLQTRFARLLAEYSSSQQKVKQRLARVETRV 711          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q29441|CNGA3_BOVIN (Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus OX=9913 GN=CNGA3 PE=2 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 4.699e-170
Identity = 267/525 (50.86%), Postives = 379/525 (72.19%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            V+D SS  YY+W+ V+ + V +N  +L  RA F   Q ++  LW V DY  D    +D+++ +R  FLEQGL+V + +RL K+Y   + FK+D+++++P +L    L    ++Y   RFNRL K+ +LFEF +RT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP  SN             + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T+R V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVAEDGI  FV L +GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E ++    +   +E  +  +E+S+    ++ ++L+ ++      +K +LS++E Q+
Sbjct:  179 VMDPSSNMYYHWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVRARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKL---GMNYPELRFNRLLKLARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNVSNPE-----------YGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYIIKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAK-AGADPKDIEEKVEHLETSLDSLQTRFARLLAEYNATQMKVKQRLSQLESQV 688          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q16281|CNGA3_HUMAN (Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens OX=9606 GN=CNGA3 PE=1 SV=2)

HSP 1 Score: 508.449 bits (1308), Expect = 1.092e-169
Identity = 270/525 (51.43%), Postives = 378/525 (72.00%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            VVD SS  YY W+  + L V +N  +L  RA F   Q +Y  LW V DY  D   V+D+++ +R  FLEQGL+V + NRL ++Y +  +FK+D+++++P +L  L +     +Y   RFNRL K  +LFEF +RT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         I+IP      +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIGKEMYI+  GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  160 VVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKV---GTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP--------NISIP---EHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 669          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A3P7XJ78 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS4000 PE=4 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 298/533 (55.91%), Postives = 401/533 (75.23%), Query Frame = 2
Query:  629 RLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 2227
            +L S  +  V+DSS   YY WIG++T+TVL+N +VLP+R+AF         +W V DY ID    +DI +  R  +LE+GLLV++  +L++ YI + +F ID++AILP +LF  I P  N    W RFNRL KIY+ FEF++RT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS+          TE WD+  S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ KMDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I+ ++    +++++LI +F  + + +K +L+++E++
Sbjct:   92 KLPSNLKDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDSLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQE 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A183LJM5 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 298/533 (55.91%), Postives = 401/533 (75.23%), Query Frame = 2
Query:  629 RLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 2227
            +L S  +  V+DSS   YY WIG++T+TVL+N +VLP+R+AF         +W V DY ID    +DI +  R  +LE+GLLV++  +L++ YI + +F ID++AILP +LF  I P  N    W RFNRL KIY+ FEF++RT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS+          TE WD+  S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ KMDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I+ ++    +++++LI +F  + + +K +L+++E++
Sbjct:   92 KLPSNLKDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDSLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQE 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A504Z0W2 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_00261 PE=4 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 301/545 (55.23%), Postives = 404/545 (74.13%), Query Frame = 2
Query:  602 PPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFF 2236
            PPL    + R   W    VVDSS   YY WIG+++ TVL+N +VLP+R+AF         +W  FDY+ID+   IDI +  R  FLEQGLLV++VN+LRK Y+ + E   D++A+ P +L  LI P       W RFNRL K+Y+LFEFI+RT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRSN     +    +  W+   S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ +MDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+AK  L+QRG+EIL KDNLID E           +E  + ++++++    +++++LI +F  + + +K +L+++E+  +F
Sbjct:   74 PPLLP--WKRGYQWITTLVVDSSQSAYYYWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSNDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDTLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLEEYQYF 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: G4VGD7 (Putative cyclic-nucleotide-gated cation channel OS=Schistosoma mansoni OX=6183 GN=Smp_194700 PE=4 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 301/554 (54.33%), Postives = 406/554 (73.29%), Query Frame = 2
Query:  566 ERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 2227
