SMED30010163

Overview
NameSMED30010163
Smed IDSMED30010163
Length (bp)2352
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010163 (SMED30010163) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010163 (SMED30010163) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010163 (SMED30010163) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010163 (SMED30010163) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010163

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig45405newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig45405uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig41392newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig41392uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010163SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30010163SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30010163SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30010163SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010163 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.013837:3978..15906 -8631
v31.039037:311..2313 +7745
v31.020002:2740..5254 +4254
Homology
BLAST of SMED30010163 vs. TrEMBL
Match: K1R1R1 (Bullous pemphigoid antigen 1, isoforms 6/9/10 OS=Crassostrea gigas OX=29159 GN=CGI_10016946 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.028e-10
Identity = 66/240 (27.50%), Postives = 121/240 (50.42%), Query Frame = 1
Query:  616 ESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCF-----DKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELS 1320
            E++  G++DL    + D +  E+ S+ ++++   ID  AA+++LD L+ +S  E+I+    + +   F      + ++++EA++  LL PE VY+   E N +++L  +I+ G  +    +V I++  G    M L+EA+   NGI+   +  ++        LKDL++S +VN      + P      M ++D L N  L   S VKL   + ETG   +    D E+   + D+ E S
Sbjct: 1012 EAIKAGSVDLQNGMVKDLRTGEVMSLAEAMQTSKIDPTAAKSLLDALDKLSLHEMIQKGQINPDKGHFIPSDKSRPITIQEAMDRGLLHPENVYVVDKENNNIVSLDSLIKSGRFDPKTGMV-IDQKTGRA--MSLSEAIA--NGIIGGKIAVDDFVD-TSVTLKDLIDSSKVNPRSTTFVAPNN--YKMSLRDALANGFLTMNSNVKL---DPETGCVVL--AADEEIVQALVDVKENS 1238          
BLAST of SMED30010163 vs. TrEMBL
Match: R7T9B7 (SH3_10 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_205084 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.749e-7
Identity = 102/430 (23.72%), Postives = 192/430 (44.65%), Query Frame = 1
Query:  145 SIAKSIFENHLELDPMICD-VDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDE--------------KDFTIESVSKIDANDENKKYRTKINVGNLLKSLN--QLRCFDKFGMDTIENAV--------------IGKNEDSKEEFEM--------TIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCF-----DKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEM-KKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLI 1299
            +I ++  E  L +D +  + VDGEK  + +  ++G+++   ++ +L  +  L     +E + EDS    II+A   E +  K  E + + E              +D    ++  + A  ENKK   +   G ++  +   ++      G   I+ A+              + ++ D K++  M        T+ E+V+NG+LD+      +    E  ++ ++V   L++ + A+ IL+ +   S   LI   I D     F      K +SL+EAI++ LL P  V++   E  +V +L  +I+ G  N      K   +    +E+ LN A+K+  GIL+  ++ E M ++  P  +KD+L + ++N    I   P     P+  K  L    L  +S VK+   + +TGV  +   GD E+ + +
Sbjct:  739 TIGEAFDEGLLHVDTLHLEGVDGEKFPLQEAALQGLVEPHTLREILGTLDPL----AIENLMEDS----IIDANTGEYVDPKTGERMSLAEAIEQGRLDPDQVFLRDLVSGAIMSLSAAIENKKINPE--TGKVIDPVTGQEMSFATAIGNHVIDPAIDADKLAAQISALKFLNEHLDVKQKGVMNPLSGSMSTLEEAVLNGSLDIPNGSYVNTTTDEASTLAEAVNEKLMNPQVAKEILNAMNENSLGALIDKGIIDPNTGKFIDPVTGKKMSLKEAIDKGLLDPCSVFVVDPETGQVTSLDSLIKDGRFNPVSGKFKDPLTG---LEVSLNNAIKK--GILTPRIDPERMIEEKVP--VKDILANSKLNPADLIFQAPDGSTLPL--KTALGAGFLTPDSIVKI---DPKTGV--LTVAGDPELTNAL 1144          
BLAST of SMED30010163 vs. Planmine SMEST
Match: SMESG000017520.1 (SMESG000017520.1)