            ++  +   I+NIP    DL           V+DSS   YY WIG++T+TVL+N +VLP+R+AF          W V DY ID    +DI +  R  +LE+GLLV++  +L++ Y+ + +F ID+I ILP +L  LI P  N    W RFNRL KIY+ FEF++RT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS+          TE WD+  S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ KMDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I++++    +++++LI +F  + + +K +L+++E++
Sbjct:   74 KKLTIRQRIQNIPSNLKDL-----------VIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPITWMVLDYCIDCVYFMDIFVGFRTGYLEEGLLVRDKEKLKQAYLKRRQFIIDIITILPTDLLYLI-PIFNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRASGLSSDSFVYPPRSSDDTSDEYKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDSLNALPDKLKAEIAIHVHFDTLQRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDILRKAQEQQESIEQCVQRIDNTMNQLTTRLARLIGEFGASQAKLKRRLTRLEQE 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A4E0RSW7 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola hepatica OX=6192 GN=D915_005543 PE=4 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 296/532 (55.64%), Postives = 398/532 (74.81%), Query Frame = 2
Query:  641 WNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFF 2236
            W    VVDSS   YY WIG+++ TVL+N +VLP+R+AF         +W  FDY+ID+   IDI +  R  FLEQGLLV++VN+LRK Y+ + E   D++A+ P +L  LI P       W RFNRL K+Y+LFEFI+RT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRS      +    +  W+   S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ +MDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+AK  L+QRG+EIL KDNLID E           +E  + ++++++    +++++LI +F  + + +K +L+++E+  +F
Sbjct:   85 WITTLVVDSSQSAYYYWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSTDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDTLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIVGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLEEYQYF 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 500.745 bits (1288), Expect = 1.114e-168
Identity = 262/528 (49.62%), Postives = 379/528 (71.78%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFS 2239
            V+D +   YYNW+ V+T  V++N +++  RA F   Q  Y   W++ D++ D   V D++  +R  +LEQGLLVK+  +LR+ Y+  ++FK+DLI+++P +L  +++    ++Y   R N+L ++ +LFEF  RT+TRTNFPN+FRIS+L+++++IIIHWN C ++ +S ++G GSD FVYP  SN             + +    Y Y+ +WSTLTLTTI E P P  + EF  +  + L GVLIFA+IVGNVGSMI+N+NA + DFQ ++D +K+YM FR V+ +LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNL+DLE ++    +   ME  + +I S ++   ++ ++L+   E   S +K +++K+E +I  S
Sbjct:   86 VIDPAGNTYYNWLFVITCPVMYNWVLIIARACFEELQHDYLIYWFILDFVSDLVYVADMVFRTRTGYLEQGLLVKDEKKLRERYMVSLQFKLDLISMIPTDLLYVLV---GLNYPEIRMNKLFRVNRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACLYYSVSKAMGFGSDRFVYPDPSNPE-----------FGRLIRKYAYSMYWSTLTLTTIGETPPPEKDAEFFFVVTDFLVGVLIFATIVGNVGSMITNMNAARADFQARIDAIKQYMSFRKVTTDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKSMLEEKGRQILMKDNLLDLEVAKQG-PDPKDMEEKVVRIGSVLEDLQTRFARLLAQHEAVQSRLKRRVTKLETKITVS 598          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 491.5 bits (1264), Expect = 1.876e-165
Identity = 263/526 (50.00%), Postives = 372/526 (70.72%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D ++  YY+W+ ++   V +N++++  RA F   Q  Y  LW + DY  D     D  + SR  FLEQGLLVK+  +L  +Y    +FK D+++++P +   L + + N +    RFNRL K+ +LFEF +RT+TRTN+PNIFRIS+L++++LIIIHWN C FF IS +IG G+D +VYP  S+             + +    Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R+I WFDYLW  K++ DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++GK ILMKDNLID EA  N   +   +E  I K+ES++    +K  +L+ ++ +  + +K +L+ +E ++
Sbjct:   63 WIMDPATDKYYHWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYPNISHP-----------EYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMESKV 573          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 491.115 bits (1263), Expect = 2.214e-164
Identity = 264/526 (50.19%), Postives = 373/526 (70.91%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D ++  YY+W+ ++   V +N++++  RA F   Q  Y  LW + DY  D     D  + SR  FLEQGLLVK+  +L  +Y    +FK D+++++P +   L + + N +    RFNRL K+ +LFEF +RT+TRTN+PNIFRIS+L++++LIIIHWN C FF IS +IG G+D +VYP         I+ P    + +    Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R+I WFDYLW  K++ DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++GK ILMKDNLID EA  N   +   +E  I K+ES++    +K  +L+ ++ +  + +K +L+ +E ++
Sbjct:  137 WIMDPATDKYYHWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYP--------NISHP---EYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMESKV 647          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 488.034 bits (1255), Expect = 2.459e-163
Identity = 258/526 (49.05%), Postives = 376/526 (71.48%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D +S  YY+W+ ++++   +N+++L  RA F   Q  Y ++W   DY  D    ID  + SR  FLEQGLLVK+  +L +NY    +F+ DL++++P ++  L + + N +    RFNRL K+ +LFEF +RT+TRTNFPNIFRI +L++++LIIIHWN C FF IS ++G GSD +VYP  S+     +A             Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++G+ ILMKD LID  A++     D  +E+ ++ +E++++   +K++++  D+  +   +K +++ +E ++