HSP 1 Score: 1509.58 bits (3907), Expect = 0.000e+0
Identity = 779/784 (99.36%), Postives = 781/784 (99.62%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEES VKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVK LL+EINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCI+EAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  886 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESMVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKFLLSEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIKEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1669          

HSP 2 Score: 1499.18 bits (3880), Expect = 0.000e+0
Identity = 775/784 (98.85%), Postives = 780/784 (99.49%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTD EI+ELCEDSSNKEVNMKILC+AIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEH+KDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLR FDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDK +NLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1670 IVQRKPTDLEIKELCEDSSNKEVNMKILCRAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHMKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRFFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKLKNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2453          

HSP 3 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 686/779 (88.06%), Postives = 700/779 (89.86%), Query Frame = 1
Query:   16 PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHL                            KD L++E +N+E  + +F      G+K                      I P   M +K+G   +++     +  SRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQN FAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  170 PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHL----------------------------KDLLESEEVNKEKDIIIF-----PGMK----------------------IKP---MLIKDGLKNELL-----NEESRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNWFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 885          

HSP 4 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 401/541 (74.12%), Postives = 434/541 (80.22%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNL 1623
            IVQRKPTD EIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENK INLSKMIECGMLNASENLVKIEKS+GEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLE+ E++  +D+I F G  +  + +KD ++ +L + ES V + + ++   +K   + G+ +  D++                                 +S L+ R N  +    C  ED     FDE   + K+L+    Q K LL         + F  LF V   ++ + L
Sbjct: 2454 IVQRKPTDLEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKEINLSKMIECGMLNASENLVKIEKSNGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLENGEIDVNRDLICFVGKTVLEVNVKDAIEQKLASLESFVMVTD-SVSDNMKKTVFFGNKKFIDIM---------------------------------LSFLNLRFNFAEIQKKCASEDMPLNNFDEISSEFKILS----QEKHLLF--------NNFHELFNVSFPSSAKAL 2948          

HSP 5 Score: 310.071 bits (793), Expect = 1.878e-89
Identity = 169/175 (96.57%), Postives = 172/175 (98.29%), Query Frame = 1
Query: 1816 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNP 2340
            MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNT+EYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDC+LHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNV   T+P
Sbjct:    1 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTDEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCKLHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNV--PTDP 173          
BLAST of SMED30010163 vs. Planmine SMEST
Match: SMESG000017520.1 (SMESG000017520.1)

HSP 1 Score: 1508.43 bits (3904), Expect = 0.000e+0
Identity = 779/784 (99.36%), Postives = 781/784 (99.62%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEES VKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVK LL+EINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCI+EAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  885 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESMVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKFLLSEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIKEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1668          

HSP 2 Score: 1497.64 bits (3876), Expect = 0.000e+0
Identity = 775/784 (98.85%), Postives = 780/784 (99.49%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTD EI+ELCEDSSNKEVNMKILC+AIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEH+KDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLR FDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDK +NLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1669 IVQRKPTDLEIKELCEDSSNKEVNMKILCRAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHMKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRFFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKLKNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2452          

HSP 3 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 687/784 (87.63%), Postives = 702/784 (89.54%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            I  + PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHL                            KD L++E +N+E  + +F      G+K                      I P   M +K+G   +++     +  SRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQN FAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  164 IEDKNPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHL----------------------------KDLLESEEVNKEKDIIIF-----PGMK----------------------IKP---MLIKDGLKNELL-----NEESRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNWFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 884          

HSP 4 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 401/541 (74.12%), Postives = 434/541 (80.22%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNL 1623
            IVQRKPTD EIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENK INLSKMIECGMLNASENLVKIEKS+GEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLE+ E++  +D+I F G  +  + +KD ++ +L + ES V + + ++   +K   + G+ +  D++                                 +S L+ R N  +    C  ED     FDE   + K+L+    Q K LL         + F  LF V   ++ + L
Sbjct: 2453 IVQRKPTDLEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKEINLSKMIECGMLNASENLVKIEKSNGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLENGEIDVNRDLICFVGKTVLEVNVKDAIEQKLASLESFVMVTD-SVSDNMKKTVFFGNKKFIDIM---------------------------------LSFLNLRFNFAEIQKKCASEDMPLNNFDEISSEFKILS----QEKHLLF--------NNFHELFNVSFPSSAKAL 2947          