Sbjct:  127 WIMDPASDLYYHWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLA-----------RKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTADAKD--LEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNMEARV 636          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 488.419 bits (1256), Expect = 1.020e-162
Identity = 258/526 (49.05%), Postives = 376/526 (71.48%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D +S  YY+W+ ++++   +N+++L  RA F   Q  Y ++W   DY  D    ID  + SR  FLEQGLLVK+  +L +NY    +F+ DL++++P ++  L + + N +    RFNRL K+ +LFEF +RT+TRTNFPNIFRI +L++++LIIIHWN C FF IS ++G GSD +VYP  S+     +A             Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++G+ ILMKD LID  A++     D  +E+ ++ +E++++   +K++++  D+  +   +K +++ +E ++
Sbjct:  178 WIMDPASDLYYHWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLA-----------RKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTADAKD--LEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNMEARV 687          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 220.32 bits (560), Expect = 4.713e-64
Identity = 146/452 (32.30%), Postives = 251/452 (55.53%), Query Frame = 2
Query:  680 YYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXX-XXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVV-AEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGK 2029
            Y  W+ ++ L   ++   LP+R +F +      S WY+ DY  D+  ++  +++  R  F+ +G ++ +     K Y    +FK DL+++LP+++  L      +    +R  RL K Y  FEF +R +   +   I+R+     +LL  +H N CF++F+S+  GLGS  +VY  +                      Y+  ++W+  TL TI  +P P    E +        GV + + ++G +G +I    A +  ++  MD    YM    +S+ ++ R+  W++Y W ++  LDE E+L  LP K+R EIAI V+Y  +  V++F+ C++ ++  ++L+LK  V+ PGD++C+KG++G+EMYI+K G++ VV   D   VFVTL  GSVFGE+S+L + G   GNRRTANV + G+++LF L+K DL ++L  YP+++  L ++ K
Sbjct:   54 YLIWLTLVMLAFQWSCWFLPLRLSFPVHTPNTMSFWYIGDYTCDAIYLLDILVMQCRLQFVHRGDIITDQKETSKFYYHSEKFKSDLLSLLPLDILYLKFGPSAM----FRLPRLIKYYAFFEFNDRLEAIMSKAYIYRVIRTTGYLLFSLHLNACFYYFVSDMEGLGSTRWVYNGKGYR-------------------YIRCYYWAVKTLITIGGLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYTIVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGG---GNRRTANVMAHGFANLFILDKRDLNEILRIYPESEKLLRKKAK 479          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 3.797e-24
Identity = 83/303 (27.39%), Postives = 141/303 (46.53%), Query Frame = 2
Query: 1130 HWNGCFFFFISN-----------SIG-LGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGE-LSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPD 1999
            HW  C ++ I N            IG L   G       N TD +    + + +    ++Y   F +S+LT      V  P  N+E I     +L G L++ASI GNV ++I  + +    +  +M  VK ++ F  +   L +R+  +F + W     +D   VL   P+ L+A+I +H++   + +   F    +  L  L +K K     PGD +   GD+   MY + RG + ++ ED   V   L +  +FGE ++  + PG  S     A+VR++ Y DL  + ++D+ +VL  YP+
Sbjct:  258 HWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKDKY--VTALY---FTFSSLTSVGFGNV-SPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILRED--IVVAILGKNDIFGEPVNQYSRPGKSS-----ADVRALTYCDLHKIVREDMLEVLDMYPE 547          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 5.449e-23
Identity = 64/245 (26.12%), Postives = 129/245 (52.65%), Query Frame = 2
Query: 1268 SMYMYAFFWSTLTLTTIA-EVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPD 1999
            S Y+ + +++  +LT++         + E I     +L G L+ A + GNV ++I  + + ++ +  +   +K ++    + K+L++R++ +F   W     +D  E+L   PD+LRA+IA+H++ E I  +++F+   +  L  L L +K    +PG+++ R+GD  +  Y V  G + V+ +D   V   L +G + G     ++       +  A+V+++ Y DL C++   L+DVL  YP+
Sbjct:  257 SAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKE-ILQLAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVLKDD--MVLAILGKGDLIGS----DLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYPE 494          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 88.1965 bits (217), Expect = 3.617e-18
Identity = 65/251 (25.90%), Postives = 122/251 (48.61%), Query Frame = 2
Query: 1253 WDQFPS---MYMYAFFWSTLTLTTIA-EVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEY 1993
            W+  PS   +Y+ + +++  +LT+I      P  + E I     ++ G L++A+I GNV ++   + A    +   ++ V+ +++   V K L +R++++    W   + +D E+VL   P  +RA+I +H++ +       F+      L  L ++ +    +PGD I   G+    +  V  G L V+ +D  +V   L +G VFG++       + S     ANVR++ Y DL  + +D L  VL  Y
Sbjct:  419 WEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVIQDD--EVVAILGKGDVFGDVFWKERVIAPS----CANVRALTYCDLHVIRRDALVKVLDFY 663          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001558.1 (pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 gene:ENSPMAG00000001411.1 transcript:ENSPMAT00000001558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 7.179e-14
Identity = 61/257 (23.74%), Postives = 117/257 (45.53%), Query Frame = 2
Query: 1130 HWNGCFFFFISNS---IGLGSDGFVYPP--------------RSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNE 1849
            HW  C +F I      + + SD  + P                +NS+      P+   +    S+Y   F  S++T      V     + E I     +L G L+ A + GNV ++I  + + ++ +  +   +K ++    + + L++R++ +F   W     +D  E+L   PD+LRA++ +H++ E ++ + +F+   +  L  L L +K    +PG+Y+ R+GD  +    V  G + V+ +DG  V   L E