HSP 5 Score: 307.76 bits (787), Expect = 1.078e-88
Identity = 168/175 (96.00%), Postives = 171/175 (97.71%), Query Frame = 1
Query: 1816 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNP 2340
            MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNT+EYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDC+LHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN    T+P
Sbjct:    1 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTDEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCKLHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN---PTDP 172          
BLAST of SMED30010163 vs. Planmine SMEST
Match: SMESG000045684.1 (SMESG000045684.1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 598/785 (76.18%), Postives = 651/785 (82.93%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENE-DVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V    C  +  + ++ Y GD  +  L+N LNEL+  L E + +L   +++    +IL   V +   K     + +   L  D      D   P+++ L  K+++V+ L+ E+      D     F V      +++ E V I + I C+A+S      TII+ VK   +D I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  416 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV----C-YDNKLAAISYYGDKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLK----DSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1190          

HSP 2 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 460/461 (99.78%), Postives = 461/461 (100.00%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQI 1383
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQ+
Sbjct: 1946 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQV 2406          

HSP 3 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 465/786 (59.16%), Postives = 578/786 (73.54%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE   ++   E ++ S L  ++ + D ++A L    +     E    ++ L  K DQ K  L EI+      K +N   +  G                    +SG+E  +TIII VKLQ+DD+ILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN+EEETNPKCFA
Sbjct: 1191 IVQRKPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE---ILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEISPPA---KEENRSILRYGP-------------------ISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNMEEETNPKCFA 1945          

HSP 4 Score: 410.609 bits (1054), Expect = 7.803e-124
Identity = 231/326 (70.86%), Postives = 256/326 (78.53%), Query Frame = 1
Query: 1393 SVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEI------NDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
             +I++  + +N+F  IN  +    D   FD    +    +  + +   L  +I       D   C +      +++   ++ L E V I DVI C A S NE  +T+I   + Q +++IL I EAIKENLINVEYQTCRC+RENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:   91 GIINKFGEILNIFQAINENILNVKDETFFDAQFEEEISWDKAYQKNYLLTMDIPENILTTDYIKC-RLAKQLQLYLSLEYKILFEGVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCDRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 415          
BLAST of SMED30010163 vs. Planmine SMEST
Match: SMESG000045684.1 (SMESG000045684.1)

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 598/785 (76.18%), Postives = 651/785 (82.93%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENE-DVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V    C  +  + ++ Y GD  +  L+N LNEL+  L E + +L   +++    +IL   V +   K     + +   L  D      D   P+++ L  K+++V+ L+ E+      D     F V      +++ E V I + I C+A+S      TII+ VK   +D I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  460 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV----C-YDNKLAAISYYGDKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLK----DSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1234          

HSP 2 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 460/461 (99.78%), Postives = 461/461 (100.00%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQI 1383
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQ+
Sbjct: 1990 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQV 2450          

HSP 3 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 465/786 (59.16%), Postives = 578/786 (73.54%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            IVQRKPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE   ++   E ++ S L  ++ + D ++A L    +     E    ++ L  K DQ K  L EI+      K +N   +  G                    +SG+E  +TIII VKLQ+DD+ILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN+EEETNPKCFA
Sbjct: 1235 IVQRKPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE---ILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEISPPA---KEENRSILRYGP-------------------ISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNMEEETNPKCFA 1989          

HSP 4 Score: 410.223 bits (1053), Expect = 8.946e-124
Identity = 231/326 (70.86%), Postives = 256/326 (78.53%), Query Frame = 1
Query: 1393 SVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEI------NDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
             +I++  + +N+F  IN  +    D   FD    +    +  + +   L  +I       D   C +      +++   ++ L E V I DVI C A S NE  +T+I   + Q +++IL I EAIKENLINVEYQTCRC+RENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  135 GIINKFGEILNIFQAINENILNVKDETFFDAQFEEEISWDKAYQKNYLLTMDIPENILTTDYIKC-RLAKQLQLYLSLEYKILFEGVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCDRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 459          
BLAST of SMED30010163 vs. Planmine SMEST
Match: SMESG000017522.1 (SMESG000017522.1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 575/764 (75.26%), Postives = 628/764 (82.20%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENE-DVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIM 2289
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V    C  +  + ++ Y  D  +  L+N LNEL+  L E + +L   +++    +IL   V +   K     + +   L  D      D   P+++ L  K+++ + L+ E+      D     F V      +++ E V I + I C+A+S      TII+ VK   +D I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM
Sbjct:  766 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV----C-YDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLK----DSEVPELRNLKMKYEEAEELMNEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM 1519          