Sbjct:   44 HWMACIWFVIGCQEIVVRVSSDTHISPHCWLHQLRKRLEASGSANSSVSHCGPPLRSAY--ITSLY---FTLSSITSVGFGNVSANT-DSEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTKDLKEFIRIHRLPQPLKQRMLEYFQTTWSVNNGIDTNELLKDFPDELRADVTMHLNKEMLQ-LPLFEAASRGCLRSLSLNVKTTFCAPGEYLIRQGDALQAFCFVLSGSMEVL-KDG-TVLAILGE 291          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 411.764 bits (1057), Expect = 5.119e-137
Identity = 219/456 (48.03%), Postives = 321/456 (70.39%), Query Frame = 2
Query:  683 YNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRS----NSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEIL 2038
            Y W+ V++L VL+N   + +R AF     K   +W + DY  D   + DI+++ R  FLE+G+L     ++R++Y+   EF +D  A++P+++  + + H       +R NR+ K ++ + F++RT++RT FPN+ R++SL+ F+L+IIHWN C +F +S  IG GSD +VYP       NS++ TI+            MY+Y+F+WSTLTLTTI EVP P    E+II+T++ L GVL+FA+IVGNVG++I+N+NA + DFQ KMDG+K YM F  + + L++R+I WFDYLW  K+  DEEE+L +LPDKLRAEIAI+VH +++R V++FQDCE   L +L+L+L+ Q+FSPGDY+CRKG++G+EMYIV RGKL VV+E G K++  L  GS FGE+S+L++  S +GNRRTA+VRSVGY++LFCL K+DL +VL EYP+ K K+ +  KE L
Sbjct:    6 YFWLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILVSMRTGFLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPA----FRINRILKFHRFWHFLDRTESRTTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTIS-----------RMYIYSFYWSTLTLTTIGEVPPPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSM--SSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO34633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW2])

HSP 1 Score: 356.681 bits (914), Expect = 9.092e-116
Identity = 187/454 (41.19%), Postives = 302/454 (66.52%), Query Frame = 2
Query:  689 WIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDN 2050
            W+ ++++ V++N + +  R  F   Q ++ +LW+V DYI D    +DI++  R  +L+QGLLV+++ +LR+NY++ ++FK+D+I+ILP +     L  R       R  R+ ++ KLF+   R +T++++PN+ +  ++++ +L++ HWN CF+F IS SIG GSD +VYP  S++            +D+    Y+Y+F+WST  + T      P  + E + +  +L  G L FA++VG  G+++ ++   + +F    + +K+YM    V+ +L++R+I+W DY+W  K+SLD E +L  LP+KLR +IA+HV+   +R+V VF DCE  LL ++++KL+ QVFSPGDYICRKGD+G+EMYIV  G L VV +DG  V   L+EGS FGE+SILN+ G   GNRRTA VRSVG+SDL CL+KDDL + +++YP+A+M+L +RG+E+L + +
Sbjct:    4 WLYIVSVAVVYNWVFIIARQCFSQLQVRFMTLWFVMDYICDIIYGMDIMVEFRTAYLDQGLLVRDLKKLRQNYLATVKFKLDMISILPFDFLYFGLGTRFTLCRLLRLLRIHRVVKLFQ---RGETKSSYPNLLQTFAVVLVILLVFHWNACFYFAISESIGFGSDKWVYPNLSSNN-----------YDKLSRQYLYSFYWSTRMMITGESENPPETDMELLFVVADLTVGYLTFAALVGQFGAILGHIMRARVEFITHSNSIKQYMNNHKVNNDLQERVISWIDYMWHKKRSLDHERILKKLPEKLRGQIAVHVYLAVLRHVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVVGDDGTTVLAILSEGSYFGEISILNLSG--IGNRRTAAVRSVGFSDLLCLSKDDLLEAMSDYPEARMRLEERGRELLNRTH 441          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO49540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK0])

HSP 1 Score: 286.96 bits (733), Expect = 3.753e-89
Identity = 179/450 (39.78%), Postives = 264/450 (58.67%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAF--VIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLE-QGLLVKEVNRLRKNYISKIEFKIDLIAILPIEL---FSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAED---GIKVFV-TLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDL 1972
            FV+D      Y W  ++T  V +N  ++ +R AF  V  +  YR +++  D I D   ++DI++  R  + +  G+++     L  NY SKI F +D +++ P+E    F+L+ P      VW+R  RL K + +  F   +D RTN PN  R+  L ++L + +HW  C ++ IS   GLGS+ +VYP  S                     Y+ + +WS LTLTTI E P P  N E +  +   L G+ +FA++VGNVG +ISN+NA +TDFQ KMD +K YME   V ++L+ R   W  Y W         + L  LP +LRAE+AIHVH  T++ V +F+DC++ LL +L+LKL+ Q+FSPGDYICR G+IG+EMYI+  GK+ VV  D   G K+ V +L EG+ FGE+S+L +   +  NRR+A+VRSVGYS+L  L++ DL
Sbjct:    2 FVIDPEGGLCYTWAALVTFAVFYNFCIVLLRIAFKEVRNELFYRMIYWPLDVISDIIYLVDILVQFRTAYRDDHGIMINTPKLLALNYCSKIPFFLDALSVFPLETTLPFTLVQPS-----VWFRCLRLLKWHCVLRFFVISDLRTNKPNRLRVVKLALYLGLALHWVACGYYMISEYEGLGSNSWVYPEASGEDG---------------KKYIKSLYWSILTLTTIGETPEPSTNLEHVFTSAMFLFGIFVFAAVVGNVGDVISNMNAARTDFQTKMDYIKSYMEHHKVPEDLQNRAKRWAYYAWSR-----HSDALGMLPLRLRAELAIHVHLATLKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLLRLDEGR--NRRSADVRSVGYSELLWLSQKDL 424          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO39918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S2])

HSP 1 Score: 283.108 bits (723), Expect = 7.299e-88
Identity = 166/450 (36.89%), Postives = 263/450 (58.44%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAK 2005
            V+     F Y W   +   + +N+ V+ +R AF   Q ++   W VFDY  D   V+DIIIN R  FLE+G+LV +  R+ ++Y     F  DL+++ P ++  ++ P R       R NRL K YK F   +  ++ T +P   R+  L+  + ++I+WN  F+  IS + G G++ +VYP   +                    Y+ + +WSTLTLT I ++P P  NFE++      L GV +FA+IVGN GS+I N NA + DF+ + +G   YM    V K+L++R++ W+DY W +     +   L+ LPDKL+ EIA+HV+ ET+R V+  Q C+   L  L+L +KL++F+PGD+ICRKG++ +EMY++  GK+ VV E G +V   L+ G  FGE+ IL++  S+  NRRTA++R++GY + F L+K+D+     +YP+A+
Sbjct:    1 VIAPDGRFMYIWFYFVVFAIRYNLWVVILRIAFPAAQDEFTVAWLVFDYFCDFLYVLDIIINFRTGFLEEGILVVDAKRVARHYAVSKNFIADLLSVFPTDILCVLYPER---LPMLRINRLIKAYKSFRIKSLMESHTTYPTFLRVFFLLHLMFLLINWNAGFYIMISRTEGFGTNAWVYPGNGS----------------LYQQYLKSLYWSTLTLTAIGDLPSPATNFEYLYTIACYLCGVFMFATIVGNAGSIIVNRNANRLDFERQREGTNNYMRKNRVPKDLQRRVLMWYDYSWASGGG--DLNSLTLLPDKLKTEIALHVNLETLRKVTFLQKCQPEFLHDLVLMMKLRIFTPGDFICRKGEVAREMYVIIDGKIEVVGEVG-QVLKVLSGGDFFGEIGILSL--SEGQNRRTADIRTIGYVECFVLSKEDVLKATRDYPEAQ 426          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 272.707 bits (696), Expect = 1.229e-83
Identity = 177/460 (38.48%), Postives = 265/460 (57.61%), Query Frame = 2
Query:  656 VVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAE-------VPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 2014
            V+D S  FY+ W+  ++L V++N   L V  AF              DY  DS   +D ++  R  FLE G++V    +L K Y     F +DLI+ILP ++  L L    I     RFNRL K ++   F +R +  +  P +F ++ LI +L +IIHW  C +F +S   G G+D +++P                   +    Y+Y+ + S++++TT+          PR  L   F+I+T   L GVLIFA+IVGN G MI  +   +  +  K++G+K Y+E   +   L+KR+I+WFDYLW +K+ ++E+E+   L D  +AEIAIHV+ +T+  V +F DC+   L +L+LKL+  + SPGD+ICR+G+ G+EMYIV +G L V+ E    V  TL+ GS FGE+S+LN+ G   GN RTA+VRSVG+SDLF L+K DL +VL  YP AK ++
Sbjct:    2 VLDPSGTFYFLWLLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDTLVQFRVGFLEHGVMVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPI----LRFNRLFKAHRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHPRLDGQLS------------KLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFVIVTY--LTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIRVEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVLDEKE-TVLATLSAGSHFGEISLLNMKG--IGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQM 440          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 505.753 bits (1301), Expect = 1.564e-169
Identity = 270/526 (51.33%), Postives = 375/526 (71.29%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D S+  YY W+ V+   V +N++++  RA+F   Q+ Y  LW V DY  D   + D  + SR  +LEQGLLVK+  +LR  Y +  +FK D+IA++P +L  L       D   +RFNRL KI +LFEF  RT+TRT+FPN+FRIS+L++++L+IIHWN C FF IS +IG GSD +VYP  S+     +A             Y+Y+ +WSTLTLTTI E P PV + E++ +  + L GVLIFASIVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW  K++ DE+EVL TLPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  176 WIMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYPNISHPEHGRLA-----------RKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 686          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: ENSORLT00000025598.2 (cyclic nucleotide-gated channel cone photoreceptor subunit alpha [Source:NCBI gene;Acc:101170498])

HSP 1 Score: 494.582 bits (1272), Expect = 7.609e-165
Identity = 260/526 (49.43%), Postives = 372/526 (70.72%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D ++  YY+W+  L + V +N+++L  RA F   Q  Y ++W V DY  D    ID  + +R  FLEQGLLVK+   L++ Y++ ++FK D+I++LP ++   ++   N ++   RFNRL ++ +LFEF +RT+TRTNFPNIFRI++L+++++IIIHWN C +F +S  +G GSD +VYP  +      +AI            Y+Y F+WSTLTLTTI E P PV + E+  +  + L GVLIFA+IVGNVG+MISN+ A + +FQ K+D +K+YM FR V+K+LE R++ WFDYLW  +++ DE++VL +LPDKL+AEIAI+VH ET+  V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L  +G+ ILMKDNLID   S     +   +EN +N+IE+S++   +K  +L    +++   +K +LS +  Q+
Sbjct:  108 WIMDPATDLYYHWLSALAVPVFYNLMLLVARACFNELQYNYTTMWIVLDYGSDVFYYIDTFVRARTGFLEQGLLVKDPKVLKEKYMTTLQFKFDVISLLPTDIVFFVIGINNPEW---RFNRLFRLPRLFEFFDRTETRTNFPNIFRIANLVLYIIIIIHWNACLYFAVSKVLGFGSDTWVYPALTGPKFSRLAI-----------QYIYCFYWSTLTLTTIGETPPPVRDIEYFFVVADFLTGVLIFATIVGNVGAMISNMGAARVEFQAKIDSIKQYMHFRKVTKDLEARVVKWFDYLWTEEKTCDEKQVLKSLPDKLKAEIAINVHLETLSKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKYALEDKGRAILMKDNLID--ESLVAACDAKDLENKVNQIEASVEVMTNKFKKLTAQHQSSQRKLKQRLSNLSNQV 617          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 490.345 bits (1261), Expect = 2.500e-164
Identity = 271/552 (49.09%), Postives = 376/552 (68.12%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRK-----------------------C---FLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D S+  YY W+ V+   V +N++++  RA+F   Q+ Y  LW V DY  D   + D  + SR                        C   +LEQGLLVK+  +LR  Y +  +FK D+IA++P +L  L       D   +RFNRL KI +LFEF  RT+TRT+FPN+FRIS+L++++L+IIHWN C FF IS +IG GSD +VYP  S+     +A             Y+Y+ +WSTLTLTTI E P PV + E++ +  + L GVLIFASIVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW  K++ DE+EVL TLPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:   90 WIMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYPNISHPEHGRLA-----------RKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 626          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 490.345 bits (1261), Expect = 1.816e-163
Identity = 271/552 (49.09%), Postives = 376/552 (68.12%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRK-----------------------C---FLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            +++D S+  YY W+ V+   V +N++++  RA+F   Q+ Y  LW V DY  D   + D  + SR                        C   +LEQGLLVK+  +LR  Y +  +FK D+IA++P +L  L       D   +RFNRL KI +LFEF  RT+TRT+FPN+FRIS+L++++L+IIHWN C FF IS +IG GSD +VYP  S+     +A             Y+Y+ +WSTLTLTTI E P PV + E++ +  + L GVLIFASIVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW  K++ DE+EVL TLPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  153 WIMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYPNISHPEHGRLA-----------RKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 689          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga2b (cyclic nucleotide gated channel subunit alpha 2 [Source:NCBI gene;Acc:101171687])

HSP 1 Score: 487.263 bits (1253), Expect = 5.048e-163
Identity = 265/526 (50.38%), Postives = 370/526 (70.34%), Query Frame = 2
Query:  653 FVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2230
            FVV  S   YY W+ V+++TVL+N  V+  RA F   Q  +   W V DYI D+  ++D I+  R  FLEQGLLVK+  +LR +Y+  ++FK+D+ +ILP +L  +      I     RFNRL    ++FEF +RT+TRTN+PNIFRI +L++++L+IIHWN C ++ IS S+G GSD +V+P  S +   T++             Y+Y  +WSTLTLTTI E+P PV + E++ +  + L GVLIFA+IVGNVGSMISN+NA + +FQ ++D +K YM FR VS+ELE R+I WFDYLW NK+++DE+EVL  LP+KLRAEIAI+VH ET++ V +F+DCE  LL++L+LKL+ QVFSPGDYICRKGDIGKEMYI+K GKL VVA+DG+  +  L  GS FGE+SILNI GSK GNRRTAN+RS+GYSDLFCL+KDDL + + EYPDAK  L +RG+EIL K+ L+D E +++  L     E  + ++E S+    ++ ++L+ D+      +K +++ +E+QI
Sbjct:  121 FVVSPSDDIYYRWLLVISITVLYNWFVVVARACFDELQVTFFIWWLVLDYISDTVYILDTIVRLRTGFLEQGLLVKDHIKLRDSYVRTLQFKLDVASILPTDLGYIAT---GIHTPQLRFNRLLHFPRMFEFFDRTETRTNYPNIFRICNLVLYILVIIHWNACIYYAISKSLGFGSDTWVFPNASRTGFTTLS-----------ESYVYCLYWSTLTLTTIGEMPPPVRDEEYLFVVFDFLVGVLIFATIVGNVGSMISNMNATRAEFQARIDAIKHYMHFRKVSRELETRVIKWFDYLWTNKKAVDEQEVLKNLPNKLRAEIAINVHLETLKKVRIFKDCEAGLLVELVLKLRQQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLTSGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVIEYPDAKTVLEERGREILKKEGLLD-ENADSGGLQKEDTEEKVERLEMSLDTLQTRFARLLNDYTHTQQRLKQRVTLLEQQI 631          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000035733.1 (SMESG000035733.1)

HSP 1 Score: 1071.23 bits (2769), Expect = 0.000e+0
Identity = 573/574 (99.83%), Postives = 574/574 (100.00%), Query Frame = 2
Query:  521 MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 2242
            MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTR+GSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNIFRISSLIIFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI
Sbjct:    1 MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTRIGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNIFRISSLIIFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 574          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 403/578 (69.72%), Postives = 487/578 (84.26%), Query Frame = 2
Query:  521 MTLWKRIKKCFVRNNERFPVLG----NIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 2242
            M +  R +K   R +E  PV+     + E I       FT++  W Q  VVDSSS  YYNWIG LT+T+LFN+++LPVRAAF IPQ+ YR +W++FDY+ID  N+ID+ I SR  FLE GL+V +  ++ KNYISK+ FK+D   ILP+ELFSLI P +NIDYVWYRFNRLTKIYKLFEFI+RTDTRTNFPNIFRISSLI+FLLI+IHWNGCFFFF+SNSIGLGSDGFVYPPRSN+T+ T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP PV N EFIIMT+ELLGGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE++LL+QLILKL++QVFSPGDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N L N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++  +  SI
Sbjct:    1 MWICNRFRKKSNRKDENLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 578          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 398/559 (71.20%), Postives = 479/559 (85.69%), Query Frame = 2
Query:  557 RNNERFPVLG----NIENIPPLKGDLFTRLGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 2221
            R +E  PV+     + E I       FT++  W Q  VVDSSS  YYNWIG LT+T+LFN+++LPVRAAF IPQ+ YR +W++FDY+ID  N+ID+ I SR  FLE GL+V +  ++ KNYISK+ FK+D   ILP+ELFSLI P +NIDYVWYRFNRLTKIYKLFEFI+RTDTRTNFPNIFRISSLI+FLLI+IHWNGCFFFF+SNSIGLGSDGFVYPPRSN+T+ T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP PV N EFIIMT+ELLGGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE++LL+QLILKL++QVFSPGDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N L N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++
Sbjct:    6 RKDENLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQ 564          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000044898.1 (SMESG000044898.1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 293/326 (89.88%), Postives = 294/326 (90.18%), Query Frame = 2
Query: 1223 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMK 2200
            MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP              GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQ                 GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS +K
Sbjct:    1 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP--------------GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQIR---------------GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSIVK 297          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000044898.1 (SMESG000044898.1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 292/323 (90.40%), Postives = 292/323 (90.40%), Query Frame = 2
Query: 1223 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS 2191
            MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP              GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQ                 GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS
Sbjct:    1 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP--------------GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQIR---------------GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS 294          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNGA35.877e-17151.43cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA32.275e-17051.43cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA11.252e-16449.81cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA11.252e-16449.81cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA11.252e-16449.81cyclic nucleotide gated channel subunit alpha 1 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-48.089e-15243.85Cyclic nucleotide-gated cation channel [Source:Un... [more]
cng-11.833e-9837.41Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
cng-21.894e-8031.18Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
che-64.468e-7029.46pep chromosome:WBcel235:IV:2104056:2111408:-1 gene... [more]
tax-21.808e-6533.06TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2][more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CngA1.372e-15045.40gene:FBgn0261612 transcript:FBtr0302924[more]
CngA2.977e-14845.40gene:FBgn0261612 transcript:FBtr0302925[more]
CG422602.239e-11043.39gene:FBgn0259145 transcript:FBtr0299573[more]
CG422602.178e-10843.42gene:FBgn0259145 transcript:FBtr0330241[more]
CG422604.548e-10843.39gene:FBgn0259145 transcript:FBtr0299572[more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b8.937e-17150.48cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga1b6.227e-17050.29cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3b4.471e-16450.19cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3b5.730e-16450.09cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3a2.611e-16350.57cyclic nucleotide gated channel subunit alpha 3a [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyb2.837e-17551.90nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb5.392e-17551.90nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb1.564e-17451.90nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb1.127e-17351.90nuclear transcription factor Y subunit beta [Sourc... [more]
amacr9.403e-17050.19alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnga35.955e-17248.76cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga35.955e-17248.76cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga38.210e-17248.76cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga11.777e-16549.62cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
Cnga11.777e-16549.62cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90980|CNG3_CHICK2.299e-17250.00Cyclic nucleotide-gated channel rod photoreceptor ... [more]
sp|Q9JJZ8|CNGA3_MOUSE4.165e-17148.76Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q90805|CNG1_CHICK5.459e-17151.33Cyclic nucleotide-gated channel cone photoreceptor... [more]
sp|Q29441|CNGA3_BOVIN4.699e-17050.86Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q16281|CNGA3_HUMAN1.092e-16951.43Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7XJ780.000e+055.91Cyclic nucleotide-binding domain-containing protei... [more]
A0A183LJM50.000e+055.91Cyclic nucleotide-binding domain-containing protei... [more]
A0A504Z0W20.000e+055.23Cyclic nucleotide-gated channel cone photoreceptor... [more]
G4VGD70.000e+054.33Putative cyclic-nucleotide-gated cation channel OS... [more]
A0A4E0RSW70.000e+055.64Cyclic nucleotide-gated channel cone photoreceptor... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b1.114e-16849.62cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3a1.876e-16550.00cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3a2.214e-16450.19cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3b2.459e-16349.05cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3b1.020e-16249.05cyclic nucleotide gated channel subunit alpha 3b [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1a4.713e-6432.30cyclic nucleotide gated channel subunit beta 1a [S... [more]
ENSPMAT00000005594.13.797e-2427.39pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
ENSPMAT00000005922.15.449e-2326.12pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
kcnh1b3.617e-1825.90potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000001558.17.179e-1423.74pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 ge... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353935.119e-13748.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346339.092e-11641.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495403.753e-8939.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399187.299e-8836.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353761.229e-8338.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga3a1.564e-16951.33cyclic nucleotide gated channel subunit alpha 3 [S... [more]
ENSORLT00000025598.27.609e-16549.43cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3a2.500e-16449.09cyclic nucleotide gated channel subunit alpha 3 [S... [more]
cnga3a1.816e-16349.09cyclic nucleotide gated channel subunit alpha 3 [S... [more]
cnga2b5.048e-16350.38cyclic nucleotide gated channel subunit alpha 2 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035733.10.000e+099.83SMESG000035733.1[more]
SMESG000013398.10.000e+069.72SMESG000013398.1[more]
SMESG000013398.10.000e+071.20SMESG000013398.1[more]
SMESG000044898.10.000e+089.88SMESG000044898.1[more]
SMESG000044898.10.000e+090.40SMESG000044898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010168 ID=SMED30010168|Name=Cyclic nucleotide gated channel alpha 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2298bp
GATCAAAATATATTAACATATTGGCTCTGTCAAATTCGATAACAATTGTT
ACAATTTTAGCAGAAACCAGATTAATAAACATAATAAATCTCCGATTTCC
TATGTTTCTGAATAGTTACTAAAATGAGTAGACATTTTTTACAAAAATTG
TAAAACAAATATTGAAATGCTTATTGTTTAAAGATAGATCTGTTTACTGA
ATAATTTCATTAATCATTCATTCGGAATATATGTATTAACATTTGAATGA
GAGCACTGAAAATTATGTCAAATAATTTAATTTTATAAATAATCCAAAAC
CCTTATGAATTTCAATAAAAACTTCAAGATTAAATAATTAACAAAGTAGA
GTTGATAAATGAAAGGATGAGAAAATTTTTTAAATTAATTATCCAATCAA
ATGAAAGTCAAATCTAAAAATACAATTCATTCGTTACGTATTTCAATTCT
TATTTGTTCTCATCCAAAGAGCAAGGCAGCCATTTTTATGATCAATTGTA
AAAAAAATCTACGATAGAAAATGACTTTATGGAAACGAATTAAAAAATGC
TTTGTCAGAAACAATGAAAGATTTCCAGTGTTAGGAAATATAGAAAATAT
CCCTCCACTTAAAGGAGATTTATTTACAAGGCTTGGCTCATGGAATCAAA
AGTTTGTTGTGGACTCCTCTTCTGTATTTTATTACAATTGGATCGGGGTA
TTGACTTTAACTGTCCTTTTCAATATCCTCGTGCTTCCTGTCAGAGCAGC
TTTTGTGATTCCTCAAAGAAAATATCGATCTTTATGGTACGTTTTCGATT
ATATCATTGACAGTGGAAATGTCATTGACATAATTATTAACTCAAGAAAA
TGTTTCCTTGAACAGGGCTTACTTGTGAAAGAGGTGAATAGGCTGAGGAA
GAATTACATATCAAAAATTGAGTTTAAAATTGATTTAATAGCAATTTTGC
CTATCGAGTTATTCAGCCTGATTCTCCCGCACCGAAATATTGATTATGTT
TGGTATCGATTTAATCGGCTCACAAAAATCTATAAATTATTTGAATTTAT
AAATCGCACGGACACCAGGACAAATTTTCCAAATATTTTCAGAATTTCTT
CACTGATCATTTTCCTTCTAATTATAATTCATTGGAATGGTTGTTTTTTC
TTTTTTATAAGTAATTCAATAGGATTGGGATCAGATGGCTTTGTGTATCC
TCCGAGGTCCAACAGCACTGATATGACCATAGCAATTCCTGTTACTGAAC
CCTGGGACCAATTTCCTAGCATGTACATGTATGCTTTCTTTTGGTCAACA
TTGACTTTAACAACAATAGCAGAAGTCCCAAGGCCCGTATTGAATTTTGA
ATTTATCATAATGACCGTGGAATTGTTAGGGGGAGTGTTGATATTTGCCT
CTATTGTTGGAAATGTGGGATCCATGATTTCCAACGTGAACGCTGTGAAA
ACCGACTTTCAAATGAAAATGGACGGAGTTAAACGATACATGGAATTCCG
AGGAGTTAGTAAAGAATTGGAAAAACGAATCATAAACTGGTTCGATTATT
TATGGGTCAACAAGCAGTCTCTGGATGAAGAAGAAGTTCTATCAACTCTG
CCCGATAAACTTAGGGCAGAAATTGCTATCCATGTCCATTATGAAACCAT
AAGAAACGTATCAGTTTTTCAAGACTGTGAGCAAAGTCTGCTAATCCAGT
TAATTTTAAAACTTAAATTACAAGTGTTTAGTCCGGGAGATTATATATGC
CGAAAAGGTGATATTGGAAAGGAAATGTATATTGTAAAACGTGGGAAATT
GAACGTGGTGGCTGAGGATGGAATAAAGGTTTTTGTAACTTTAAATGAAG
GAAGTGTGTTTGGAGAGTTATCAATTCTCAATATTCCTGGAAGTAAAAGC
GGAAATCGTCGGACCGCTAATGTAAGATCGGTTGGATATTCAGATTTGTT
TTGTTTAAACAAAGATGATCTTTGGGATGTCTTGGCTGAATATCCCGATG
CAAAAATGAAATTGATTCAACGTGGTAAAGAAATTCTGATGAAAGATAAC
CTTATTGATTTAGAGGCAAGTGAAAATGTATTATTAAACGATAACGGCAT
GGAAAATATCATAAATAAAATTGAATCTTCAATAAAAGGATTTGATTCAA
AGATTTCACAACTTATAGAAGATTTCGAAACAGCCCATTCAAGTATGAAA
TGTAAACTTTCAAAAATTGAAAAGCAGATTTTCTTTTCTATTTGAGAAAA
ACATTTTTCCCAATTTACTGTGATTTTTTAATTGTTTAAATGAGTAGA
back to top

protein sequence of SMED30010168-orf-1

>SMED30010168-orf-1 ID=SMED30010168-orf-1|Name=SMED30010168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=575bp
MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTRLGSWNQKFVVDSS
SVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGN
VIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSL
ILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNIFRISSLIIFLL
IIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPS
MYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVG
SMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQS
LDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKL
QVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGEL
SILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQ
RGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIE
DFETAHSSMKCKLSKIEKQIFFSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034220ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR032406CLZ_dom
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 382..503
e-value: 4.6E-23
score: 92.6
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 401..491
e-value: 2.4E-19
score: 69.2
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 382..500
score: 24.803
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 382..499
e-value: 4.48459E-21
score: 86.6109
NoneNo IPR availableGENE3DG3DSA:1.10.287.630coord: 309..373
e-value: 6.9E-27
score: 95.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 183..308
e-value: 3.6E-5
score: 25.4
NoneNo IPR availablePANTHERPTHR45638FAMILY NOT NAMEDcoord: 39..569
NoneNo IPR availablePANTHERPTHR45638:SF17CYCLIC NUCLEOTIDE-GATED CATION CHANNEL SUBUNIT Acoord: 39..569
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 50..305
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 250..267
NoneNo IPR availableTMHMMTMhelixcoord: 274..296
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 375..508
e-value: 8.6E-39
score: 134.3
IPR032406Cyclic nucleotide-gated channel, C-terminal leucine zipper domainPFAMPF16526CLZcoord: 498..569
e-value: 7.3E-13
score: 48.7
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 447..470
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 409..425
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 311..502