HSP 2 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 460/461 (99.78%), Postives = 461/461 (100.00%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQI 1383
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQ+
Sbjct: 2271 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENEDVMQV 2731          

HSP 3 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 462/782 (59.08%), Postives = 574/782 (73.40%), Query Frame = 1
Query:   13 KPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
            KPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE   ++   E ++ S L  ++ + D ++A L    +     E    ++ L  K DQ K  L EI+      K +N   +  G                    +SG+E  +TIII VKLQ+DD+ILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1520 KPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFIGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE---ILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEISPPA---KEENRSILRYGP-------------------ISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2270          

HSP 4 Score: 408.297 bits (1048), Expect = 4.813e-123
Identity = 231/326 (70.86%), Postives = 255/326 (78.22%), Query Frame = 1
Query: 1393 SVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEI------NDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2352
             +I++  + +N+F  IN  +    D   FD    +    +  + +   L  +I       D   C +      +++   ++ L E V I DVI C A S NE  +T+I   + Q +++IL I EAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  441 GIINKFGEILNIFQAINENILNVKDETFFDAQFEEEISWDKAYQKNYLLTMDIPENILTTDYIKC-RLAKQLQLYLSLEYKILFEVVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 765          
The following BLAST results are available for this feature:
BLAST of SMED30010163 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
K1R1R13.028e-1027.50Bullous pemphigoid antigen 1, isoforms 6/9/10 OS=C... [more]
R7T9B71.749e-723.72SH3_10 domain-containing protein OS=Capitella tele... [more]
back to top
BLAST of SMED30010163 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010163 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017520.11.878e-8999.36SMESG000017520.1[more]
SMESG000017520.11.078e-8899.36SMESG000017520.1[more]
SMESG000045684.17.803e-12476.18SMESG000045684.1[more]
SMESG000045684.18.946e-12476.18SMESG000045684.1[more]
SMESG000017522.14.813e-12375.26SMESG000017522.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010163 ID=SMED30010163|Name=SMED30010163|organism=Schmidtea mediterranea sexual|type=transcript|length=2352bp
ATTGTACAAAGGAAGCCAACTGATCCAGAAATAGAAGAATTATGTGAAGA
TTCATCAAATAAAGAAGTGAATATGAAAATATTGTGCAAGGCAATTGAAT
GTGATTGCATGAATGAATTCCTGATTTATGACGATGTGAAAGAAAGTATT
GCGAAAAGCATATTCGAAAATCATTTAGAACTTGATCCAATGATTTGTGA
TGTAGACGGAGAAAAGCAAAGCATTTTGAAAGGATTCGTGAAAGGCGTGA
TCGATTCGGAAGAAATGAAACGGTTGTTAGAACACGTGAAAGATTTATTT
GCAGGAGAAATGCTAGAGACGATTGATGAAGATTCGAATGGAAAAGAAAT
AATTGAAGCTTTGAATAGAGAAGATCTGAAAGATAAATGTGCGGAAATGT
TAATAATTGATGAGAAGGATTTCACAATAGAAAGCGTATCAAAAATTGAT
GCAAATGACGAGAATAAGAAATATAGAACAAAGATTAATGTTGGAAATTT
ATTGAAAAGTCTTAATCAACTGAGATGTTTTGATAAATTTGGAATGGACA
CGATTGAAAATGCAGTAATTGGAAAGAATGAAGATAGTAAAGAAGAGTTC
GAAATGACAATATTTGAATCAGTAATGAACGGAACTTTGGATTTGGATGA
ATTGGGAATATTTGATGAGAAAGAAAAAGAAATGTGTTCAATGATTAAAA
GTGTGGAACGAGGACTGATTGATGTGAAAGCAGCAGAAAATATTTTGGAT
TGTTTAGAATCGATGAGCTTCGAAGAACTAATAAAAGCAAAAATATTTGA
CATTGAAAATAATTGTTTTGATAAAAATTTGTCATTGGAAGAAGCGATTG
AAGAGGATTTGTTGAGACCGGAAGTTGTATATTTGAATTTGTGTGAGGAA
AATAAAGTAATAAATTTAAGTAAAATGATTGAATGCGGAATGTTGAATGC
GTCGGAAAACTTGGTGAAGATAGAGAAAAGCGATGGCGAAATCATTGAAA
TGAAATTGAATGAAGCAGTGAAGGAAGAAAACGGAATTTTGTCAAGTGTC
GTGAACAGTGAAGAAATGAAAAAGCATTTTCCAAGACATTTGAAAGATTT
GTTAGAAAGCGAAGAAGTCAATAAAGAGAAAGACATAATAATATTTCCTG
GAATGAAAATAAAGCCAATGCTGATAAAGGATGGATTAAAGAATGAGCTG
TTGAATGAAGAATCAAGGGTGAAATTATTTGAATGCAATTTGGAAACCGG
AGTAAAGTCAATGGAATATTGTGGAGATTCCGAGGTGGCAGATCTTATCA
ATGATTTGAATGAATTATCAACGATATTACCGGAATTATTAATGAGTTTG
AAAAACGGAGAAAATGAAGATGTGATGCAAATATTAGAAACCTCTGTGAT
ATCCAGGTTAGATAAAAGAGTGAATTTATTTGATCGGATCAATGCATGTC
TGTGTGAAGATGCAGATAACGGCACTTTTGATGAAGGGAGACCTGATGTG
AAGGTTTTGAATGCAAAGTTTGATCAAGTTAAATCTTTGTTGGCAGAGAT
AAATGATCAAAAAAATTGTGACAAATTCCAAAATTTGTTTGCAGTTCATA
TCGGGGCAAATTTCCAAAATCTTTTAGAAAATGTTGGCATCACCGATGTG
ATAACATGCGACGCCGTTTCTGGAAATGAATGTGAGAAAACTATTATTAT
TGCCGTGAAGCTTCAAAATGATGATAAAATTCTTTGCATTGAGGAGGCAA
TTAAAGAGAACTTGATCAATGTGGAATATCAAACCTGCAGATGCAACAGA
GAAAATAAAGATGAAATGAGTTGGAAAAATGCAATCGAAGAGAAACTGAT
GATTGCATGTGAAATTAATAAAAACATAATTACAGAGGAATATATGAAAT
GTCTCATAGAAAGTAACACAAATGAATACATAAATACAGATGAAATGGAA
ATCCTCGGAGCAGTAAATACACGGAATAATAAACTATTGGAGACTAATGA
AGCAATTGAAGGGAAAATATTAGATTTGAATGGACATTTATTTATGGATG
AATTATCAAAGGGTTTGATACCATTGAGACAGGCAATTGACAGTGGATAT
GTGATGGCAAAGAAAAAGGATTCCGATTGTGAATTGCATCGAGTATTTGT
AGGATCTGTAAAAGTAGGTAAAGATCAACATGAAACGAGCTTGGAAGAAG
CGATAAAAGCTAAAGTTATTGATCAATTAGAAAATGTTTACAGAATCGAA
GAAGAAAACATTGAAATACGAATAATGGACGCGATAATGTTGGGAATGAT
AAAGATTGAAGACAAGAATGTGGAAGAAGAAACAAATCCTAAATGTTTTG
CA
back to top

protein sequence of SMED30010163-orf-1

>SMED30010163-orf-1 ID=SMED30010163-orf-1|Name=SMED30010163-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=784bp
IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESI
AKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLF
AGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKID
ANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEF
EMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILD
CLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEE
NKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSV
VNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNEL
LNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSL
KNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDV
KVLNAKFDQVKSLLAEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDV
ITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNR
ENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEME
ILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGY
VMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIE
EENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001101Plectin_repeat
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton