Protocadherin delta 1

Overview
NameProtocadherin delta 1
Smed IDSMED30010131
Length (bp)3543
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin delta 1 (SMED30010131) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin delta 1 (SMED30010131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin delta 1 (SMED30010131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin delta 1 (SMED30010131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010131SMESG000050290.1 SmedASXL_005352SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30010131SMESG000050290.1 SmedASXL_013764SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30010131SMESG000050290.1 dd_Smed_v6_16065_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010131SMESG000050290.1 dd_Smed_v6_32959_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010131SMESG000050290.1 OX_Smed_1.0.08339ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin delta 1 vs. Ensembl Human
Match: PCDHGA12 (protocadherin gamma subfamily A, 12 [Source:HGNC Symbol;Acc:HGNC:8699])

HSP 1 Score: 196.823 bits (499), Expect = 3.615e-51
Identity = 182/649 (28.04%), Postives = 300/649 (46.22%), Query Frame = 3
Query:  291 NIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTP-ILYTDLFQLTVEENTINYDRALLTFRPS---------DLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLY-LRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSD 2162
             +++I  G  Q F L+     +V   +ID E  ELC+    C   NLD        + E +  I  Y + + + DIND  P F++ +  ++  E   +   +  LP A D D  K N + +Y++    HFS   QN      DG S+ P L+L  ALD E K  + L L A+DG    + G   I V V+D N+ AP F++  +   SV E+   GT +  + ATD D   N  + +    +++ + A  F ++ ++G +  IGELD+E+   Y + + A D+A  S R      + I+++DVNDN PE+   +    S++ EN P  + +  L + D+DS +NG+V C F++    F L      +Y + ++ V DRE++  Y + +   D G P LST   +++ + D ND  P F   ++   + EN+P          G+S + V  HD       ++T+   +N     + +S + I+  +GVLY   + D E   + +++V   D+ H   +    + + V D+NDN P ILY  L      + +   + A  +  P          D DS    +        SE  L    L   ++   R  LDR+ +     V+ + D   HG   L  T  + V V+D
Sbjct:   63 GVRIIPRGRTQLFALNPRSGSLVTAGRIDRE--ELCMGAIKC-QLNLDI-------LMEDKVKI--YGVEVEVRDINDNAPYFRESELEIKISEN-AATEMRFPLPHAWDPDIGK-NSLQSYELSPNTHFSLIVQNG----ADG-SKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQP-EYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDD-KAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAK----VLITVLDVNDNAPEVVLTS--LASSVPENSPRGTLIALLNVNDQDSEENGQVIC-FIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNP---------RGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAPEILYPAL----PTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQ-SLVVAVQD---HGQPPLSATVTLTVAVAD 666          

HSP 2 Score: 112.464 bits (280), Expect = 1.621e-24
Identity = 150/595 (25.21%), Postives = 248/595 (41.68%), Query Frame = 3
Query:  732 LLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-FAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLD-KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT----NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQST--SEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP-----NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMI 2435
            L + A+ C+      LD+L  D     G   + V+V DIN+ AP F RE +    + E+           A D D   N+  +++L       + NT F++ + NG       +L +   LD E++  + + + A D   P+   ++ +  + + ++D NDN P   F     ++++ EN  + + +  +  TD D   N EV   F   +++      LD     I +    D EE   Y + +   D+   S    V +TVL  D ND  P+ +  +   SV ENSP  T +     N  +     QVI   I G L F ++  +           + YS V  +   +DRE    Y + V   D         T I ++V D NDN P+     +   + EN      +L++    D D   N     S  ++T     +  Y  ++ D   LY   S D E+    Q  +   D   +G+  L +   + + V DQNDN+P+ ++P      ST   L     EP G++V KV A D D G N  + Y   ++L   +  LF +  HTGE+      L     + + ++ +
Sbjct:   95 LCMGAIKCQLN----LDILMEDKVKIYG---VEVEVRDINDNAPYF-RESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYEL-------SPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPV---RTGTARIRVMVLDANDNAP--AFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVL--DVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICF-IQGNLPFKLEKSYG----------NYYSLVTDIV--LDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPR-GVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARD---NGHPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEP-GYLVTKVVAVDRDSGQNAWLSY---RLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAV 646          

HSP 3 Score: 87.8113 bits (216), Expect = 7.545e-17
Identity = 77/257 (29.96%), Postives = 124/257 (48.25%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLE--SLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDT-ENQKSTIRENQPISSP----VTFLKITDRDSNQNGEVTCRFLK-SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS 1565
            I + V D N+  P F +   S++ + E+  +G  +  + A D D   N  IT+ L   ++  A  ++  ++N   G L  +   DYE+ +   + ++A D+   P+S    S+ SL++ ++D NDN PE+ +       ST  E  P S+     VT +   DRDS QN  ++ R LK SE   F  GL     +  +  + DR+ + +  V +   DHG P LS +VTLTV +    D  PQ L++        NS
Sbjct:  438 ISLNVADTNDNPPVFPQASYSAY-IPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLS----SNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSATVTLTVAVA---DSIPQVLADLGSLESPANS 684          
BLAST of Protocadherin delta 1 vs. Ensembl Human
Match: PCDHGA12 (protocadherin gamma subfamily A, 12 [Source:HGNC Symbol;Acc:HGNC:8699])

HSP 1 Score: 197.208 bits (500), Expect = 6.537e-51
Identity = 181/649 (27.89%), Postives = 300/649 (46.22%), Query Frame = 3
Query:  291 NIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTP-ILYTDLFQLTVEENTINYDRALLTFRPS---------DLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLY-LRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSD 2162
             +++I  G  Q F L+     +V   +ID E  ELC+    C   NLD        + E +  I  Y + + + DIND  P F++ +  ++  E   +   +  LP A D D  K N + +Y++    HFS     + Q   DG S+ P L+L  ALD E K  + L L A+DG    + G   I V V+D N+ AP F++  +   SV E+   GT +  + ATD D   N  + +    +++ + A  F ++ ++G +  IGELD+E+   Y + + A D+A  S R      + I+++DVNDN PE+   +    S++ EN P  + +  L + D+DS +NG+V C F++    F L      +Y + ++ V DRE++  Y + +   D G P LST   +++ + D ND  P F   ++   + EN+P          G+S + V  HD       ++T+   +N     + +S + I+  +GVLY   + D E   + +++V   D+ H   +    + + V D+NDN P ILY  L      + +   + A  +  P          D DS    +        SE  L    L   ++   R  LDR+ +     V+ + D   HG   L  T  + V V+D
Sbjct:   63 GVRIIPRGRTQLFALNPRSGSLVTAGRIDRE--ELCMGAIKC-QLNLDI-------LMEDKVKI--YGVEVEVRDINDNAPYFRESELEIKISEN-AATEMRFPLPHAWDPDIGK-NSLQSYELSPNTHFSL----IVQNGADG-SKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQP-EYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDD-KAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAK----VLITVLDVNDNAPEVVLTS--LASSVPENSPRGTLIALLNVNDQDSEENGQVIC-FIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNP---------RGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAPEILYPAL----PTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQ-SLVVAVQD---HGQPPLSATVTLTVAVAD 666          

HSP 2 Score: 112.464 bits (280), Expect = 2.324e-24
Identity = 150/595 (25.21%), Postives = 248/595 (41.68%), Query Frame = 3
Query:  732 LLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-FAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLD-KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT----NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQST--SEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP-----NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMI 2435
            L + A+ C+      LD+L  D     G   + V+V DIN+ AP F RE +    + E+           A D D   N+  +++L       + NT F++ + NG       +L +   LD E++  + + + A D   P+   ++ +  + + ++D NDN P   F     ++++ EN  + + +  +  TD D   N EV   F   +++      LD     I +    D EE   Y + +   D+   S    V +TVL  D ND  P+ +  +   SV ENSP  T +     N  +     QVI   I G L F ++  +           + YS V  +   +DRE    Y + V   D         T I ++V D NDN P+     +   + EN      +L++    D D   N     S  ++T     +  Y  ++ D   LY   S D E+    Q  +   D   +G+  L +   + + V DQNDN+P+ ++P      ST   L     EP G++V KV A D D G N  + Y   ++L   +  LF +  HTGE+      L     + + ++ +
Sbjct:   95 LCMGAIKCQLN----LDILMEDKVKIYG---VEVEVRDINDNAPYF-RESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYEL-------SPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPV---RTGTARIRVMVLDANDNAP--AFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVL--DVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICF-IQGNLPFKLEKSYG----------NYYSLVTDIV--LDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPR-GVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARD---NGHPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEP-GYLVTKVVAVDRDSGQNAWLSY---RLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAV 646          

HSP 3 Score: 87.8113 bits (216), Expect = 7.432e-17
Identity = 77/257 (29.96%), Postives = 124/257 (48.25%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLE--SLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDT-ENQKSTIRENQPISSP----VTFLKITDRDSNQNGEVTCRFLK-SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS 1565
            I + V D N+  P F +   S++ + E+  +G  +  + A D D   N  IT+ L   ++  A  ++  ++N   G L  +   DYE+ +   + ++A D+   P+S    S+ SL++ ++D NDN PE+ +       ST  E  P S+     VT +   DRDS QN  ++ R LK SE   F  GL     +  +  + DR+ + +  V +   DHG P LS +VTLTV +    D  PQ L++        NS
Sbjct:  438 ISLNVADTNDNPPVFPQASYSAY-IPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLS----SNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSATVTLTVAVA---DSIPQVLADLGSLESPANS 684          
BLAST of Protocadherin delta 1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 192.971 bits (489), Expect = 2.105e-49
Identity = 176/646 (27.24%), Postives = 287/646 (44.43%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTH-FVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            K+   IEDIND  P F      +   E   ++  K  LP A+D D    N +  Y++  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F +E +   S+ E+   GT +  L ATD D   N  I F   +L +      F +N   G + +   LD E+   + + ++A D   +  R      + +++ DVNDN P +      +  N    + EN P+++ +  + +TD+D++ NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    S+ EN+       +    L K+   D D     E+ + +       +A     +D+ +G+L V   +DRE  ++Y   +   D+     T    ++V + D+NDN+P+   + ++  V EN   +    L+T    D    N+   +S      +     F +D     +R   S DRE+  S+ F ++  D    G     ++AKV + V D NDN P FI P   + + L +    P G VV +V A D D G N  V Y    I+     +LF +D+ TG I
Sbjct:  156 KIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGI-NGVQNYELIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM----VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN-------SPGIQLMKVSATDADSGPNAEINYLL-----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD-----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG---GRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY---SIVGGNTRDLFAIDQETGNI 765          

HSP 2 Score: 120.553 bits (301), Expect = 8.698e-27
Identity = 157/581 (27.02%), Postives = 248/581 (42.69%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKI--TDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVE 1889
            + ENS IN+   +P   D   P++ + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P FK+ +  V   E  P      QL   A D D  +  ++      FSN   N+ + L+   +    + +   LD E   ++ L +LA+DG     R ++ V V D+N+  P          +  +  + E+    T IA +  TD DA  N  +T        F+L  +     +N F        L+    LDYE  K Y+I ++A D+   P+++    S  L I + D NDN P   F       +I EN   S  +  +K+  TD DS  N E+           F   L  +   +   K  DRE+ D+Y   I+  D+G P L+++VT+ V I D+ND  P F  N ++F V EN P H T+     GL  +   D+     +T  I +++  D+ T    ID  +GV+    + DRE    Y   V   D   V       + ++V D NDN P+     +  + E
Sbjct:  180 IPENSAINSKYTLPAAVD---PDVGING---VQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLH--ATDADIGENAKI---HFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV----FSNQFL-------LENAAYLDYESTKEYAIKLLAADAGKPPLNQ----SAMLFIKVKDENDNAP--VFTQSFVTVSIPENN--SPGIQLMKVSATDADSGPNAEINYLLGPDAPPEF--SLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTV-----GLITVTDPDYGDNSAVTLSILDEN--DDFT----IDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYE 715          

HSP 3 Score: 111.694 bits (278), Expect = 4.133e-24
Identity = 157/570 (27.54%), Postives = 243/570 (42.63%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-----SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTH--FVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            V I   + DIN+ AP F   +  + S+ E++   +      A D D   N    ++L      ++ N F +++     GD    L V  ELD E++  Y + +   D      ++SS+  L +S+ D NDN+P  K +TE + S I EN P+ + VT L  TD D  +N ++   F       +   F LN        I   +  DREE   + + ++  D G   +     + V + D ND  P    +++ N  N    + EN P +T +      L  +   D D  G +T F D  H        +  +++  +L  A  +D E T EY +++   D+          +++ V+DENDN P+       +++ EN  +    L+    +D DS   G     +     D    F LD     L + K LDRE+   + F I   D   +G   L +   VFV + DQNDNSP F     TH  +   V  + P    VG +   DPD G+N  V      IL + D   F +D  TG I  N  F  E+   + F   + AED G
Sbjct:  155 VKIRFLIEDINDNAPLFPATV-INISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGG--FPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVS-IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTG---LITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKI-----ALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQF--LLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN-SPGIQLMKVSATDADS---GPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKD---NGVPPLTSNVTVFVSIIDQNDNSPVF-----THNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTL---SILDEND--DFTIDSQTGVIRPNISFDREKQESYTF--YVKAEDGG 681          

HSP 4 Score: 71.633 bits (174), Expect = 7.506e-12
Identity = 71/272 (26.10%), Postives = 122/272 (44.85%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRELTNE---------YRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLK---YFKLD---------HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            +I+I++ +G ++  GA IDRE             Y + V            I   +ED NDN P+    +  +++ EN+ IN    L    P+ +D       V  +   + +++K    F LD           +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P F     T   +++  + P+G  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I I  P   E+      +++ S
Sbjct:  106 LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTL----PAAVDP-----DVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS 362          
BLAST of Protocadherin delta 1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 192.971 bits (489), Expect = 2.134e-49
Identity = 178/644 (27.64%), Postives = 283/644 (43.94%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNST-HFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            K+   IEDIND  P F      +   E   ++  K  LP A+D D    N +  Y++  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F +E +   S+ E+   GT +  L ATD D   N  I F   +L +      F +N   G + +   LD E+   + + ++A D   +  R      + +++ DVNDN P +      +  N    + EN P+++ +  + +TD+D++ NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    S+ EN+     LT       K+  +D D          N     +A     +D  +G+L V   +DRE  ++Y   +   D+     T    ++V + D+NDN+P+   + +   V EN   +    L+T    D    N+   +S      +     F +D     +R   S DRE+  S+ F ++  D    G     ++AKV + V D NDN P FI P S   + L +    P G VV +V A D D G N  V Y    I+     +LF +D+ TG I
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGI-NGVQNYELIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM----VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT-------KVSAMDADSGPNAKI---NYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD-----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG---GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY---SIVGGNTRDLFAIDQETGNI 733          

HSP 2 Score: 117.857 bits (294), Expect = 5.932e-26
Identity = 153/568 (26.94%), Postives = 241/568 (42.43%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPI 1856
            + ENS IN+   +P   D   P++ + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P FK+ +  V   E  P      QL   A D D  +  ++      FSN   N+ + L+   +    + +   LD E   ++ L +LA+DG     R ++ V V D+N+  P          +  +  + E+    T IA +  TD DA  N  +T        F+L  +     +N F        L+    LDYE  K Y+I ++A D+   P+++    S  L I + D NDN P   F       +I EN      +T +   D DS  N ++           F   L  +   +   K  DRE+ D+Y   I+  D+G P L+++VT+ V I D+ND  P F  N + F V EN P H T+     GL  +   D+     +T  I +++  D+ T    ID  +GV+    + DRE    Y   V   D   V       + ++V D NDN P+
Sbjct:  148 IPENSAINSKYTLPAAVD---PDVGING---VQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLH--ATDADIGENAKI---HFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV----FSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQ----SAMLFIKVKDENDNAP--VFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEF--SLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTV-----GLITVTDPDYGDNSAVTLSILDEN--DDFT----IDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPV 672          

HSP 3 Score: 112.464 bits (280), Expect = 2.555e-24
Identity = 159/570 (27.89%), Postives = 245/570 (42.98%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-----SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            V I   + DIN+ AP F   +  + S+ E++   +      A D D   N    ++L      ++ N F +++     GD    L V  ELD E++  Y + +   D      ++SS+  L +S+ D NDN+P  K +TE + S I EN P+ + VT L  TD D  +N ++   F       +   F LN        I   +  DREE   + + ++  D G   +     + V + D ND  P    +++ N  N    + EN P +T +      L  +   D D  G +T F D  H        +  +++  +L  A  +D E T EY +++   D+          +++ V+DENDN P+       +++ EN  N     LT + S +D+ ++G     +     D    F LD     L + K LDRE+   + F I   D   +G   L +   VFV + DQNDNSP F     TH   N    E  P    VG +   DPD G+N  V      IL + D   F +D  TG I  N  F  E+   + F   + AED G
Sbjct:  123 VKIRFLIEDINDNAPLFPATV-INISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGG--FPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVS-IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTG---LITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKI-----ALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQF--LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN--NSPGIQLT-KVSAMDA-DSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKD---NGVPPLTSNVTVFVSIIDQNDNSPVF-----THNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTL---SILDEND--DFTIDSQTGVIRPNISFDREKQESYTF--YVKAEDGG 649          

HSP 4 Score: 103.99 bits (258), Expect = 9.713e-22
Identity = 102/357 (28.57%), Postives = 162/357 (45.38%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND 1790
            LD E+   Y + LLA D AGK       ++ +KV D N+ AP F++    + S+ E+   G  +  + A D D+ PN  I + L      +    F+++   G L V+ +LD EK+  Y  TI+A D+   P++    S+ ++ +SIID NDN P    +  N    + EN P    V  + +TD D   N  VT   L   + F ++    +   I  N  FDRE+ + Y   +   D G  S S+S  +T+ + D ND  P F+          N  +   L ++N G    QVI    D  +  E+ + I   +T D    +  ID+ +G + +    D      +R+ V  ND
Sbjct:  424 LDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSF-VTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLL----GPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLT----SNVTVFVSIIDQNDNSPVFTHNEYN--FYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS---QTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP------PSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD----LFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755          

HSP 5 Score: 72.0182 bits (175), Expect = 6.161e-12
Identity = 71/272 (26.10%), Postives = 122/272 (44.85%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRELTNE---------YRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLK---YFKLD---------HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            +I+I++ +G ++  GA IDRE             Y + V            I   +ED NDN P+    +  +++ EN+ IN    L    P+ +D       V  +   + +++K    F LD           +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P F     T   +++  + P+G  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I I  P   E+      +++ S
Sbjct:   74 LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTL----PAAVDP-----DVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS 330          
BLAST of Protocadherin delta 1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 192.971 bits (489), Expect = 2.149e-49
Identity = 193/674 (28.64%), Postives = 302/674 (44.81%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP--ELKFDTENQKSTI--RENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ++F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + E+   GT +  L ATD D   N  I +   +     T   FA+N   G + V   LD E+  I+ +T++A D +    R +    +TI++ DVNDN P  +L++       T+   E  P+++ +  + ++D+D++ NG+V C F++ E  F L  + D  Y +E++ + D E    +   I+  D G PSL+ +  + V +EDEND  P F       SV EN+    + TT++ ++    K    + DI+ +L           NA S   +D+ +GVL  +   DRE    +   V   D+          + V V DENDN+P    + FQ  V EN   Y    ++T   +D    N    +S        VL  +      +    S DRE+ SS+ F ++ +D    G     +TAKV + V D NDNSP  I P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +              ++ IS  DLG  K
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFPIPSATDPD-TGFNGVQHYELL---NGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF-KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK----NADIVYQL---------GPNA-SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADA-GENKAVTLSILNDNDNFVLDPYS---GVIKSNVSFDREQQSSYTFDVKATDG---GQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKY---TIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNIS--DLGYPK 762          

HSP 2 Score: 121.709 bits (304), Expect = 2.892e-27
Identity = 164/564 (29.08%), Postives = 235/564 (41.67%), Query Frame = 3
Query:  822 LIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKST-IRENQPISSPVTFLKITDRDSNQNGEV----TCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTL-------TNSNNGLSKIQVIDHDIIGELTFFIDN------KHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDST-NTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNF 2423
            LI +K+I  D N+ AP F   + +  S+ E+T+  +      ATD D   N    ++L  LN         +    G+    L V   LD E++  Y + I   D    + +KSS+  L +++ DVNDN P  K   E Q    I EN P+ + V  L  TD D   N E+      +   +  R F   L +    I   +  DREE   + V ++  D    S     T+T+ + D ND  P     + R+ +   SP + T+        N+   L  +   D D+ G++  FI+       K   DN        +Y  +L  +  +D E T E+  ++  +DS          + V +EDENDN PI    + +L+V EN       L T   +D DS  N         + S     +F LD     L  S   DREE   F F +   D   +G   L + A V V V D+NDNSPKF      HF   VS + P    VG +   D D G N  V      IL D D   F LD ++G I  N  F  EQ   + F
Sbjct:  125 LIKIKIIVKDTNDNAPMFPSPVIN-ISIPENTLINSRFPIPSATDPDTGFNGVQHYEL--LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGG--TPQKSSTAILQVTVSDVNDNRPVFK---EGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLF--ALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNI---DLRYII---SPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDN--------QY--LLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENN-RRGLYLTTISATDEDSGKNADIVYQLGPNAS-----FFDLDRKTGVLTASRVFDREEQERFIFTVTARD---NGTPPLQSQAAVIVTVLDENDNSPKFTH---NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTL---SILNDND--NFVLDPYSGVIKSNVSFDREQQSSYTF 643          

HSP 3 Score: 116.701 bits (291), Expect = 1.011e-25
Identity = 149/572 (26.05%), Postives = 245/572 (42.83%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIV----LVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS--ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITY--QIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNI--------TFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE---LTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPIL 1859
            + EN+ IN+   IP   D   P+      GFN   H +    + V    +V+  + E     +  QN   E  D  +V  I++ +        T  L + + D+ND  P FK+ Q  V   E    VG   +   A D D    N  I Y      +   + LF L  + T+    + +  +LD E    + + +LA+DG+    R  + + V D+N+  P          +  +  + E     T IA +  +D D   N  +         F L+++ + +             L+    LDYE  K +S  I+A DS   S  +++   + + + D NDN P   F+    + ++ EN      +T +  TD DS +N ++  +   + + F L+    K   + +++VFDREE +R+   +   D+G P L +   + V + DEND  P+F  N+F+F V EN P ++T       +  I V D D  GE   +T  I N    DN   V  +D YSGV+    + DRE  + Y   V   D           + ++V D NDN+P++
Sbjct:  151 IPENTLINSRFPIPSATD---PDT-----GFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDT-YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPEN-APVGTSVIQLHATDADIGS-NAEIRYIFGAQVAPATKRLFAL--NNTTGL--ITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL-----------LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTAL--VRVKLEDENDNPP--IFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLD---RKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYST-------VGVITVTDAD-AGENKAVTLSILN----DNDNFV--LDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVV 675          

HSP 4 Score: 92.4337 bits (228), Expect = 3.639e-18
Identity = 103/394 (26.14%), Postives = 179/394 (45.43%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQ-IESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQV----IDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVE 1889
            LD E    +   ++A+D +GK       L+ VK+ D N+  P F++ +    SV E+  +G  +  + ATD D+  N +I ++L        A+ F ++   G L      D E+Q+ +  T+ A D+   +    S  ++ ++++D NDN P  KF   + +  + EN P  S V  + +TD D+ +N  VT   L   + F    +LD +   I+SN  FDRE+   Y  ++   D G P  S++  +T+ + D ND  P  +S         N+ F     ++  G    +V    +D  +  EL + I     S N   + +ID  +G + +           +RL V  +D     S+H +   +++ V D   N   +Y DL + T+E
Sbjct:  427 LDYEGTKEFSFKIVASD-SGKPSLNQTALVRVKLEDENDNPPIFNQPVIE-LSVSENNRRGLYLTTISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNG--TPPLQSQAAVIVTVLDENDNSP--KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNF----VLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP------PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTI----VSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVL-VFLYVNDTAGNASYIY-DLIRRTME 793          

HSP 5 Score: 60.4622 bits (145), Expect = 2.363e-8
Identity = 92/333 (27.63%), Postives = 142/333 (42.64%), Query Frame = 3
Query:  216 TLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGFNQY-FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP 1196
            T++L E  P+NT I +   +DK    N KVI     +  FHL     K V   Q  LE S L        D     +F F I   +     L  T  + + +ED ND  P F Q    +   E  +  G       A D+D S KN  I YQ+     G N     +D   +   L      D E +  +I  + A D      + +  + V V+D N+ +P+F+      F V E+  K + +  +  TD DA  N  +T  + + N     + F ++ ++G +K     D E+Q  Y+  + A D       +SS+  +TI+++DVNDN P
Sbjct:  370 TVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHL-----KAVYDNQYLLETSSL-------LDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRR-GLYLTTISATDED-SGKNADIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDN-----DNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG--QPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin delta 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 184.111 bits (466), Expect = 1.412e-46
Identity = 197/765 (25.75%), Postives = 352/765 (46.01%), Query Frame = 3
Query:  225 LKENSPINTTI---------DIPVFNDKLFPNIKVIGDGFNQ-YFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIE--DINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND--SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            L E++PI T I           P++   + P      D  +Q  F LD    +I L K +D               E LD K +  +  +E+    ++    + +   D+ D +P F++  Y+ E  E    +G   L   A D D S +N  I Y +   NG +NL  +     +++  +     LD ET     LD++A+D     +E   ++ + V+D+N+ AP F+ +   + ++ E+     VIA ++ATD D   N  + +   S+ ++       ++   G++ +   +D +   I ++ I A D A      SS+  LTI++ID+ND+ P L      +  T+ EN  I   V  +   D DS  NG +      SE+ F ++   GL      I++ K+ DRE   RY + +   D G PSL+TS T+ V+++D ND  P F    +  ++ E  P  + +         ++ +D+D   ++T+ I+         S++ I     +L V+G + R+  ++ R+ +   D   +   C  + V ++D N + P      F + + E++ I Y   ++T +  D D  +   R+ +    S D  ++F++D     + +   LDRE+ ++F  ++  SD   H +  L T+ ++ V + D NDNSP+F    S+ +   +S   P+G    +V A D D+G NG V Y +++      + LF LDR +G + ++S    EQF     ++ I A D G
Sbjct:  174 LPEDTPIETIIASVKASHASSQPLYYSMVAPQ-----DSRSQNLFTLDTMSGEIRLAKSMD--------------REVLD-KHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIRED-APIGTTVLSVFARDLD-SGENGEIEYSLGEGNG-KNLLAI----NAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASD-SYNVTILENITIPAVIATVKATDEDFGTNGKVHY---SMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGA--QPALSSTVPLTINVIDINDHAPTLI--AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-FIIDEDSGL------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT-------LKAVDNDEDQKITYRIE--EADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGGLQGRCV-VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGY--PVITLKAEDHDRGDNA-RIVY----SIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD---HASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAV--IVLPIFARDRG 868          

HSP 2 Score: 136.732 bits (343), Expect = 5.439e-32
Identity = 190/761 (24.97%), Postives = 324/761 (42.58%), Query Frame = 3
Query:  204 IEIKTLFLKENSPI------NTTIDIPVFNDKLFPNIKVIGD--GFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCK---FVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSD-LDSTNTGFRVSFDQSTSEDVLKYFKLDHD-------KLYLRKSLDRE-EISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPF 2393
            +EI  + + +N+P+      N TI   +    +   +K   +  G N   H   + +  +    ID    E+ +       E +D K      +IR  +     L  T  L I + DIND  P     Q  +   E   ++G++     AID+D S  N +I Y +    G ++       G  +   LL     D ET   Y L + A D           + V+  DIN+ AP F ++ + + ++ E   +G+ I  L+A DND   +  IT+++E  +  E  +   +      L V GEL  +  K+  + I A D   +  R      + + I DVN       F+       I E+ PI  PV  LK  D D   N  +   +    ++FF          + S+   DRE+   + V +   DH  P L+TS  + V+++D ND  PQF S+++  ++ E+ P  T+         ++  ID DI   G + +F+ N+ +S  +  + ++D+ SG L V+  +DRE      L +   D    S+    ++I + + D NDN P      + L + EN+ +      +  R +D  D+ +  FR+ F  + +    K F ++ D       ++  R   D E + + F F +Q S      + QL +T  V + VSD NDN P          ++N   +  +   +G + AFDPD   N T+ Y     L + D  L   +++TG+I +   +
Sbjct:  361 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR------ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN-VAIGEEVGRVYAIDED-SGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK-EYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADR-EVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGR----CVVNVFIDDVNS---APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV--YSIDSSQFFRIDPSSGDISVSSD--LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-------QVSAIDADIGPNGIVDYFL-NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAA-SEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI-FGGADA----KLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS------SGQLSSTVPVRIHVSDVNDNKPAL---KDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEY----FLEEND--LIEAEKYTGKILVKQEW 1058          

HSP 3 Score: 133.65 bits (335), Expect = 4.451e-31
Identity = 164/639 (25.67%), Postives = 273/639 (42.72%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEG---PKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLL-ANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFF-LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSF-DQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLD 2357
            T  + I + D+ND  P F    Y V   E    P  +   +    A D+DF   N  + Y +  S+G   L      G      + L   +D   K+  I  ++ A DGA       V + + VIDIN++AP      K   ++ E+   G  +  + A D D+ PN  I + +E       +  F ++  +G +K    LD E    YS+ + A D    S   S++ ++ +   D+NDN P   FD +    TI E  P  S +  LK  D D +Q  ++T R  +++   F +  + D+   +  +    R++  +  V I   D G   L     + V I+D N   P F  + F   + E+SP    +         ++  DHD      + + ID       ++   +ID  SG + V+  +DRE    + + V  +D         T I V ++D NDN+P   +  +  T+ E+ I    + L     D D    G    F ++S+S   ++ F+LD     LR S  LDRE+ +     I   D+   G   L   +++ + +SD NDN+P F       + L ++ + P+G  VG + A D D G+N  + +   +I    D  LF ++
Sbjct:  358 TAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVK----ATDEDFGT-NGKVHYSMASSSGIGGLTIDYSTG-----EVTLRERID--AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKM-ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLK--DINDNAP--TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG--GLQGRCVVNVFIDDVNSA-PYFNDHPFSVKIPEHSPIGYPVIT-------LKAEDHDRGDNARIVYSID-------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED-IPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR---GTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF---RIFGGADAKLFDIE 943          
BLAST of Protocadherin delta 1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 160.229 bits (404), Expect = 2.927e-39
Identity = 146/552 (26.45%), Postives = 267/552 (48.37%), Query Frame = 3
Query:  822 LIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND--SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            ++ + V+D+N+ AP F+ +   + ++ E+     VIA ++ATD D   N  + +   S+ ++       ++   G++ +   +D +   I ++ I A D A      SS+  LTI++ID+ND+ P L      +  T+ EN  I   V  +   D DS  NG +      SE+ F ++   GL      I++ K+ DRE   RY + +   D G PSL+TS T+ V+++D ND  P F    +  ++ E  P  + +         ++ +D+D   ++T+ I+         S++ I     +L V+G + R+  ++ R+ +   D   +   C  + V ++D N + P      F + + E++ I Y   ++T +  D D  +   R+ +    S D  ++F++D     + +   LDRE+ ++F  ++  SD   H +  L T+ ++ V + D NDNSP+F    S+ +   +S   P+G    +V A D D+G NG V Y +++      + LF LDR +G + ++S    EQF     ++ I A D G
Sbjct:    1 MVEITVVDVNDNAPVFASD-SYNVTILENITIPAVIATVKATDEDFGTNGKVHY---SMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGA--QPALSSTVPLTINVIDINDHAPTLI--AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-FIIDEDSGL------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT-------LKAVDNDEDQKITYRIE--EADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGGLQGRCV-VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGY--PVITLKAEDHDRGDNA-RIVY----SIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD---HASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAV--IVLPIFARDRG 509          

HSP 2 Score: 136.732 bits (343), Expect = 5.684e-32
Identity = 190/761 (24.97%), Postives = 324/761 (42.58%), Query Frame = 3
Query:  204 IEIKTLFLKENSPI------NTTIDIPVFNDKLFPNIKVIGD--GFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCK---FVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSD-LDSTNTGFRVSFDQSTSEDVLKYFKLDHD-------KLYLRKSLDRE-EISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPF 2393
            +EI  + + +N+P+      N TI   +    +   +K   +  G N   H   + +  +    ID    E+ +       E +D K      +IR  +     L  T  L I + DIND  P     Q  +   E   ++G++     AID+D S  N +I Y +    G ++       G  +   LL     D ET   Y L + A D           + V+  DIN+ AP F ++ + + ++ E   +G+ I  L+A DND   +  IT+++E  +  E  +   +      L V GEL  +  K+  + I A D   +  R      + + I DVN       F+       I E+ PI  PV  LK  D D   N  +   +    ++FF          + S+   DRE+   + V +   DH  P L+TS  + V+++D ND  PQF S+++  ++ E+ P  T+         ++  ID DI   G + +F+ N+ +S  +  + ++D+ SG L V+  +DRE      L +   D    S+    ++I + + D NDN P      + L + EN+ +      +  R +D  D+ +  FR+ F  + +    K F ++ D       ++  R   D E + + F F +Q S      + QL +T  V + VSD NDN P          ++N   +  +   +G + AFDPD   N T+ Y     L + D  L   +++TG+I +   +
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR------ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN-VAIGEEVGRVYAIDED-SGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK-EYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADR-EVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGR----CVVNVFIDDVNS---APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV--YSIDSSQFFRIDPSSGDISVSSD--LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-------QVSAIDADIGPNGIVDYFL-NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAA-SEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI-FGGADA----KLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS------SGQLSSTVPVRIHVSDVNDNKPAL---KDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEY----FLEEND--LIEAEKYTGKILVKQEW 699          
BLAST of Protocadherin delta 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 146.747 bits (369), Expect = 4.812e-35
Identity = 185/710 (26.06%), Postives = 311/710 (43.80%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQY--YVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHF-SNGGQ------NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEF--SRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLES----LNNAETANTFAMNLHNG----DLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFD----------TENQKSTIRENQPISSPVTFLKI-TDRDSNQNGEVTCRFLKSEN-----RFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTS-------VTLTVLIEDENDQDPQFLSNNFRFSVKEN-SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSF--DQSTSEDVLKYFKLDHDKLYLRKSLDREE---ISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPI---GHVVGKVQA--FDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + ++ + DIND +P F++  Y   V  +E   +VG   +   A D D +  N  ITY +   +  G+      + F+L+     ++  + L+  +  +T+  +I +++A+D    E       + + V+D  + AP++  S + K   +V E+     VI   +A  +    N+++ +KL +     N AE+         NG    ++ ++  LDYE+   Y++T+ A D   ++ R +S+ +  + + DVND  P+   D          T N+       +PI   VT   I TD D  QN EV  R +   N      F ++ L  + +    N+ FDRE+ID Y + +   D    +L  +       V + ++I D ND  P F    +   VKE+    H  +T   + L K   + + +IG     I     +D           SG ++V   +D E +++Y L +  +D  H   T++Y+ +ED NDN P      +  TV E  ++  + L     +D D      R+ +  +   +++V +  K     + L K+LDR+    + S+ FV+Q  D   +G   L   A V V V D NDNSP  IFP    F       EPI   G     VQA  FD     N  + Y I +       ++F +D++TG+IF       E      FII + A D G
Sbjct:  964 QFSVEVVDINDNSPQFERPSYETSVSRFE---AVGTSVITVFAFDND-AAHNAEITYSLEIDTTAGEEHQNDLDFFELV---NRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD---MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPI---VTVKAIDTDSDGPQN-EVHYRIVGEANGEETKHFRIDELTGEIF---PNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTD-----------SGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKY-SGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNG---LVGYADVQVNVRDINDNSP--IFPERL-FGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRG 1637          

HSP 2 Score: 107.071 bits (266), Expect = 5.863e-23
Identity = 146/580 (25.17%), Postives = 258/580 (44.48%), Query Frame = 3
Query:  822 LIHVKVIDI--NEYAPEFSRELKSSFSVHESTVKGTVIAHLQATD----NDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQ---KIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFL-SNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLY----VAGAIDRELTNEYRLRV-------CC--NDSIHVVCTDIYVDVEDENDNTP-----ILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTG---FRVSFDQSTSEDVLKYFKLDHDKLYLRKS----LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIY--EISKILPDK---DLNLFHL-DRHTGEIFINSPF-LSEQFCRFNFI 2426
            L  V +++I  +E  P+F+++ +   +V E  +    +  ++A       D      IT+ LE     +    F ++   G + +   LD++     K++ + + A +     + + S   LTI I DVNDN P   F      + +RE+ P++  +  +   D+D+  N  +T            NG +    +++++++ +R  + R+  N+   DHG+P SLS+S  + +  E+ ND+   FL ++ +   V E++   T +        +IQ  D D   E+T+ F+D    S    ++  ID+++G++     V+ A   E  N   L V       CC      H     + + +ED N+N P       Y+D+ ++   E T   D   ++    +D DS+  G   + + + QS S    K F +D     L  S     DRE        ++ +D+   G+  L    +  V+V D NDNSP+F  P+   +  +VS  E +G  V  V AFD D  +N  + Y  EI     ++   DL+ F L +R +GEI +  P  +  Q   FN I
Sbjct:  513 LSEVAILEILADERPPQFAKQ-EYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTARE-----DNRESHVDLTIRIDDVNDNVP--TFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRF--NVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVI-------QIQARDADR-DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIM--EGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESR---KAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDR---GDRPLIGFCQFSVEVVDINDNSPQFERPS---YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI 1063          

HSP 3 Score: 105.531 bits (262), Expect = 1.996e-22
Identity = 145/586 (24.74%), Postives = 255/586 (43.52%), Query Frame = 3
Query:  636 KNRMITYQIHFSNGGQNLFQLLY------DGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHV-KVIDINEYAPEFSREL-------KSSFSVHESTVKGTVIAHLQATDNDA-YPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD---SAPISERKSSSFSLTISII--DVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKI----QVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDREL-----TNEYRLRVCCNDSIHVVC-TDIYVDVEDENDNTPILYTDLFQLTVEEN--TINYDRA-LLTFRPSDLD---STNTGFRVSFDQSTSEDVLKYFKLDHD--KLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPD 2279
            +N  + Y++  S G  N  +  +      +  ++   ++++  LD E  ++Y L L A D   +       V +V D+N+  P+F+ +L       + + + H     G  I  ++A D D+  P N + +++    N E    F ++   G++    + D EK  +Y +T+ A D   SA       +  ++ + I+  DVNDN P   F+ +     ++E++     V  +K  D D + N  +    + +       G+      I   +  D E  D+Y + +I  D G  + +T+V   + IED ND  PQF          E   + TT+   +  + K+       D D   E +  I  +     A  V +I KYSG + +  A+DR+      +  + ++   +D   +V   D+ V+V D NDN+PI    LF   +EEN   I+ D    +  +  D D   + N        ++   +    F++D +  K++  +SLDRE  S  +F+I++   +  G       A V +KV+D NDN+P F     T +  +V    PIG  V    AFD D
Sbjct: 1127 RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAP--SFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVY--IHIEDVNDNAPQF----------EQQKYATTVIEEDVDIPKVLFNVHATDADQ-DEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVR-ANDRGVPSREGFANVTIKVTDMNDNAPFF---EKTRYEGSVEETAPIGAAVMSFSAFDAD 1689          

HSP 4 Score: 90.1225 bits (222), Expect = 9.403e-18
Identity = 184/775 (23.74%), Postives = 315/775 (40.65%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELC-VHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHH-YILDLLANDGAGK---EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAET--ANTFAMNLHNGDLKV---IGELDY-EKQKIYSITIIAYDSAPI----SERKSSSFSLTISIIDVNDNYPELKFDTE-NQKSTIRENQPISSPVTFLKI--TDRDSNQNGEV--TCRFLKSENR--FFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI---------HVVCTD------------IYVDVEDENDNTPILYTD---LFQLTVEENTINYDRALLTFRP-SDLDSTNTGFRVSFDQST-----SEDVLKYF-KLDHD----KLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKF---IFPNS--THFVLNVSCHEPIGHVVGKVQAFDPDL-GNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAED 2447
            ++F +D S   I L + +D +D  L  +H           K     R   +++ +    L I I+D+ND  P F +  Y  +  E    + Q  L   A+DKD    +R ITY +   N     F +  +G   A   + L+A     +H  Y  ++ A D           +IH++  + N+ +  F    + +  V E    GT +  +QA D D    + +T+     N   T   N F+++ H G +K+   +   D  E +   ++T+I  D        S+  +S  +L I I DVN+N PE     + +  + I E    + P T +K+  TD DS+ NG++  +  + +SE+R  F ++   G+L     +    VFDRE   R  V +   D GD  L      +V + D ND  PQF   ++  SV                 S+ + +   +I    F  D  H ++  T  ++ID  +G  +       EL N     +     I         +V+  D            + ++V D+    P   T       +TV+EN +  ++ +L  R  S  DS N+        S      +E   + F K ++     ++ + + LD E+++++   +  +D      S++ +T    V+V D ND  P+F   +F  +       N    +  G  +  V+A D D  G    V Y I      ++   F +D  TGEIF N  F  E+     +I+ + A D
Sbjct:  583 KWFRIDPSTGIIHLTRLLDFDDPALPKLH-----------KLKVTAREDNRESHV---DLTIRIDDVNDNVPTFTRPLYTAQVRED-IPLNQTILKVTAVDKDTGDNSR-ITYSVDNHN-----FSINSNGEISAK--VRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHV----VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-----------------SRFEAVGTSVITVFAFDNDAAHNAE-ITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDEN-VELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM----TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDM--YILTVEASD 1302          

HSP 5 Score: 80.8777 bits (198), Expect = 6.351e-15
Identity = 130/535 (24.30%), Postives = 213/535 (39.81%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL-LYDGTSQAPNLLLLNALDCE-----TKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVK--GTVIAHLQATDND--AYPNNNITFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYE--KQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKV------FDREEI---DRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD-IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKL 2018
            T  + I IED+ND  P F+Q++Y     E    + +      A D D  +K+  I Y++    G   +F++  Y GT     + L+ ALD +        ++++  + +DG G  G   + V V DIN+ +P F   L      +   +   G     +QA D D     N NI + +    L N E+   F ++ + G +  +  LD E   ++ + I + A D    S  +    ++TI + D+NDN P   F+    + ++ E  PI + V      D D      V    L  E+ +F     DK  +  S  V       D E++   D + + I   D           + V + D ND  P  +       V+E+ P  T+       + +    D D  G+   F  N+ +       I  D   G L VA  +DRE    Y L +   D+ + +    + V ++D NDN P  YT        ENT          R +D D+   G   + + S S    +Y  +
Sbjct: 1419 TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLE-GQGADEVFRIGKYSGT-----IELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES--VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS--REGFANVTIKVTDMNDNAP--FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYV-TTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPH-IHGATEHRVREDVPRGTS-------IGRYTATDRD-AGDTARFRINRQSDPKRQFTIDQD---GTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNV 1925          

HSP 6 Score: 76.2554 bits (186), Expect = 1.691e-13
Identity = 107/461 (23.21%), Postives = 198/461 (42.95%), Query Frame = 3
Query:  297 KVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQY-YVEFYEGPKSVGQKQLLPIAIDKDF---SKKNRMITYQIHFSN--GGQNLFQLLYDGTSQAPNLLLLNALDCE--TKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNI-TFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYE---KQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD 1631
            ++ G G ++ F + K    I LVK +D  D    V + N   + +D     L+   + Q         + + DIND +P F +R + Y+E    P        + +   +DF   + +N  I Y I  +    G+++F++          +  + +LD E  ++  +I+++ AND     +EG   + +KV D+N+ AP F +  +   SV E+   G  +    A D D    +N+ T++L  ES     T +  +     G L+V   LDYE   ++  + + I   D      R  +  ++ ++++D ND+ P +   TE++   +RE+ P  + +     TDRD+               R F    +D+   +      DRE+I  Y  N+I   + + +      + V ++D ND  P+  +       +EN+P +        G  +I+  D D
Sbjct: 1476 RLEGQGADEVFRIGKYSGTIELVKALD-RDPPAGVPSWNFVVQAIDDDGNGLVGYADVQ---------VNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQA-RDFDDPTTENANIEYGIVRNKLINGESVFRI----DQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEK-TRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-----RHDAEAAVHVALVDRNDHAPHIHGATEHR---VREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQF---TIDQDGTLRVAHTLDREDIAVY--NLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL------GTCEIRATDRD 1901          
BLAST of Protocadherin delta 1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 146.747 bits (369), Expect = 4.812e-35
Identity = 185/710 (26.06%), Postives = 311/710 (43.80%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQY--YVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHF-SNGGQ------NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEF--SRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLES----LNNAETANTFAMNLHNG----DLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFD----------TENQKSTIRENQPISSPVTFLKI-TDRDSNQNGEVTCRFLKSEN-----RFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTS-------VTLTVLIEDENDQDPQFLSNNFRFSVKEN-SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSF--DQSTSEDVLKYFKLDHDKLYLRKSLDREE---ISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPI---GHVVGKVQA--FDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + ++ + DIND +P F++  Y   V  +E   +VG   +   A D D +  N  ITY +   +  G+      + F+L+     ++  + L+  +  +T+  +I +++A+D    E       + + V+D  + AP++  S + K   +V E+     VI   +A  +    N+++ +KL +     N AE+         NG    ++ ++  LDYE+   Y++T+ A D   ++ R +S+ +  + + DVND  P+   D          T N+       +PI   VT   I TD D  QN EV  R +   N      F ++ L  + +    N+ FDRE+ID Y + +   D    +L  +       V + ++I D ND  P F    +   VKE+    H  +T   + L K   + + +IG     I     +D           SG ++V   +D E +++Y L +  +D  H   T++Y+ +ED NDN P      +  TV E  ++  + L     +D D      R+ +  +   +++V +  K     + L K+LDR+    + S+ FV+Q  D   +G   L   A V V V D NDNSP  IFP    F       EPI   G     VQA  FD     N  + Y I +       ++F +D++TG+IF       E      FII + A D G
Sbjct:  964 QFSVEVVDINDNSPQFERPSYETSVSRFE---AVGTSVITVFAFDND-AAHNAEITYSLEIDTTAGEEHQNDLDFFELV---NRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD---MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPI---VTVKAIDTDSDGPQN-EVHYRIVGEANGEETKHFRIDELTGEIF---PNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTD-----------SGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKY-SGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNG---LVGYADVQVNVRDINDNSP--IFPERL-FGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRG 1637          

HSP 2 Score: 107.071 bits (266), Expect = 5.863e-23
Identity = 146/580 (25.17%), Postives = 258/580 (44.48%), Query Frame = 3
Query:  822 LIHVKVIDI--NEYAPEFSRELKSSFSVHESTVKGTVIAHLQATD----NDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQ---KIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFL-SNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLY----VAGAIDRELTNEYRLRV-------CC--NDSIHVVCTDIYVDVEDENDNTP-----ILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTG---FRVSFDQSTSEDVLKYFKLDHDKLYLRKS----LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIY--EISKILPDK---DLNLFHL-DRHTGEIFINSPF-LSEQFCRFNFI 2426
            L  V +++I  +E  P+F+++ +   +V E  +    +  ++A       D      IT+ LE     +    F ++   G + +   LD++     K++ + + A +     + + S   LTI I DVNDN P   F      + +RE+ P++  +  +   D+D+  N  +T            NG +    +++++++ +R  + R+  N+   DHG+P SLS+S  + +  E+ ND+   FL ++ +   V E++   T +        +IQ  D D   E+T+ F+D    S    ++  ID+++G++     V+ A   E  N   L V       CC      H     + + +ED N+N P       Y+D+ ++   E T   D   ++    +D DS+  G   + + + QS S    K F +D     L  S     DRE        ++ +D+   G+  L    +  V+V D NDNSP+F  P+   +  +VS  E +G  V  V AFD D  +N  + Y  EI     ++   DL+ F L +R +GEI +  P  +  Q   FN I
Sbjct:  513 LSEVAILEILADERPPQFAKQ-EYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTARE-----DNRESHVDLTIRIDDVNDNVP--TFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRF--NVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVI-------QIQARDADR-DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIM--EGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESR---KAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDR---GDRPLIGFCQFSVEVVDINDNSPQFERPS---YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI 1063          

HSP 3 Score: 105.531 bits (262), Expect = 1.996e-22
Identity = 145/586 (24.74%), Postives = 255/586 (43.52%), Query Frame = 3
Query:  636 KNRMITYQIHFSNGGQNLFQLLY------DGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHV-KVIDINEYAPEFSREL-------KSSFSVHESTVKGTVIAHLQATDNDA-YPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD---SAPISERKSSSFSLTISII--DVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKI----QVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDREL-----TNEYRLRVCCNDSIHVVC-TDIYVDVEDENDNTPILYTDLFQLTVEEN--TINYDRA-LLTFRPSDLD---STNTGFRVSFDQSTSEDVLKYFKLDHD--KLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPD 2279
            +N  + Y++  S G  N  +  +      +  ++   ++++  LD E  ++Y L L A D   +       V +V D+N+  P+F+ +L       + + + H     G  I  ++A D D+  P N + +++    N E    F ++   G++    + D EK  +Y +T+ A D   SA       +  ++ + I+  DVNDN P   F+ +     ++E++     V  +K  D D + N  +    + +       G+      I   +  D E  D+Y + +I  D G  + +T+V   + IED ND  PQF          E   + TT+   +  + K+       D D   E +  I  +     A  V +I KYSG + +  A+DR+      +  + ++   +D   +V   D+ V+V D NDN+PI    LF   +EEN   I+ D    +  +  D D   + N        ++   +    F++D +  K++  +SLDRE  S  +F+I++   +  G       A V +KV+D NDN+P F     T +  +V    PIG  V    AFD D
Sbjct: 1127 RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAP--SFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVY--IHIEDVNDNAPQF----------EQQKYATTVIEEDVDIPKVLFNVHATDADQ-DEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVR-ANDRGVPSREGFANVTIKVTDMNDNAPFF---EKTRYEGSVEETAPIGAAVMSFSAFDAD 1689          

HSP 4 Score: 90.1225 bits (222), Expect = 9.403e-18
Identity = 184/775 (23.74%), Postives = 315/775 (40.65%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELC-VHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHH-YILDLLANDGAGK---EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAET--ANTFAMNLHNGDLKV---IGELDY-EKQKIYSITIIAYDSAPI----SERKSSSFSLTISIIDVNDNYPELKFDTE-NQKSTIRENQPISSPVTFLKI--TDRDSNQNGEV--TCRFLKSENR--FFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI---------HVVCTD------------IYVDVEDENDNTPILYTD---LFQLTVEENTINYDRALLTFRP-SDLDSTNTGFRVSFDQST-----SEDVLKYF-KLDHD----KLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKF---IFPNS--THFVLNVSCHEPIGHVVGKVQAFDPDL-GNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAED 2447
            ++F +D S   I L + +D +D  L  +H           K     R   +++ +    L I I+D+ND  P F +  Y  +  E    + Q  L   A+DKD    +R ITY +   N     F +  +G   A   + L+A     +H  Y  ++ A D           +IH++  + N+ +  F    + +  V E    GT +  +QA D D    + +T+     N   T   N F+++ H G +K+   +   D  E +   ++T+I  D        S+  +S  +L I I DVN+N PE     + +  + I E    + P T +K+  TD DS+ NG++  +  + +SE+R  F ++   G+L     +    VFDRE   R  V +   D GD  L      +V + D ND  PQF   ++  SV                 S+ + +   +I    F  D  H ++  T  ++ID  +G  +       EL N     +     I         +V+  D            + ++V D+    P   T       +TV+EN +  ++ +L  R  S  DS N+        S      +E   + F K ++     ++ + + LD E+++++   +  +D      S++ +T    V+V D ND  P+F   +F  +       N    +  G  +  V+A D D  G    V Y I      ++   F +D  TGEIF N  F  E+     +I+ + A D
Sbjct:  583 KWFRIDPSTGIIHLTRLLDFDDPALPKLH-----------KLKVTAREDNRESHV---DLTIRIDDVNDNVPTFTRPLYTAQVRED-IPLNQTILKVTAVDKDTGDNSR-ITYSVDNHN-----FSINSNGEISAK--VRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHV----VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-----------------SRFEAVGTSVITVFAFDNDAAHNAE-ITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDEN-VELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM----TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDM--YILTVEASD 1302          

HSP 5 Score: 80.8777 bits (198), Expect = 6.351e-15
Identity = 130/535 (24.30%), Postives = 213/535 (39.81%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL-LYDGTSQAPNLLLLNALDCE-----TKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVK--GTVIAHLQATDND--AYPNNNITFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYE--KQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKV------FDREEI---DRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD-IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKL 2018
            T  + I IED+ND  P F+Q++Y     E    + +      A D D  +K+  I Y++    G   +F++  Y GT     + L+ ALD +        ++++  + +DG G  G   + V V DIN+ +P F   L      +   +   G     +QA D D     N NI + +    L N E+   F ++ + G +  +  LD E   ++ + I + A D    S  +    ++TI + D+NDN P   F+    + ++ E  PI + V      D D      V    L  E+ +F     DK  +  S  V       D E++   D + + I   D           + V + D ND  P  +       V+E+ P  T+       + +    D D  G+   F  N+ +       I  D   G L VA  +DRE    Y L +   D+ + +    + V ++D NDN P  YT        ENT          R +D D+   G   + + S S    +Y  +
Sbjct: 1419 TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLE-GQGADEVFRIGKYSGT-----IELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES--VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS--REGFANVTIKVTDMNDNAP--FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYV-TTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPH-IHGATEHRVREDVPRGTS-------IGRYTATDRD-AGDTARFRINRQSDPKRQFTIDQD---GTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNV 1925          

HSP 6 Score: 76.2554 bits (186), Expect = 1.691e-13
Identity = 107/461 (23.21%), Postives = 198/461 (42.95%), Query Frame = 3
Query:  297 KVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQY-YVEFYEGPKSVGQKQLLPIAIDKDF---SKKNRMITYQIHFSN--GGQNLFQLLYDGTSQAPNLLLLNALDCE--TKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNI-TFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYE---KQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD 1631
            ++ G G ++ F + K    I LVK +D  D    V + N   + +D     L+   + Q         + + DIND +P F +R + Y+E    P        + +   +DF   + +N  I Y I  +    G+++F++          +  + +LD E  ++  +I+++ AND     +EG   + +KV D+N+ AP F +  +   SV E+   G  +    A D D    +N+ T++L  ES     T +  +     G L+V   LDYE   ++  + + I   D      R  +  ++ ++++D ND+ P +   TE++   +RE+ P  + +     TDRD+               R F    +D+   +      DRE+I  Y  N+I   + + +      + V ++D ND  P+  +       +EN+P +        G  +I+  D D
Sbjct: 1476 RLEGQGADEVFRIGKYSGTIELVKALD-RDPPAGVPSWNFVVQAIDDDGNGLVGYADVQ---------VNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQA-RDFDDPTTENANIEYGIVRNKLINGESVFRI----DQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEK-TRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-----RHDAEAAVHVALVDRNDHAPHIHGATEHR---VREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQF---TIDQDGTLRVAHTLDREDIAVY--NLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL------GTCEIRATDRD 1901          
BLAST of Protocadherin delta 1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 117.472 bits (293), Expect = 4.243e-26
Identity = 143/567 (25.22%), Postives = 251/567 (44.27%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFS-LTISIIDVNDNYPELK---FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDR---EEIDRYFVNIICHDHGDPSLSTSVTLTVLI-EDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRE--LTNEYRLRV----CCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR------KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINS 2387
            LD E    Y L ++   G+G++    + V+V ++N+  P F   +     V E+   G+ +A + A D D      + + L S ++ +T   F ++   G + +   LD+E    +++TI A D +        +F+ LTI + D+NDN P      + T    +T    QP      F KI   D +  G +T    +  +  F           ES  +F +      +RY V +   D+G PS STSV ++V+I E E    P F    FRF V ENS     + N +   S+          E  + I +      A+ +  IDK+ G L+VAG IDRE   T+E+++ +      +  +   C   +V V DENDN P+  +  + L++ ++++ + + +     SD DS   G RVS+   +  D L    L+ D   ++        LD    +++Q +++  D H H         +V +K+S  + ++P F+ P     VL  +    +G V+ K++A +     N  ++Y +      +      +D  TGE+ + +
Sbjct: 1888 LDREILERYSLKVIGT-GSGQQIGTRVDVRVNNLNDNVPSFP--MSKPRRVPENLRVGSYVATVGAKDVDNL--APLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS------FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQP------FAKIEAHDLDARGALTYSLGQGSSSIFR-------VAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESR----------EFHYRIQDPE----ASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKC---HVIVLDENDNLPVFTSVAYYLSL-KDSMAHGQKIGQIMASDQDSGENG-RVSYRILSGND-LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARD-HGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTS---VGTVLQKIRASNRLGMRNDGLLYSLK-----EHQGKLGIDVKTGELTLKT 2400          

HSP 2 Score: 114.005 bits (284), Expect = 5.321e-25
Identity = 151/670 (22.54%), Postives = 269/670 (40.15%), Query Frame = 3
Query:  459 IFEKQASILTYKLNIF-IEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHV--KVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCN-DSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + EK   I+     +  I DIND  P +   Q ++      ++ G  + L  A D D  + N  I Y +        L   L     +   + + N +DC         + A DG        + V   ++D     P+F + L     + E T  GT +  + A ++    +  I + L++ +   T +T +     G + +    D+EKQK Y  T+IA ++      ++S+  ++I + DVNDN+P   F       T+RE      P+  +  +D DS   GEV+   L   + F +N +  + +   + K   R    R+ + +   D G  S   S  + + + D++ + PQF  + +     E+         S   +SK++           +  D  H          ID+ +G +YV   +D ++ +   L +     S     T + + +ED NDN P   + L ++++ E+ +         + SD D    G  R S   S     ++  +    +L     LD E   +++  ++ +D      S   T   +F+ V D NDN+P+F     + + + V  + P   +VGKV A D D   NG ++Y I+          F +D   G ++       E     +  I I AED G
Sbjct:  414 LLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLN---RTQGGSRTL-TAKDPDLGQ-NGWIRYSV--------LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQ-VEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMS-----GTVCIQKTFDFEKQKSYQTTVIATNA----NSETSTSLISIRLKDVNDNWP--IFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVF---AQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDI-LPGIAIGSVGAMSKVKY--------SIYSGDQDHN-------FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIRED-LKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFT-GQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMT---LFIHVLDVNDNAPEF---EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRIT-----NGSEYFGIDEKLGNVYTKRSIDREVISHVD--ISIVAEDKG 1021          

HSP 3 Score: 100.523 bits (249), Expect = 5.760e-21
Identity = 112/464 (24.14%), Postives = 199/464 (42.89%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFY-QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTP 1853
            T  ++I ++D+ND  P F   +Y++   EGPK   ++ LL ++     S     ++Y I   +   ++  +  +  +Q P            +  + L + A DG G+  E    IH+ VID +   P+FSR  K      E  + G  I  + A     Y          S+ + +  + F+++   G + V   LD +       T++    A +   +S+   + I I D NDN P+  F +   + +IRE+  +  P   ++ +D+D  +NGEV    + S     +   +D+F  Q+ +  + D E    Y + +   D G P  S+++TL + + D ND  P+F  + +   V ENSP  T        + K+   D D +  G++ + I       N +    ID+  G +Y   +IDRE+ +   + +   D             + V D NDN P
Sbjct:  624 TSLISIRLKDVNDNWPIFYPNEYHLTVREGPKP--EEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKP----------LARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRS-KYEIRTTEDILPGIAIGSVGAMSKVKY----------SIYSGDQDHNFSIDEDTGKIYVTRYLDADVHD----TVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQ--FSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIE--IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTI-------VGKVVARDKDSLENGQIVYRI------TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 4 Score: 97.0561 bits (240), Expect = 7.386e-20
Identity = 156/657 (23.74%), Postives = 268/657 (40.79%), Query Frame = 3
Query:  372 IDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIE--DINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEK---QKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIY 2306
            ID E   + V N   C  N+  +  F +R  +  +  L+  L +  +  D     P F++  + VE  E    +G   L+ +  +      ++ I Y +   N  ++L      GT     + +    D E +  Y   ++A +   +    LI +++ D+N+  P F    +   +V E       +  + A+D D+     +++ + S      +++F++N       V GE+  +K   +  + + + A D    S   S++  +T+  ID +   P+        K  IR  + I   +  + I    +    + +      ++ F ++    K Y     +  D +  D   +NI        S  T V   + IED ND  PQF S+    S++E+   H            +Q  D D    GE+ + I + H      S I+ID+++G L     +D E T  Y+LRV   D  I    ++  +++ V D NDN P      + + V EN+      +      D DS   G  V    + SE    YF +D     +Y ++S+DRE IS     I   DK   G     +TA   + V D NDN P  +  + T  V  V    P+   +G + A DPD G NG+V+Y
Sbjct:  485 IDKETGRIFVPNTIDC--NIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPED-TPIG-TCLVKVVANNSQCGNSKRIRYSLQ--NQDEHLTVDTMSGT-----VCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPN-EYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS-----ESSSFSIN------PVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITV--IDKDTKTPQFS----RSKYEIRTTEDI---LPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIY---VTRYLDADVHDTVLLNIQATLPSGESNQTQVV--IFIEDHNDNPPQFSSSLVEISIREDLKLHEPFY-------VVQASDKDKKKNGEVRYSIISSHPG----SSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENS-PPKTIVGKVVARDKDSLENGQIVYRITNGSE----YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDK---GVPPRSSTASARISVLDVNDNPPSCL--SITPIV--VPAGSPLSTAIGTIVAMDPDKGLNGSVLY 1081          

HSP 5 Score: 81.2629 bits (199), Expect = 4.816e-15
Identity = 122/589 (20.71%), Postives = 221/589 (37.52%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-------LKSENRFFLNGLLDKFYQIESNKV------FDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSD-QNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLN-LFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVK 2468
            LD E    ++L ++  DG  +     + V V D N+  P+      S   + ES+  G V+   +A+D D   N   +F+L      +++ +  +    GDL                         +  R SS  S  I +  V+   P L  +   + S         +P+ FLK T   +   G    +F       L       + G +D  + ++S  V       DRE ++RY + +I    G         + V + + ND  P F  +  R  V EN           + ++ +   D D +  L +F+ +  +    T    ID+++G +++   +D E+  E+ L +   D      T++ + V D NDN P     L+Q TV   T +  +        DLD+     R +   S  +     F++  +   L   +       +   +  +D   +G     T+  V V + + +  + P F       F   V  +  IG  +G +         +G    E    + D + + +F +D+  G +F+  P   EQ     F + I  E + +QKV+
Sbjct: 1687 LDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLE----DSSGSLDLVPETGDL-------------------------VLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMSKPR-RVPEN-------LRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTH-FNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA-----RGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATD---NGVPSFSTSVPVSVIIGEAEPTDKPGF---EKAEFRFEVMENSKIGLQIGNL---------SGEESREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQ 2213          

HSP 6 Score: 72.4034 bits (176), Expect = 2.202e-12
Identity = 133/539 (24.68%), Postives = 212/539 (39.33%), Query Frame = 3
Query:  861 PEFSRELKSSFSVHESTVKGTVIAHLQAT-DNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKV-------------FDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIY-VDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYF--------KLDHDKLYLR---KSLDREEISS--FQFVI----QISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            P F + L + F+V ES   GT I  +    +  A P   + F  E     +T+    ++  +G++  I  LDYEK+  + I  +        E    +  + + + D NDN P   F  +  K  I E   + +      +TD D  +      RF+       L G ++  +++ S KV              DRE  D+Y + I   D G P+    +  ++ I D ND  P F  + +  SV  N    + L         +Q  D DI        D K TS  + S   I + SGV+    ++    T++  +    + S  +  + +  + V     ++P L  D+  L VE N+ +          S L S     RVS  Q   +  L+          + D   +YL      LDRE  S    +F++    QI  +HP    QL T       + D NDN+P++   +  H  LN +           + A DPDLG NG + Y +       D  L  +D+ TG IF+
Sbjct:   20 PTFCQCL-TKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDE-----QTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKV------EESGETIDILVEVDDENDNAP--SFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFD--VHRFV------ILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLIT-------VQATDADIGENSRISYDIKKTSAPSNSNFAISQ-SGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPL--DIIWL-VESNSAHL------MENSTLGSIVA--RVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHP----QLLT-------IGDINDNAPQW-HSSQIHISLNRTQGGS-----RTLTAKDPDLGQNGWIRYSV------LDTELVSIDKETGRIFV 494          

HSP 7 Score: 63.929 bits (154), Expect = 8.270e-10
Identity = 127/547 (23.22%), Postives = 212/547 (38.76%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDA-----------YPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK----SENRFFLN--GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHT-----SDNATSVIQIDK-YSGVLYVAGAIDRELTNEYRLRVCC-NDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPF 2393
            I V+V D N+ AP F+ ++     + E    GT  A    TD D              N N  FKL S    E            DL V G+LD E +  Y + I A D       K      +I IID NDN P   F      +++  N  I S +  ++ TD D  +N  ++    K    S + F ++  G++     +      D        V ++  DHG PSLS+S  +T+ +       P     +  + V+ NS     + NS  G          I+  ++     + T       +A    Q D+ +  +L + G +DRE  +E+ L+     D   ++     + + D NDN P  ++   Q+ +  N        LT +  DL   N   R S   +     L     +  ++++  ++D    S  +F ++  D    G+  L T  +V   + D     P+F       + + +    PIG  + KV A +   GN+  + Y     L ++D +L  +D  +G + I   F
Sbjct:  108 ILVEVDDENDNAPSFADQV-VKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQ--------ADLVVNGQLDREFRDKYELLIEAQDGG--KPAKIGQLRCSIEIIDANDNAP--VFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD--------VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPL---DIIWLVESNSAH--LMENSTLG---------SIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSS--QIHISLNRTQGGSRTLTAKDPDL-GQNGWIRYSVLDTE----LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDG---GSPALSTDLQVVADLLDTESKPPQF---EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYS----LQNQDEHL-TVDTMSGTVCIQKTF 601          
BLAST of Protocadherin delta 1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 195.282 bits (495), Expect = 7.581e-50
Identity = 199/755 (26.36%), Postives = 337/755 (44.64%), Query Frame = 3
Query:  327 FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFI--EDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA----PN---LLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF------FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI-----HVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG---FRV--SFDQ--STSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNST---HFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTG--EIFINSPFLSEQF---CRFNFIIMISAEDLGNQKVK 2468
            F +D     ++L + +D E S+               +   ++   +     L+  L I +  +D+ND  P F++ +Y V   E  +S+  + +   A D D +  N  ITY+I  +        +     SQ     PN   + L   LD ET+  Y L +LA D        +  + V+V+D N+  P+F +  K  F + E+  +G+V+  + A+D D   N  I + L  +N+     +F ++   G++     LD E +++Y + + A D    +  +S+   + I + DVNDN PE+  D +    ++RE QP  + V  ++  DRD  QN  +T   +K  +     L  +      I +  V D EE   Y + +   D G+P   T   L V + D ND  P F S++  F V+E++     + + +       V+ + +  E +F      +  N  T D   +   ID++SG L VA  +DRE+ +E+RL +   D+            + ++V D NDN P    D   L V E T      +  F  +D D+   G   +R+   F Q   + E  +  F++D     L L+  LD E +  +  ++Q  D+  +   +L T+  V +++ D ND++P F+ PNS+      L +S    IG VV  + A D D G+NG + YEI+          F ++  TG  E+  + P  +E      RFN I  I A+D G  + K
Sbjct:  979 FAIDARSGHLILSQHLDYESSQ---------------RHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSES-RSINAQIIQVNASDLD-TGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKS-KYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-----SFQVHPVTGEISTREPLDRELRELYDLVVEARDQG--TPVRSARVPVRIHVSDVNDNAPEIA-DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSV--EESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG---GNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI--IGAKDHGQPEPK 1699          

HSP 2 Score: 162.925 bits (411), Expect = 7.676e-40
Identity = 177/741 (23.89%), Postives = 319/741 (43.05%), Query Frame = 3
Query:  303 IGDGFNQY--FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI----AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFH--------TTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            IG+GF     F +  +  +I +  ++D E                   + F +   ++     T  + + + D+ND  P F  R+Y V   E PK+  Q    PI    A D D+    + ++Y+I   N    +F++  D ++    ++  + L   T+  ++L++ A DG         ++ + +ID  +  P F +  + ++ V E   +GTV+  + A   D    + + +   S+ + +    F++  ++G++++   LD+E +    + I A    P     +    + I + DVNDN PE  F+    + ++ E+  + +P+      D+DS  +G+VT   +K   +          + I S  + D E   R+ + +   D G PSLST++T+ V ++D ND  P F  + +  +V E+   +        + L   NN     +++D  +       + N  +S + +    I   SG +Y+   +DRE  + Y+L V   D    + H   T + V V D NDN P      ++  +EEN +     +     SDLD   N   R S     S      F++     ++  R+ LDRE    +  V++  D+   G         V + VSD NDN+P+   P     V++V   +P G  V +V+A D D G N ++ Y I K        LF +D  +G I        E+  R  + + ++A D GN
Sbjct:  650 IGEGFKHLTEFEVRSASGEICIAGELDFERRS---------------SYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQ-VSYRIVAGNEA-GIFRI--DRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKA-RYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRY---SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT---QVNIEVEDVNDNAPE--FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHL-DYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDN-----VTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK-TRVIVRVLDANDNDPKFQKSKYEFRIEEN-LRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELRELYDLVVEARDQ---GTPVRSARVPVRIHVSDVNDNAPEIADPQED--VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE--RSIYRLGVAASDGGN 1342          

HSP 3 Score: 156.762 bits (395), Expect = 4.769e-38
Identity = 178/682 (26.10%), Postives = 300/682 (43.99%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQN-LFQLL----YDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK--FDTENQKSTIRENQPISSPVTFLKITDRDS-NQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDS-----TNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVS-------CHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            + ++D ND  P F Q   ++EF E      ++ LLP A D D    N   T + +  +G  N  F+L      DG     +L +   LD ET   Y L + A DG      G + +++ + D+N+  P F++  +   +V E+   GT +  + A+D DA  N  + + +     ++    F ++   G + +   LD+E ++++ + ++A D       ++++F ++I + DVNDN P +   F +++    I E+      V  + + D DS  +   V       +  F L    +  Y +  +   DRE +  Y ++++  D G P L  S ++ + I D ND  P+F  + +  +V E          ++ G S +QV+ HD    +   LT+ +    T +      QID  +G++     ID E     +L V   D     +    T + V + D NDN PI     + ++V EN     R +L    SD D       N      F   T  +V    +    ++ +   LD E  SS++F +  +D+       L TTA + ++++D NDN P F +P      L  S          PI  VV    A DPD GN G V Y   +I+   +  +F +DR TGEIF+  P +     +   ++ ISA D GN
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYN---TQRYNIVSGNVNDAFRLSSHRERDGVLYL-DLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQS-RYFATVPENATVGTSVLQVYASDTDADENGLVEYAINR-RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAF-VSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---------VADPGTSVLQVLAHDRDEGLNSALTYSL--AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTAT-VLVTIHDVNDNEPIFDQSFYNVSVAENE-PVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEV----RSASGEICIAGELDFERRSSYEFPVLATDR-----GGLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVV----ATDPDYGNFGQVSY---RIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 4 Score: 144.436 bits (363), Expect = 2.951e-34
Identity = 171/688 (24.85%), Postives = 287/688 (41.72%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKS---VGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPEL-------KFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFF----LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCN---------DSIHVVCTDIYVDVEDENDNTPIL-YTDLFQLTVEE-NTINYDRALLTFRPSDLDSTNT-GFRVSFDQSTSEDVLKY-FKLDHDKLYLRKSLDREE-ISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDK-DLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            +L I +ED ND +P F Q+Q+     EG      V Q      A D D     R+  + +  ++    + +  + G  +  N++L    D E +  Y L ++A D    +  G   I V+++D+N+  P F     +  +V E+T  G VI  + A D D YP        ES  + E  + FA++ ++G L +   LDYE Q+ Y + +IA D+A       +   LT+ + D NDN P          F      S I E+  +   +  +  TD DS  N       ++     F     NG++          V    +   YFV II  D G P+L +S  L V   D      QFL N +R  + E +P  + +         +Q+    +   L     N+   ++A  ++Q    S  + +   +DRE  + Y+LR+  +                  + + + D NDN PI   +  ++  + E   + Y  A L  +  D D  NT    V +D ++  D   +   L    L++   LD +    S++ +I+  D H      L +     +++ D+NDN PKF      HF+     +EP+G  V +  A D D G  G + Y I     D+    +F +D  +G   + S F+ +   R  + + + A D+G +K
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVH----AFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRT-NIVL----DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP--NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-----HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD---YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV---------LQLGQDALDQSLAIIAGNE---ESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQL--QAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQ--RPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAE---NEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG--LVTSAFVFDYEQRQRYDMELLASDMGGKK 2950          

HSP 5 Score: 134.035 bits (336), Expect = 4.306e-31
Identity = 155/579 (26.77%), Postives = 248/579 (42.83%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNG----DLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNG----EVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDS-TNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            LD ET+  Y   L+A   +G+  RVL+ VK  D N+ AP F  +        E+T +      L A D D  P N   + + S N  +     +    +G    DL++ G LD E    YS+ I A D      R     ++ I+I DVNDN P   F+     +T+ EN  + + V  +  +D D+++NG     +  R    E  F ++      Y    NK  D E  + + + ++  DHG+  L T+  +++ + D ND  P     N  F   + SP  +        +++I V D D   E        +  D   ++   D    ++ V   +DRE+ + Y L V   D     +H     I++ + D NDN P    DL+   V E   +   ++L     D D   N+    S  + T E   ++F++D     +  R  +D E     Q  +   D    G   L +TA V V + D NDN P F   + + + ++V+ +EP+G  + KV A DPD G N  V Y I +    K L  F +   +GEI I      E+   + F ++ +
Sbjct:  138 LDRETRASY--SLVAIPLSGRNIRVLVTVK--DENDNAPTFP-QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR--GFMTVNITIQDVNDNQP--IFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIY---INKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI---NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHA-SKSIFLRITDVNDNPPEFEQDLYHANVME-VADPGTSVLQVLAHDRDEGLNSALTYSLAE-TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDG---GVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF--KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLAT 690          

HSP 6 Score: 132.88 bits (333), Expect = 1.130e-30
Identity = 141/587 (24.02%), Postives = 242/587 (41.23%), Query Frame = 3
Query:  714 SQAPNLLLLNALDCETKHHYILDLLANDGAGK-EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNK-------VFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN---SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFD--PDLGNNGT--------VIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            + + N+ +   LD E K   +L++ A  G     G   ++++V D+N+ APEF   +    SV ES   G  +    A D D+  +  +T+   SL        FA++  +G L +   LDYE  + +++ + A D    S   S++ ++ + + DVNDN P   F+ +     + E++ I++ +  +  +D D+  N  +T R + +      N +    + + + I  N          DRE  DRY + ++  D+G P+      + V + D ND DP+F  + + F ++EN         +T S+  L +   I + ++                 S  Q+   +G +     +DREL   Y L V   D    +      + + V D NDN P +      +            ++  R  D D   N     S  +    D    F +D     +R    LD EE S ++  +  SD    GN    T   + V+V D NDN P F    S+  V  V     +GHVVG +   +   D+  N          V Y ++ +  D     F +DRH+G + +
Sbjct:  879 TNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASM-VRISVPESAELGAPLYAAHAHDKDSGSSGQVTY---SLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS--LSTNLTILVDVQDVNDNPP--VFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL--------------PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDG---GNPPRETVRMLRVEVLDLNDNRPTF---TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVV 1437          

HSP 7 Score: 117.087 bits (292), Expect = 7.098e-26
Identity = 168/675 (24.89%), Postives = 282/675 (41.78%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKS---SFSVHESTVKGTVIAHLQATDNDA---YPNNNITFKLESLNNAETANTFAMNLHNGDLKVI---GELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQI--ESNKVFDREEIDRYF-----VNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTL--TNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD-IYVDVEDENDNTPILYTDLFQLTVEENTINYDRA----LLTFRPSDLDSTNTG--------------FRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSE 2402
            +NI I+D+ND  P F Q +Y+    E   +VG   L   A D D + +N ++ Y I   N  Q+  + ++    +   + +  ALD ETK  + L ++A D   +  E    + ++V D+N+  P  +    S   S  + ES   G  +A +   D D+   Y N N+T     LN  +    FA+   +  + ++     LD E    Y+++++A D        S S  L I+  DVNDN PE  F+ +   + + E     + V  +   DRD   N  +T    ++           +++QI  ++  +  R  ID        + ++  D G P LS++ T+ V I D ND +P F  + +  SV EN P    +   ++++    +  + +  IGE       KH ++      ++   SG + +AG +D E  + Y   V   D   +  T  I + + D NDN P+ Y   +++++ E+     +A    ++    +D D  N G              FR+  D+ST E     F +  D L +R              I  +D    GN +    A VF+ + D     P F      ++V       P G VVG V A   D+ +   V Y I    PD     F ++ ++G I I  P   E
Sbjct:  272 VNITIQDVNDNQPIFNQSRYFATVPEN-ATVGTSVLQVYASDTD-ADENGLVEYAI---NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVT-----LNGGD--GHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRIT--DVNDNPPE--FEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH------AQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGE-----GFKHLTE-----FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRI--DRSTGE----IFVVRPDMLSVRTQ------PMHMLNISATDG---GNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKE---DIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD---GYFSIETNSGNIRIAKPLDHE 893          

HSP 8 Score: 94.7449 bits (234), Expect = 4.798e-19
Identity = 161/695 (23.17%), Postives = 279/695 (40.14%), Query Frame = 3
Query:  459 IFEKQASILTYKLNIFIEDINDWTPAF-----KQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNAL-----DCETKHHYILDLLANDGAG---KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-FAMNLHNGDLKVIGELDYEKQKIYSITIIAYD---------SAPISERKSSSF------------SLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSE--NRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPIL--YTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFL 2396
            + E+  + +T +L I   D ND  P F        +    F      +G+     +A+D+D S  N  +TY+I   NG +  F++     SQ   + L+ +L     D E    + L + A D      K+  + +H+ V   +   P F + +  + ++ E+   G+ +  + A       N N+++++     A  AN  F ++   G +   G+ D E Q  Y + +   D         SA   +R S S             ++ I++ DVNDN PE +  +    S    ++P    +  +  +D D   N ++          N+F ++    +     S +  DRE+  RY + I   D G P S      +T+ +ED+ND  P+F  + +  SV+E++P  T++        +I  +D D  +   L + + N+     A     ID  SG++   G +DREL   Y   V   D     +      + ++V D NDN PI   Y  + Q+      I   + LL  +  D D   N     S +   S  V   F+++     L   +SL  E        +   DK   GN    +   + + + +    +P   F N T+ V+ +  + P G  + +V A   D G    V +       D    +  LD  +GEI +N P L
Sbjct: 1578 VTERLQTSVTVRLRIL--DANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDED-SGDNGQLTYEITGGNG-EGRFRI----NSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRA-TILENVPSGSFVLQVTAKSLHGAENANLSYEIP----AGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEP--GVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL----SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-------QISAVDADLGVNARLVYSLANETQWQFA-----IDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPA---LIQPGQTLLKVQALDADLGANAEIVYSLNAENSA-VSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK---GNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVM-LKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNED---GILSLDSLSGEIRVNKPHL 2229          

HSP 9 Score: 92.8189 bits (229), Expect = 1.851e-18
Identity = 146/586 (24.91%), Postives = 248/586 (42.32%), Query Frame = 3
Query:  729 LLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSF--------SVHESTVKGTVIAHLQATDNDAYPNNN-ITFKLESLNNAETANTFAMNLHNGDLKV-IGELD--YEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQ-KSTIRENQPISSPVTFLKITDRDSN-----QNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNII-CHDHGDPSLSTSVT-----LTVLIEDENDQDPQF-LSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDREL---TNEYRLRVCCNDSIHVVCT--DIYVDVEDENDNTPIL-YTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTS-EDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            L+L   LD E +  Y LD++A+D A  E R ++ V+V D N+ AP F  +   ++         + ES      +  + ATD D+  NN+ + + +E          F+++  NG + V +  L         Y + IIA D+      K +  S T+  +  NDN        +NQ ++ I E  P+ S V  L     D +      N E     L+S+    +             K  DRE  D Y + ++  H HG P +S+  +     + + I D ND  P F  S  +   + E +P   ++       +++Q ID D        +    TS N   +  ID  +GVL+V   +D +    + E  +R C +     +C+     +++ DENDN P    T+      E   +    ++     SDLD    G    S   + S E   K F++D +   +  +   D E+   +   +  SD    G  +   +  V V++  +++ +P+F    +  FVL  +   P G+VVG+V A D D G +G V+Y++S   P      F ++R +G + I
Sbjct: 2487 LVLKRRLDYELQQEYELDVIASDAA-HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-----FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG-----KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLV-------------KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSI-------AQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVG--SSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDM---GGKK--ASVAVRVEIESRDEFTPQFT-ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSA--PHSH---FKVNRSSGAVLI 3028          

HSP 10 Score: 90.1225 bits (222), Expect = 1.300e-17
Identity = 121/479 (25.26%), Postives = 201/479 (41.96%), Query Frame = 3
Query: 1023 FAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDN---YPELKFDTENQKSTIRENQPISSPVTFLKI----TDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE---LTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTP----ILYTDLFQLTVEENTINYD-RALLTFRPSDLDSTNTGFRVSFDQS------TSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINS 2387
             A++   G+++   +LD E +  YS+  I     P+S R   +  + +++ D NDN   +P+     E  ++T RE +    P   L +    T R +  +G V   F  S +R   +G+L  +  ++ +   DRE    Y + I   D G P L   +T+ + I+D ND  P F  N  R+       F T   N+  G S +QV   D   +   L  +  N+  SD    + +ID  +G +Y+  A+D E    + L V   D           + + V D NDN P    I  +D     + E+    +  A ++    D  +      V+ +        T+ D   Y  + H        LDRE +S++   +  +DK   G   L  +  +F++++D NDN P+F       +  NV      G  V +V A D D G N  + Y +++  P+     F +D  TG I   S
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAI-----PLSGR---NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRE-RDGVL--YLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF--NQSRY-------FATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK-EQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVH------LPLDREIVSNYTLSVVATDK---GTPPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRS 567          

HSP 11 Score: 67.0106 bits (162), Expect = 1.170e-10
Identity = 79/301 (26.25%), Postives = 131/301 (43.52%), Query Frame = 3
Query: 1458 PSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF---FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNT-GFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHF------VLNVSCHEPIGHVVGKVQAFDPDL-GNNGTVIYEI 2312
            P L++   L + +EDEND  P+F    F  +V E +       N    ++++   D D           +D  H  DNA  VI+   +SG++     +DRE+ + Y+L++   D      T    I V + D NDN P    +   +TV E T      + +   +D+D+     +R+  + +   + +  F LD    KL L++ LD E    ++  +  SD   H    + T     V+V+D+NDN+P F+      +      +  +S    +   +  V A D D  GNN  VIY I
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGN-------NKGTFVAQVHAFDSDAGSNARLRYHIVDGNH--DNAF-VIE-PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEAT-ELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDA-AHEARTVLT-----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII 2581          
BLAST of Protocadherin delta 1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 195.282 bits (495), Expect = 7.581e-50
Identity = 199/755 (26.36%), Postives = 337/755 (44.64%), Query Frame = 3
Query:  327 FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFI--EDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA----PN---LLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF------FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI-----HVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG---FRV--SFDQ--STSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNST---HFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTG--EIFINSPFLSEQF---CRFNFIIMISAEDLGNQKVK 2468
            F +D     ++L + +D E S+               +   ++   +     L+  L I +  +D+ND  P F++ +Y V   E  +S+  + +   A D D +  N  ITY+I  +        +     SQ     PN   + L   LD ET+  Y L +LA D        +  + V+V+D N+  P+F +  K  F + E+  +G+V+  + A+D D   N  I + L  +N+     +F ++   G++     LD E +++Y + + A D    +  +S+   + I + DVNDN PE+  D +    ++RE QP  + V  ++  DRD  QN  +T   +K  +     L  +      I +  V D EE   Y + +   D G+P   T   L V + D ND  P F S++  F V+E++     + + +       V+ + +  E +F      +  N  T D   +   ID++SG L VA  +DRE+ +E+RL +   D+            + ++V D NDN P    D   L V E T      +  F  +D D+   G   +R+   F Q   + E  +  F++D     L L+  LD E +  +  ++Q  D+  +   +L T+  V +++ D ND++P F+ PNS+      L +S    IG VV  + A D D G+NG + YEI+          F ++  TG  E+  + P  +E      RFN I  I A+D G  + K
Sbjct:  979 FAIDARSGHLILSQHLDYESSQ---------------RHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSES-RSINAQIIQVNASDLD-TGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKS-KYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-----SFQVHPVTGEISTREPLDRELRELYDLVVEARDQG--TPVRSARVPVRIHVSDVNDNAPEIA-DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSV--EESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG---GNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI--IGAKDHGQPEPK 1699          

HSP 2 Score: 162.925 bits (411), Expect = 7.676e-40
Identity = 177/741 (23.89%), Postives = 319/741 (43.05%), Query Frame = 3
Query:  303 IGDGFNQY--FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI----AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFH--------TTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            IG+GF     F +  +  +I +  ++D E                   + F +   ++     T  + + + D+ND  P F  R+Y V   E PK+  Q    PI    A D D+    + ++Y+I   N    +F++  D ++    ++  + L   T+  ++L++ A DG         ++ + +ID  +  P F +  + ++ V E   +GTV+  + A   D    + + +   S+ + +    F++  ++G++++   LD+E +    + I A    P     +    + I + DVNDN PE  F+    + ++ E+  + +P+      D+DS  +G+VT   +K   +          + I S  + D E   R+ + +   D G PSLST++T+ V ++D ND  P F  + +  +V E+   +        + L   NN     +++D  +       + N  +S + +    I   SG +Y+   +DRE  + Y+L V   D    + H   T + V V D NDN P      ++  +EEN +     +     SDLD   N   R S     S      F++     ++  R+ LDRE    +  V++  D+   G         V + VSD NDN+P+   P     V++V   +P G  V +V+A D D G N ++ Y I K        LF +D  +G I        E+  R  + + ++A D GN
Sbjct:  650 IGEGFKHLTEFEVRSASGEICIAGELDFERRS---------------SYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQ-VSYRIVAGNEA-GIFRI--DRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKA-RYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRY---SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT---QVNIEVEDVNDNAPE--FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHL-DYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDN-----VTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK-TRVIVRVLDANDNDPKFQKSKYEFRIEEN-LRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELRELYDLVVEARDQ---GTPVRSARVPVRIHVSDVNDNAPEIADPQED--VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE--RSIYRLGVAASDGGN 1342          

HSP 3 Score: 156.762 bits (395), Expect = 4.769e-38
Identity = 178/682 (26.10%), Postives = 300/682 (43.99%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQN-LFQLL----YDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK--FDTENQKSTIRENQPISSPVTFLKITDRDS-NQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDS-----TNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVS-------CHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            + ++D ND  P F Q   ++EF E      ++ LLP A D D    N   T + +  +G  N  F+L      DG     +L +   LD ET   Y L + A DG      G + +++ + D+N+  P F++  +   +V E+   GT +  + A+D DA  N  + + +     ++    F ++   G + +   LD+E ++++ + ++A D       ++++F ++I + DVNDN P +   F +++    I E+      V  + + D DS  +   V       +  F L    +  Y +  +   DRE +  Y ++++  D G P L  S ++ + I D ND  P+F  + +  +V E          ++ G S +QV+ HD    +   LT+ +    T +      QID  +G++     ID E     +L V   D     +    T + V + D NDN PI     + ++V EN     R +L    SD D       N      F   T  +V    +    ++ +   LD E  SS++F +  +D+       L TTA + ++++D NDN P F +P      L  S          PI  VV    A DPD GN G V Y   +I+   +  +F +DR TGEIF+  P +     +   ++ ISA D GN
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYN---TQRYNIVSGNVNDAFRLSSHRERDGVLYL-DLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQS-RYFATVPENATVGTSVLQVYASDTDADENGLVEYAINR-RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAF-VSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---------VADPGTSVLQVLAHDRDEGLNSALTYSL--AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTAT-VLVTIHDVNDNEPIFDQSFYNVSVAENE-PVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEV----RSASGEICIAGELDFERRSSYEFPVLATDR-----GGLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVV----ATDPDYGNFGQVSY---RIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 4 Score: 144.436 bits (363), Expect = 2.951e-34
Identity = 171/688 (24.85%), Postives = 287/688 (41.72%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKS---VGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPEL-------KFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFF----LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCN---------DSIHVVCTDIYVDVEDENDNTPIL-YTDLFQLTVEE-NTINYDRALLTFRPSDLDSTNT-GFRVSFDQSTSEDVLKY-FKLDHDKLYLRKSLDREE-ISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDK-DLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            +L I +ED ND +P F Q+Q+     EG      V Q      A D D     R+  + +  ++    + +  + G  +  N++L    D E +  Y L ++A D    +  G   I V+++D+N+  P F     +  +V E+T  G VI  + A D D YP        ES  + E  + FA++ ++G L +   LDYE Q+ Y + +IA D+A       +   LT+ + D NDN P          F      S I E+  +   +  +  TD DS  N       ++     F     NG++          V    +   YFV II  D G P+L +S  L V   D      QFL N +R  + E +P  + +         +Q+    +   L     N+   ++A  ++Q    S  + +   +DRE  + Y+LR+  +                  + + + D NDN PI   +  ++  + E   + Y  A L  +  D D  NT    V +D ++  D   +   L    L++   LD +    S++ +I+  D H      L +     +++ D+NDN PKF      HF+     +EP+G  V +  A D D G  G + Y I     D+    +F +D  +G   + S F+ +   R  + + + A D+G +K
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVH----AFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRT-NIVL----DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP--NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA-----HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD---YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV---------LQLGQDALDQSLAIIAGNE---ESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQL--QAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQ--RPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAE---NEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG--LVTSAFVFDYEQRQRYDMELLASDMGGKK 2950          

HSP 5 Score: 134.035 bits (336), Expect = 4.306e-31
Identity = 155/579 (26.77%), Postives = 248/579 (42.83%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNG----DLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNG----EVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDS-TNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            LD ET+  Y   L+A   +G+  RVL+ VK  D N+ AP F  +        E+T +      L A D D  P N   + + S N  +     +    +G    DL++ G LD E    YS+ I A D      R     ++ I+I DVNDN P   F+     +T+ EN  + + V  +  +D D+++NG     +  R    E  F ++      Y    NK  D E  + + + ++  DHG+  L T+  +++ + D ND  P     N  F   + SP  +        +++I V D D   E        +  D   ++   D    ++ V   +DRE+ + Y L V   D     +H     I++ + D NDN P    DL+   V E   +   ++L     D D   N+    S  + T E   ++F++D     +  R  +D E     Q  +   D    G   L +TA V V + D NDN P F   + + + ++V+ +EP+G  + KV A DPD G N  V Y I +    K L  F +   +GEI I      E+   + F ++ +
Sbjct:  138 LDRETRASY--SLVAIPLSGRNIRVLVTVK--DENDNAPTFP-QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR--GFMTVNITIQDVNDNQP--IFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIY---INKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTI---NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHA-SKSIFLRITDVNDNPPEFEQDLYHANVME-VADPGTSVLQVLAHDRDEGLNSALTYSLAE-TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDG---GVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF--KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLAT 690          

HSP 6 Score: 132.88 bits (333), Expect = 1.130e-30
Identity = 141/587 (24.02%), Postives = 242/587 (41.23%), Query Frame = 3
Query:  714 SQAPNLLLLNALDCETKHHYILDLLANDGAGK-EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNK-------VFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN---SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFD--PDLGNNGT--------VIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            + + N+ +   LD E K   +L++ A  G     G   ++++V D+N+ APEF   +    SV ES   G  +    A D D+  +  +T+   SL        FA++  +G L +   LDYE  + +++ + A D    S   S++ ++ + + DVNDN P   F+ +     + E++ I++ +  +  +D D+  N  +T R + +      N +    + + + I  N          DRE  DRY + ++  D+G P+      + V + D ND DP+F  + + F ++EN         +T S+  L +   I + ++                 S  Q+   +G +     +DREL   Y L V   D    +      + + V D NDN P +      +            ++  R  D D   N     S  +    D    F +D     +R    LD EE S ++  +  SD    GN    T   + V+V D NDN P F    S+  V  V     +GHVVG +   +   D+  N          V Y ++ +  D     F +DRH+G + +
Sbjct:  879 TNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASM-VRISVPESAELGAPLYAAHAHDKDSGSSGQVTY---SLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS--LSTNLTILVDVQDVNDNPP--VFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL--------------PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDG---GNPPRETVRMLRVEVLDLNDNRPTF---TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVV 1437          

HSP 7 Score: 117.087 bits (292), Expect = 7.098e-26
Identity = 168/675 (24.89%), Postives = 282/675 (41.78%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKS---SFSVHESTVKGTVIAHLQATDNDA---YPNNNITFKLESLNNAETANTFAMNLHNGDLKVI---GELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQI--ESNKVFDREEIDRYF-----VNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTL--TNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD-IYVDVEDENDNTPILYTDLFQLTVEENTINYDRA----LLTFRPSDLDSTNTG--------------FRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSE 2402
            +NI I+D+ND  P F Q +Y+    E   +VG   L   A D D + +N ++ Y I   N  Q+  + ++    +   + +  ALD ETK  + L ++A D   +  E    + ++V D+N+  P  +    S   S  + ES   G  +A +   D D+   Y N N+T     LN  +    FA+   +  + ++     LD E    Y+++++A D        S S  L I+  DVNDN PE  F+ +   + + E     + V  +   DRD   N  +T    ++           +++QI  ++  +  R  ID        + ++  D G P LS++ T+ V I D ND +P F  + +  SV EN P    +   ++++    +  + +  IGE       KH ++      ++   SG + +AG +D E  + Y   V   D   +  T  I + + D NDN P+ Y   +++++ E+     +A    ++    +D D  N G              FR+  D+ST E     F +  D L +R              I  +D    GN +    A VF+ + D     P F      ++V       P G VVG V A   D+ +   V Y I    PD     F ++ ++G I I  P   E
Sbjct:  272 VNITIQDVNDNQPIFNQSRYFATVPEN-ATVGTSVLQVYASDTD-ADENGLVEYAI---NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVT-----LNGGD--GHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRIT--DVNDNPPE--FEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH------AQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGE-----GFKHLTE-----FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRI--DRSTGE----IFVVRPDMLSVRTQ------PMHMLNISATDG---GNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKE---DIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD---GYFSIETNSGNIRIAKPLDHE 893          

HSP 8 Score: 94.7449 bits (234), Expect = 4.798e-19
Identity = 161/695 (23.17%), Postives = 279/695 (40.14%), Query Frame = 3
Query:  459 IFEKQASILTYKLNIFIEDINDWTPAF-----KQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNAL-----DCETKHHYILDLLANDGAG---KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-FAMNLHNGDLKVIGELDYEKQKIYSITIIAYD---------SAPISERKSSSF------------SLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSE--NRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPIL--YTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFL 2396
            + E+  + +T +L I   D ND  P F        +    F      +G+     +A+D+D S  N  +TY+I   NG +  F++     SQ   + L+ +L     D E    + L + A D      K+  + +H+ V   +   P F + +  + ++ E+   G+ +  + A       N N+++++     A  AN  F ++   G +   G+ D E Q  Y + +   D         SA   +R S S             ++ I++ DVNDN PE +  +    S    ++P    +  +  +D D   N ++          N+F ++    +     S +  DRE+  RY + I   D G P S      +T+ +ED+ND  P+F  + +  SV+E++P  T++        +I  +D D  +   L + + N+     A     ID  SG++   G +DREL   Y   V   D     +      + ++V D NDN PI   Y  + Q+      I   + LL  +  D D   N     S +   S  V   F+++     L   +SL  E        +   DK   GN    +   + + + +    +P   F N T+ V+ +  + P G  + +V A   D G    V +       D    +  LD  +GEI +N P L
Sbjct: 1578 VTERLQTSVTVRLRIL--DANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDED-SGDNGQLTYEITGGNG-EGRFRI----NSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRA-TILENVPSGSFVLQVTAKSLHGAENANLSYEIP----AGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEP--GVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL----SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-------QISAVDADLGVNARLVYSLANETQWQFA-----IDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPA---LIQPGQTLLKVQALDADLGANAEIVYSLNAENSA-VSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK---GNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVM-LKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNED---GILSLDSLSGEIRVNKPHL 2229          

HSP 9 Score: 92.8189 bits (229), Expect = 1.851e-18
Identity = 146/586 (24.91%), Postives = 248/586 (42.32%), Query Frame = 3
Query:  729 LLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSF--------SVHESTVKGTVIAHLQATDNDAYPNNN-ITFKLESLNNAETANTFAMNLHNGDLKV-IGELD--YEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQ-KSTIRENQPISSPVTFLKITDRDSN-----QNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNII-CHDHGDPSLSTSVT-----LTVLIEDENDQDPQF-LSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDREL---TNEYRLRVCCNDSIHVVCT--DIYVDVEDENDNTPIL-YTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTS-EDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            L+L   LD E +  Y LD++A+D A  E R ++ V+V D N+ AP F  +   ++         + ES      +  + ATD D+  NN+ + + +E          F+++  NG + V +  L         Y + IIA D+      K +  S T+  +  NDN        +NQ ++ I E  P+ S V  L     D +      N E     L+S+    +             K  DRE  D Y + ++  H HG P +S+  +     + + I D ND  P F  S  +   + E +P   ++       +++Q ID D        +    TS N   +  ID  +GVL+V   +D +    + E  +R C +     +C+     +++ DENDN P    T+      E   +    ++     SDLD    G    S   + S E   K F++D +   +  +   D E+   +   +  SD    G  +   +  V V++  +++ +P+F    +  FVL  +   P G+VVG+V A D D G +G V+Y++S   P      F ++R +G + I
Sbjct: 2487 LVLKRRLDYELQQEYELDVIASDAA-HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-----FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG-----KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLV-------------KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSI-------AQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVG--SSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDM---GGKK--ASVAVRVEIESRDEFTPQFT-ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSA--PHSH---FKVNRSSGAVLI 3028          

HSP 10 Score: 90.1225 bits (222), Expect = 1.300e-17
Identity = 121/479 (25.26%), Postives = 201/479 (41.96%), Query Frame = 3
Query: 1023 FAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDN---YPELKFDTENQKSTIRENQPISSPVTFLKI----TDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE---LTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTP----ILYTDLFQLTVEENTINYD-RALLTFRPSDLDSTNTGFRVSFDQS------TSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINS 2387
             A++   G+++   +LD E +  YS+  I     P+S R   +  + +++ D NDN   +P+     E  ++T RE +    P   L +    T R +  +G V   F  S +R   +G+L  +  ++ +   DRE    Y + I   D G P L   +T+ + I+D ND  P F  N  R+       F T   N+  G S +QV   D   +   L  +  N+  SD    + +ID  +G +Y+  A+D E    + L V   D           + + V D NDN P    I  +D     + E+    +  A ++    D  +      V+ +        T+ D   Y  + H        LDRE +S++   +  +DK   G   L  +  +F++++D NDN P+F       +  NV      G  V +V A D D G N  + Y +++  P+     F +D  TG I   S
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAI-----PLSGR---NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRE-RDGVL--YLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF--NQSRY-------FATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK-EQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVH------LPLDREIVSNYTLSVVATDK---GTPPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRS 567          

HSP 11 Score: 67.0106 bits (162), Expect = 1.170e-10
Identity = 79/301 (26.25%), Postives = 131/301 (43.52%), Query Frame = 3
Query: 1458 PSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF---FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNT-GFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHF------VLNVSCHEPIGHVVGKVQAFDPDL-GNNGTVIYEI 2312
            P L++   L + +EDEND  P+F    F  +V E +       N    ++++   D D           +D  H  DNA  VI+   +SG++     +DRE+ + Y+L++   D      T    I V + D NDN P    +   +TV E T      + +   +D+D+     +R+  + +   + +  F LD    KL L++ LD E    ++  +  SD   H    + T     V+V+D+NDN+P F+      +      +  +S    +   +  V A D D  GNN  VIY I
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGN-------NKGTFVAQVHAFDSDAGSNARLRYHIVDGNH--DNAF-VIE-PAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEAT-ELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDA-AHEARTVLT-----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII 2581          
BLAST of Protocadherin delta 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 184.111 bits (466), Expect = 2.426e-46
Identity = 196/731 (26.81%), Postives = 318/731 (43.50%), Query Frame = 3
Query:  462 FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQ----LLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR-----VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGT---VIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT-DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFK--------LDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL--NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI----PRSYSAKITLITP 2573
            F  ++   T ++N+   D ND +P F+  Q+     EG  +VG   +   A D+D  K N  I Y I     G  L Q     ++   S++  +   ++LD ET   Y L + A D A  +         + VKV+D N+  P+FS E   +  V E    GT    +AH++ATD D   N  I + +   N   T + F+++  +GD+ ++  LDYE  + Y + I A D    S  +S++  L +++ID NDN P  +F T   + ++ EN P+   +  ++  D D   N E+T    + ++ F L  +  +   +++ K  DREE  R+   ++  D G P  S S ++ + ++D ND DP F    +  +V E+ P  T +T        +   D D    L + I   +T        Q  +  G++ +A ++D +    + L V   DS     T  +++++ D N+  PI     +  +V E+       +L    +D D    G       S +E+ +                 +     LDRE  S +   +   D    GN  L  T  V + V+D NDN+P F  P     +L  +    +G  V +V A DPD+G NG + Y    +L D+D+    F +D  +G I  N     E    F+   +  A D G+     PL     S T E + I L D+    P   S KITL  P
Sbjct:  441 FPPRSGTTTLQVNVL--DCNDHSPTFEAEQFEASIREG-ATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN---TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGG--SPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-------VTATDPDEDSRLHYEITTGNTRGRFAITSQNGR--GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDA-PVGTTVLVVSATDSD---VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG---GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL---VGTSVIQVAASDPDVGLNGRIKY----LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAI--AVDKGSP----PL-----SSTVE-VQIRLEDVNDSPPTFASDKITLYVP 1123          

HSP 2 Score: 168.318 bits (425), Expect = 1.703e-41
Identity = 176/642 (27.41%), Postives = 285/642 (44.39%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLP--IAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSF--SVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSD-NATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVV---CTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTG 2369
            T  + + + D ND  P F +R Y V+  E      +   +    A D D    N  I Y I    GG    Q   D  S + ++ L+  LD E+   Y L + A DG    +     + V VID N+ AP F     S F  SV E+   G  I  +QA D+D   N  IT+   S++  +     A++   G ++ I  LD E+Q  ++  ++A D       KS+S S+ I++ DVNDN P   F+ +  ++ + E+QP  +PVT +  TD D +           +  RF +     +   I   +  D ++  R+ + +   D G    S + T+ + I D N+  P F +  +  SV E++P  TT+         +   D D+    ++T+ ++ +  +   +     I+  +G +     +DRE T+ Y L V   D  +      TD+ + V D NDN P   + L+Q ++ E+ +    +++    SD D    G R+ +  S  +     F +D     +R  K LDRE ++ F       DK   G+  L +T +V +++ D ND+ P F    S    L V  + P+G VVG++ A DPD G N  V Y    I+   D N F L    G
Sbjct:  564 TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD-QGNNAAIRYAII---GGNTQSQFSID--SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG--VPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-------VVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL-VGTSVIQVAASDPDVGLNG-RIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDK---GSPPLSSTVEVQIRLEDVNDSPPTFA---SDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY---SIIGGDDSNAFSLVTRPG 1168          

HSP 3 Score: 139.428 bits (350), Expect = 1.004e-32
Identity = 141/594 (23.74%), Postives = 260/594 (43.77%), Query Frame = 3
Query:  768 HYILDLLANDG-AGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNA------ETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPI-SERKSSSFSLTISIIDVNDNYPELKFDT------ENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK--SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK---LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISK--ILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            HY   +  +D    + G   + V V+D N+++P F  E +   S+ E    G+ +  L+ATD D   N  I + +E++ +       +    F ++  +G +     LD E    Y + + A D A   SER++++ S+ + ++D NDNYP+    T      E+Q     +N      V  ++ TD D   N  +    +   ++++F ++ +      +   K  D E +  Y + I   D G PS S +  L V + D ND  P+F ++ F+ SV EN P    +        ++Q  D D     E+T+ I  +   DN    + +D  +G +     +DRE    +  +V   D         + + + V+D NDN P      ++  V E+       + T   +D D  +   R+ ++ +T     ++     +    + + +SLD ++   F   +  +D    G S    TA V + ++D N+ +P  IF N+  +  +V    P+G  V  V A D D+G N  + Y +++  I      + F ++  TG I  N+P   E      +++ ++A+D GN  + +
Sbjct:  430 HYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAE-QFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNII-------RVQAYDSDEGANAEITYSISER--DDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPP-GTPVTTVTATDPDEDS---RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS--GGRSD---TATVHINITDANNFAP--IFENAP-YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTS--GYLLTVTAKDGGNPSLSD 989          

HSP 4 Score: 126.716 bits (317), Expect = 7.723e-29
Identity = 125/462 (27.06%), Postives = 207/462 (44.81%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLL--LNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNG--LLDKFYQ-IESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVD--VEDENDNTPIL 1859
            I ++D+ND  PAF  + Y     E  +  G       A D D   ++  + Y+I   N  +  F +    TSQ    L+    +LD + +  ++L + A D  G+     +H+ + D N +AP F     S+ SV E    GT +  + ATD+D   N  IT+ L  ES+N   + + F++N   G +     LD E    Y +T+ A D    S   S +  + I + DVNDN P   F +   +++I E+  + + V  +  +D D   NG +  ++L S+ R   +G  ++D     I +NK  DRE +  + +  I  D G P LS++V + + +ED ND  P F S+     V ENSP  + +     G       D  +   + + I     S+  + V +       L     +D E T + R  +    +   +  D +++  V D NDN P+L
Sbjct:  782 ITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPD---EDSRLHYEITTGNT-RGRFAI----TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS--LSDTTDVEIGVTDVNDNAP--AFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI--KYLLSD-RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVV-----GEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 5 Score: 123.635 bits (309), Expect = 8.180e-28
Identity = 179/747 (23.96%), Postives = 309/747 (41.37%), Query Frame = 3
Query:  300 VIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGD--LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL--LDKFY------QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLTVEENTI---------NYD-----RALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSP-----KFIFPN-STHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRF 2417
            +IG      F +D     + LVK +D E                   +  +IR  +  +     T +L + + D ND  P F   Q+     E    VG   +   A D D    N  ITY I   +   + F L  D   +   +  +  LD E +  +   ++A DG    K     + + V D+N+  P F+ +   + +V E    GT +  + ATD D   ++ + +++ + N   T   FA+   NG   + +   LDY+++K + +T+ A DS      +S + ++ I+I D N+  P   F+     +++ E+ P+ + V  +  TD D   N ++T     S N   +NGL   D F        I +N   DRE    Y + +   D G+PSLS +  + + + D ND  P F S  ++ S+ E++           G S IQV   D    + G + + + ++   D +     ID  SG +     +DRE    + L     D      +   ++ + +ED ND+ P   +D   L V EN+           +D      A++ +     D +N    V+   S    +L   +LD++    R          F+ V++ +      +  L   A + + V+D NDN+P     + IF N   HF        P G  +G++ AFD D+ +   + Y   +IL   + NL  L+  +G + + SP L+    +F
Sbjct:  623 IIGGNTQSQFSIDSMSGDVSLVKPLDYESVR---------------SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSD-EGANAEITYSISERD---DNFPLAVD--PRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA-NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG----GRSDTATVHINITDANNFAP--IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQIT----YSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---------GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS---FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKR----------FELVVRAA------SPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF--------PSGE-IGRIPAFDADVSDK--LHY---RILSGNNANLLRLNSSSGGLVL-SPQLNTNVPKF 1288          

HSP 6 Score: 118.627 bits (296), Expect = 2.643e-26
Identity = 109/426 (25.59%), Postives = 187/426 (43.90%), Query Frame = 3
Query: 1227 STIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFID-----NKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINY--DRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNL-FHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            +T+R   P  SPV +  ++  DS           +S++ F ++    +   + ++   DRE +D ++  ++  D   P  S + TL V + D ND  P F +  F  S++E +   +T+         ++  D DI    E+ + I+          D    + +ID  SGV+    ++DRE ++ Y L V   D              + V V D+NDN P      + + V E+      D  +   R +D D   N   R +     ++       +  D + L K LD E + S++ VI+  D    G+     T ++ V V D NDN+P+F    ++ F  +V  + P+G+ + +VQA+D D G N  + Y IS    ++D N    +D  TG +    P   E+  RF F ++  A+D G
Sbjct:  379 TTVRARDPEDSPVVYSMVSLLDS-----------RSQSLFKVD---SRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD-VSLVKPLDYESVRSYRLVIRAQDG---GSPSRSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS----ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVV--AKDGG 770          

HSP 7 Score: 117.857 bits (294), Expect = 3.932e-26
Identity = 128/516 (24.81%), Postives = 219/516 (42.44%), Query Frame = 3
Query:  843 DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF--------LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPS---LSTSVTLTVLIEDENDQDPQFLSNNFRFSVKE--------NSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVV---CTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS 2315
            ++   +P F + L  + SV E    G  +  ++A D +  P   + + + SL ++ + + F ++   G +     LD E   ++   ++A D +     +S + +L ++++D ND+ P   F+ E  +++IRE   + S V  L+ TD+D  +N E+            L  +    +  +  +   I +    DRE  D Y + +   D         + + ++ V + D+ND  PQF    +   V E        N+  H   T+++ G +    I + IIG             N  S   ID  SG + +   +D E    YRL +   D         T + V+V D NDN P  YT  FQ +V EN  + Y+  ++  +  D D       +++  S  +D      +D    +++  K LDREE   F F +   D    G      ++ V + V D NDN P F   N  ++  NV   +P G  V  V A DPD   +  + YEI+
Sbjct:  351 ELRNQSPYFEQALYVA-SVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDS--FPPRSGTTTLQVNVLDCNDHSP--TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNA--AIRYAIIG------------GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYN--IIRVQAYDSDE-GANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---GVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEIT 832          
BLAST of Protocadherin delta 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 184.111 bits (466), Expect = 2.426e-46
Identity = 196/731 (26.81%), Postives = 318/731 (43.50%), Query Frame = 3
Query:  462 FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQ----LLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR-----VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGT---VIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT-DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFK--------LDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL--NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI----PRSYSAKITLITP 2573
            F  ++   T ++N+   D ND +P F+  Q+     EG  +VG   +   A D+D  K N  I Y I     G  L Q     ++   S++  +   ++LD ET   Y L + A D A  +         + VKV+D N+  P+FS E   +  V E    GT    +AH++ATD D   N  I + +   N   T + F+++  +GD+ ++  LDYE  + Y + I A D    S  +S++  L +++ID NDN P  +F T   + ++ EN P+   +  ++  D D   N E+T    + ++ F L  +  +   +++ K  DREE  R+   ++  D G P  S S ++ + ++D ND DP F    +  +V E+ P  T +T        +   D D    L + I   +T        Q  +  G++ +A ++D +    + L V   DS     T  +++++ D N+  PI     +  +V E+       +L    +D D    G       S +E+ +                 +     LDRE  S +   +   D    GN  L  T  V + V+D NDN+P F  P     +L  +    +G  V +V A DPD+G NG + Y    +L D+D+    F +D  +G I  N     E    F+   +  A D G+     PL     S T E + I L D+    P   S KITL  P
Sbjct:  441 FPPRSGTTTLQVNVL--DCNDHSPTFEAEQFEASIREG-ATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN---TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGG--SPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-------VTATDPDEDSRLHYEITTGNTRGRFAITSQNGR--GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDA-PVGTTVLVVSATDSD---VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG---GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL---VGTSVIQVAASDPDVGLNGRIKY----LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAI--AVDKGSP----PL-----SSTVE-VQIRLEDVNDSPPTFASDKITLYVP 1123          

HSP 2 Score: 168.318 bits (425), Expect = 1.703e-41
Identity = 176/642 (27.41%), Postives = 285/642 (44.39%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLP--IAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSF--SVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSD-NATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVV---CTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTG 2369
            T  + + + D ND  P F +R Y V+  E      +   +    A D D    N  I Y I    GG    Q   D  S + ++ L+  LD E+   Y L + A DG    +     + V VID N+ AP F     S F  SV E+   G  I  +QA D+D   N  IT+   S++  +     A++   G ++ I  LD E+Q  ++  ++A D       KS+S S+ I++ DVNDN P   F+ +  ++ + E+QP  +PVT +  TD D +           +  RF +     +   I   +  D ++  R+ + +   D G    S + T+ + I D N+  P F +  +  SV E++P  TT+         +   D D+    ++T+ ++ +  +   +     I+  +G +     +DRE T+ Y L V   D  +      TD+ + V D NDN P   + L+Q ++ E+ +    +++    SD D    G R+ +  S  +     F +D     +R  K LDRE ++ F       DK   G+  L +T +V +++ D ND+ P F    S    L V  + P+G VVG++ A DPD G N  V Y    I+   D N F L    G
Sbjct:  564 TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD-QGNNAAIRYAII---GGNTQSQFSID--SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG--VPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-------VVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL-VGTSVIQVAASDPDVGLNG-RIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDK---GSPPLSSTVEVQIRLEDVNDSPPTFA---SDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY---SIIGGDDSNAFSLVTRPG 1168          

HSP 3 Score: 139.428 bits (350), Expect = 1.004e-32
Identity = 141/594 (23.74%), Postives = 260/594 (43.77%), Query Frame = 3
Query:  768 HYILDLLANDG-AGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNA------ETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPI-SERKSSSFSLTISIIDVNDNYPELKFDT------ENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK--SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK---LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISK--ILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            HY   +  +D    + G   + V V+D N+++P F  E +   S+ E    G+ +  L+ATD D   N  I + +E++ +       +    F ++  +G +     LD E    Y + + A D A   SER++++ S+ + ++D NDNYP+    T      E+Q     +N      V  ++ TD D   N  +    +   ++++F ++ +      +   K  D E +  Y + I   D G PS S +  L V + D ND  P+F ++ F+ SV EN P    +        ++Q  D D     E+T+ I  +   DN    + +D  +G +     +DRE    +  +V   D         + + + V+D NDN P      ++  V E+       + T   +D D  +   R+ ++ +T     ++     +    + + +SLD ++   F   +  +D    G S    TA V + ++D N+ +P  IF N+  +  +V    P+G  V  V A D D+G N  + Y +++  I      + F ++  TG I  N+P   E      +++ ++A+D GN  + +
Sbjct:  430 HYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAE-QFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNII-------RVQAYDSDEGANAEITYSISER--DDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPP-GTPVTTVTATDPDEDS---RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS--GGRSD---TATVHINITDANNFAP--IFENAP-YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTS--GYLLTVTAKDGGNPSLSD 989          

HSP 4 Score: 126.716 bits (317), Expect = 7.723e-29
Identity = 125/462 (27.06%), Postives = 207/462 (44.81%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLL--LNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNG--LLDKFYQ-IESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVD--VEDENDNTPIL 1859
            I ++D+ND  PAF  + Y     E  +  G       A D D   ++  + Y+I   N  +  F +    TSQ    L+    +LD + +  ++L + A D  G+     +H+ + D N +AP F     S+ SV E    GT +  + ATD+D   N  IT+ L  ES+N   + + F++N   G +     LD E    Y +T+ A D    S   S +  + I + DVNDN P   F +   +++I E+  + + V  +  +D D   NG +  ++L S+ R   +G  ++D     I +NK  DRE +  + +  I  D G P LS++V + + +ED ND  P F S+     V ENSP  + +     G       D  +   + + I     S+  + V +       L     +D E T + R  +    +   +  D +++  V D NDN P+L
Sbjct:  782 ITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPD---EDSRLHYEITTGNT-RGRFAI----TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS--LSDTTDVEIGVTDVNDNAP--AFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI--KYLLSD-RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVV-----GEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 5 Score: 123.635 bits (309), Expect = 8.180e-28
Identity = 179/747 (23.96%), Postives = 309/747 (41.37%), Query Frame = 3
Query:  300 VIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGD--LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL--LDKFY------QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLTVEENTI---------NYD-----RALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSP-----KFIFPN-STHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRF 2417
            +IG      F +D     + LVK +D E                   +  +IR  +  +     T +L + + D ND  P F   Q+     E    VG   +   A D D    N  ITY I   +   + F L  D   +   +  +  LD E +  +   ++A DG    K     + + V D+N+  P F+ +   + +V E    GT +  + ATD D   ++ + +++ + N   T   FA+   NG   + +   LDY+++K + +T+ A DS      +S + ++ I+I D N+  P   F+     +++ E+ P+ + V  +  TD D   N ++T     S N   +NGL   D F        I +N   DRE    Y + +   D G+PSLS +  + + + D ND  P F S  ++ S+ E++           G S IQV   D    + G + + + ++   D +     ID  SG +     +DRE    + L     D      +   ++ + +ED ND+ P   +D   L V EN+           +D      A++ +     D +N    V+   S    +L   +LD++    R          F+ V++ +      +  L   A + + V+D NDN+P     + IF N   HF        P G  +G++ AFD D+ +   + Y   +IL   + NL  L+  +G + + SP L+    +F
Sbjct:  623 IIGGNTQSQFSIDSMSGDVSLVKPLDYESVR---------------SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSD-EGANAEITYSISERD---DNFPLAVD--PRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA-NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG----GRSDTATVHINITDANNFAP--IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQIT----YSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---------GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS---FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKR----------FELVVRAA------SPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF--------PSGE-IGRIPAFDADVSDK--LHY---RILSGNNANLLRLNSSSGGLVL-SPQLNTNVPKF 1288          

HSP 6 Score: 118.627 bits (296), Expect = 2.643e-26
Identity = 109/426 (25.59%), Postives = 187/426 (43.90%), Query Frame = 3
Query: 1227 STIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFID-----NKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINY--DRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNL-FHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            +T+R   P  SPV +  ++  DS           +S++ F ++    +   + ++   DRE +D ++  ++  D   P  S + TL V + D ND  P F +  F  S++E +   +T+         ++  D DI    E+ + I+          D    + +ID  SGV+    ++DRE ++ Y L V   D              + V V D+NDN P      + + V E+      D  +   R +D D   N   R +     ++       +  D + L K LD E + S++ VI+  D    G+     T ++ V V D NDN+P+F    ++ F  +V  + P+G+ + +VQA+D D G N  + Y IS    ++D N    +D  TG +    P   E+  RF F ++  A+D G
Sbjct:  379 TTVRARDPEDSPVVYSMVSLLDS-----------RSQSLFKVD---SRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD-VSLVKPLDYESVRSYRLVIRAQDG---GSPSRSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS----ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVV--AKDGG 770          

HSP 7 Score: 117.857 bits (294), Expect = 3.932e-26
Identity = 128/516 (24.81%), Postives = 219/516 (42.44%), Query Frame = 3
Query:  843 DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF--------LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPS---LSTSVTLTVLIEDENDQDPQFLSNNFRFSVKE--------NSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVV---CTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS 2315
            ++   +P F + L  + SV E    G  +  ++A D +  P   + + + SL ++ + + F ++   G +     LD E   ++   ++A D +     +S + +L ++++D ND+ P   F+ E  +++IRE   + S V  L+ TD+D  +N E+            L  +    +  +  +   I +    DRE  D Y + +   D         + + ++ V + D+ND  PQF    +   V E        N+  H   T+++ G +    I + IIG             N  S   ID  SG + +   +D E    YRL +   D         T + V+V D NDN P  YT  FQ +V EN  + Y+  ++  +  D D       +++  S  +D      +D    +++  K LDREE   F F +   D    G      ++ V + V D NDN P F   N  ++  NV   +P G  V  V A DPD   +  + YEI+
Sbjct:  351 ELRNQSPYFEQALYVA-SVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDS--FPPRSGTTTLQVNVLDCNDHSP--TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNA--AIRYAIIG------------GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYN--IIRVQAYDSDE-GANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---GVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEIT 832          
BLAST of Protocadherin delta 1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 183.726 bits (465), Expect = 2.510e-46
Identity = 197/731 (26.95%), Postives = 321/731 (43.91%), Query Frame = 3
Query:  462 FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQ----LLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR-----VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGT---VIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT-DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKY------FKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL--NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI----PRSYSAKITLITP 2573
            F  ++   T ++N+   D ND +P F+  Q+     EG  +VG   +   A D+D  K N  I Y I     G  L Q     ++   S++  +   ++LD ET   Y L + A D A  +         + VKV+D N+  P+FS E   +  V E    GT    +AH++ATD D   N  I + +   N   T + F+++  +GD+ ++  LDYE  + Y + I A D    S  +S++  L +++ID NDN P  +F T   + ++ EN P+   +  ++  D D   N E+T    + ++ F L  +  +   +++ K  DREE  R+   ++  D G P  S S ++ + ++D ND DP F    +  +V E+ P  T +T        +   D D    L + I   +T        Q  +  G++ +A ++D +    + L V   DS     T  +++++ D N+  PI     +  +V E+       +L    +D D    G       S +E+ +        F ++     +     LDRE  S +   +   D    GN  L  T  V + V+D NDN+P F  P     +L  +    +G  V +V A DPD+G NG + Y    +L D+D+    F +D  +G I  N     E    F+   +  A D G+     PL     S T E + I L D+    P   S KITL  P
Sbjct:  441 FPPRSGTTTLQVNVL--DCNDHSPTFEAEQFEASIREG-ATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGN---TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGG--SPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-------VTATDPDEDSRLHYEITTGNTRGRFAITSQNGR--GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDA-PVGTTVLVVSATDSD---VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG---GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL---VGTSVIQVAASDPDVGLNGRIKY----LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAI--AVDKGSP----PL-----SSTVE-VQIRLEDVNDSPPTFASDKITLYVP 1123          

HSP 2 Score: 167.933 bits (424), Expect = 1.918e-41
Identity = 176/642 (27.41%), Postives = 285/642 (44.39%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLP--IAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSF--SVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSD-NATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVV---CTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTG 2369
            T  + + + D ND  P F +R Y V+  E      +   +    A D D    N  I Y I    GG    Q   D  S + ++ L+  LD E+   Y L + A DG    +     + V VID N+ AP F     S F  SV E+   G  I  +QA D+D   N  IT+   S++  +     A++   G ++ I  LD E+Q  ++  ++A D       KS+S S+ I++ DVNDN P   F+ +  ++ + E+QP  +PVT +  TD D +           +  RF +     +   I   +  D ++  R+ + +   D G    S + T+ + I D N+  P F +  +  SV E++P  TT+         +   D D+    ++T+ ++ +  +   +     I+  +G +     +DRE T+ Y L V   D  +      TD+ + V D NDN P   + L+Q ++ E+ +    +++    SD D    G R+ +  S  +     F +D     +R  K LDRE ++ F       DK   G+  L +T +V +++ D ND+ P F    S    L V  + P+G VVG++ A DPD G N  V Y    I+   D N F L    G
Sbjct:  564 TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD-QGNNAAIRYAII---GGNTQSQFSID--SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITY---SISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG--VPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-------VVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL-VGTSVIQVAASDPDVGLNG-RIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDK---GSPPLSSTVEVQIRLEDVNDSPPTFA---SDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY---SIIGGDDSNAFSLVTRPG 1168          

HSP 3 Score: 139.428 bits (350), Expect = 1.074e-32
Identity = 141/594 (23.74%), Postives = 260/594 (43.77%), Query Frame = 3
Query:  768 HYILDLLANDG-AGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNA------ETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPI-SERKSSSFSLTISIIDVNDNYPELKFDT------ENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK--SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK---LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISK--ILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            HY   +  +D    + G   + V V+D N+++P F  E +   S+ E    G+ +  L+ATD D   N  I + +E++ +       +    F ++  +G +     LD E    Y + + A D A   SER++++ S+ + ++D NDNYP+    T      E+Q     +N      V  ++ TD D   N  +    +   ++++F ++ +      +   K  D E +  Y + I   D G PS S +  L V + D ND  P+F ++ F+ SV EN P    +        ++Q  D D     E+T+ I  +   DN    + +D  +G +     +DRE    +  +V   D         + + + V+D NDN P      ++  V E+       + T   +D D  +   R+ ++ +T     ++     +    + + +SLD ++   F   +  +D    G S    TA V + ++D N+ +P  IF N+  +  +V    P+G  V  V A D D+G N  + Y +++  I      + F ++  TG I  N+P   E      +++ ++A+D GN  + +
Sbjct:  430 HYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAE-QFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNII-------RVQAYDSDEGANAEITYSISER--DDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPP-GTPVTTVTATDPDEDS---RLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS--GGRSD---TATVHINITDANNFAP--IFENAP-YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTS--GYLLTVTAKDGGNPSLSD 989          

HSP 4 Score: 126.716 bits (317), Expect = 8.264e-29
Identity = 125/462 (27.06%), Postives = 207/462 (44.81%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLL--LNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNG--LLDKFYQ-IESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVD--VEDENDNTPIL 1859
            I ++D+ND  PAF  + Y     E  +  G       A D D   ++  + Y+I   N  +  F +    TSQ    L+    +LD + +  ++L + A D  G+     +H+ + D N +AP F     S+ SV E    GT +  + ATD+D   N  IT+ L  ES+N   + + F++N   G +     LD E    Y +T+ A D    S   S +  + I + DVNDN P   F +   +++I E+  + + V  +  +D D   NG +  ++L S+ R   +G  ++D     I +NK  DRE +  + +  I  D G P LS++V + + +ED ND  P F S+     V ENSP  + +     G       D  +   + + I     S+  + V +       L     +D E T + R  +    +   +  D +++  V D NDN P+L
Sbjct:  782 ITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPD---EDSRLHYEITTGNT-RGRFAI----TSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS--LSDTTDVEIGVTDVNDNAP--AFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI--KYLLSD-RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVV-----GEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 5 Score: 123.25 bits (308), Expect = 9.053e-28
Identity = 179/747 (23.96%), Postives = 309/747 (41.37%), Query Frame = 3
Query:  300 VIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGD--LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL--LDKFY------QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLTVEENTI---------NYD-----RALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSP-----KFIFPN-STHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRF 2417
            +IG      F +D     + LVK +D E                   +  +IR  +  +     T +L + + D ND  P F   Q+     E    VG   +   A D D    N  ITY I   +   + F L  D   +   +  +  LD E +  +   ++A DG    K     + + V D+N+  P F+ +   + +V E    GT +  + ATD D   ++ + +++ + N   T   FA+   NG   + +   LDY+++K + +T+ A DS      +S + ++ I+I D N+  P   F+     +++ E+ P+ + V  +  TD D   N ++T     S N   +NGL   D F        I +N   DRE    Y + +   D G+PSLS +  + + + D ND  P F S  ++ S+ E++           G S IQV   D    + G + + + ++   D +     ID  SG +     +DRE    + L     D      +   ++ + +ED ND+ P   +D   L V EN+           +D      A++ +     D +N    V+   S    +L   +LD++    R          F+ V++ +      +  L   A + + V+D NDN+P     + IF N   HF        P G  +G++ AFD D+ +   + Y   +IL   + NL  L+  +G + + SP L+    +F
Sbjct:  623 IIGGNTQSQFSIDSMSGDVSLVKPLDYESVR---------------SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSD-EGANAEITYSISERD---DNFPLAVD--PRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA-NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG----GRSDTATVHINITDANNFAP--IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQIT----YSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---------GTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS---FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKR----------FELVVRAA------SPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF--------PSGE-IGRIPAFDADVSDK--LHY---RILSGNNANLLRLNSSSGGLVL-SPQLNTNVPKF 1288          

HSP 6 Score: 118.242 bits (295), Expect = 2.804e-26
Identity = 109/426 (25.59%), Postives = 187/426 (43.90%), Query Frame = 3
Query: 1227 STIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFID-----NKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINY--DRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNL-FHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            +T+R   P  SPV +  ++  DS           +S++ F ++    +   + ++   DRE +D ++  ++  D   P  S + TL V + D ND  P F +  F  S++E +   +T+         ++  D DI    E+ + I+          D    + +ID  SGV+    ++DRE ++ Y L V   D              + V V D+NDN P      + + V E+      D  +   R +D D   N   R +     ++       +  D + L K LD E + S++ VI+  D    G+     T ++ V V D NDN+P+F    ++ F  +V  + P+G+ + +VQA+D D G N  + Y IS    ++D N    +D  TG +    P   E+  RF F ++  A+D G
Sbjct:  379 TTVRARDPEDSPVVYSMVSLLDS-----------RSQSLFKVD---SRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD-VSLVKPLDYESVRSYRLVIRAQDG---GSPSRSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS----ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVV--AKDGG 770          

HSP 7 Score: 117.857 bits (294), Expect = 4.207e-26
Identity = 128/516 (24.81%), Postives = 219/516 (42.44%), Query Frame = 3
Query:  843 DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF--------LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPS---LSTSVTLTVLIEDENDQDPQFLSNNFRFSVKE--------NSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVV---CTDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS 2315
            ++   +P F + L  + SV E    G  +  ++A D +  P   + + + SL ++ + + F ++   G +     LD E   ++   ++A D +     +S + +L ++++D ND+ P   F+ E  +++IRE   + S V  L+ TD+D  +N E+            L  +    +  +  +   I +    DRE  D Y + +   D         + + ++ V + D+ND  PQF    +   V E        N+  H   T+++ G +    I + IIG             N  S   ID  SG + +   +D E    YRL +   D         T + V+V D NDN P  YT  FQ +V EN  + Y+  ++  +  D D       +++  S  +D      +D    +++  K LDREE   F F +   D    G      ++ V + V D NDN P F   N  ++  NV   +P G  V  V A DPD   +  + YEI+
Sbjct:  351 ELRNQSPYFEQALYVA-SVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDS--FPPRSGTTTLQVNVLDCNDHSP--TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNA--AIRYAIIG------------GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYN--IIRVQAYDSDE-GANAEITYSISERDDNFP-LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDG---GVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEIT 832          
BLAST of Protocadherin delta 1 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 207.223 bits (526), Expect = 3.407e-54
Identity = 195/699 (27.90%), Postives = 311/699 (44.49%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS---PFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + E++  GT +  LQATD D   N  I +   +  +  T   FA+N   G + V   LD E+  I+ +T++A D +    R     ++TI++ DVNDN P +         N    + E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TT++ ++    +   I + +    +FF               +D+ +GVL  +   DRE    +   V   D+          + V + DENDN+P    + FQ  V EN   Y    ++T   +D    N   R+S          + F LD D   ++   S DRE+ SS+ F ++  D   +G+    + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+     +LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDSECSFEIEVVILPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELL---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF-KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARA----TITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADA-GENAVVRLSILNDN-----ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVD---NGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSAIPGSVVAEVFAVDGDTGMNAELKY---TIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 118.242 bits (295), Expect = 2.507e-26
Identity = 123/454 (27.09%), Postives = 201/454 (44.27%), Query Frame = 3
Query: 1158 LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTP-------ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            + I + D NDN P   F +     +I EN  I+S       TD D+  N       L  ++ F L+ +     +K+ Q+   +  DRE+ D Y + +   D G+P  S++  L V + D ND  P F  +     + ENSP  T++        ++Q  D D+       ++     S     +  ++  +G++ V   +DRE T  ++L V  +D S       I ++V D NDN P       I  T+   +  E++ IN   AL+T   SD D+   G  + F     +DV  + K  +D  YL ++   LD E    + F I  SD    G   L  TA V V++ D+NDN P F  P     V+  +  +     +  + A D D G N  ++Y++       + + F LDR TG +  +  F  E+  RF F   ++A D G + +++
Sbjct:  127 IKIIVKDTNDNAP--MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVV-------QLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITV--SDKDTDVNGKVICF---IEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDS---GKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD---MFLTTISATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFLF--TVTARDNGTRALQS 553          

HSP 3 Score: 60.4622 bits (145), Expect = 1.271e-8
Identity = 95/353 (26.91%), Postives = 151/353 (42.78%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGFNQY---FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTEN 1220
            L  ++S    T+ L E  PINT I +   +DK    N KVI   F +    FHL     K V   Q  LE S L        D     +++F I   +     L  T  + + +ED ND  P F Q    +   E   ++    L  I+   + S +N  I YQ+     G N     +D   +   L      D E +  ++  + A D   +  + +  + V ++D N+ +P+F+      F V E+  K + +  +  TD DA    N   +L  LN+ E    F ++  +G +K     D E+Q  Y+  + A D+   S   SS+  +TI++IDVNDN P + +   N
Sbjct:  359 LRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSAL-------LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVME--NNLRDMFLTTISATDEDSGRNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADA--GENAVVRLSILNDNE---NFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG--SPPCSSAAKVTINVIDVNDNTPIVIYPPSN 680          
BLAST of Protocadherin delta 1 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 207.223 bits (526), Expect = 4.277e-54
Identity = 195/699 (27.90%), Postives = 311/699 (44.49%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS---PFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + E++  GT +  LQATD D   N  I +   +  +  T   FA+N   G + V   LD E+  I+ +T++A D +    R     ++TI++ DVNDN P +         N    + E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TT++ ++    +   I + +    +FF               +D+ +GVL  +   DRE    +   V   D+          + V + DENDN+P    + FQ  V EN   Y    ++T   +D    N   R+S          + F LD D   ++   S DRE+ SS+ F ++  D   +G+    + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+     +LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDSECSFEIEVVILPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELL---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF-KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARA----TITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADA-GENAVVRLSILNDN-----ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVD---NGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSAIPGSVVAEVFAVDGDTGMNAELKY---TIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 118.242 bits (295), Expect = 2.258e-26
Identity = 123/454 (27.09%), Postives = 201/454 (44.27%), Query Frame = 3
Query: 1158 LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTP-------ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            + I + D NDN P   F +     +I EN  I+S       TD D+  N       L  ++ F L+ +     +K+ Q+   +  DRE+ D Y + +   D G+P  S++  L V + D ND  P F  +     + ENSP  T++        ++Q  D D+       ++     S     +  ++  +G++ V   +DRE T  ++L V  +D S       I ++V D NDN P       I  T+   +  E++ IN   AL+T   SD D+   G  + F     +DV  + K  +D  YL ++   LD E    + F I  SD    G   L  TA V V++ D+NDN P F  P     V+  +  +     +  + A D D G N  ++Y++       + + F LDR TG +  +  F  E+  RF F   ++A D G + +++
Sbjct:  127 IKIIVKDTNDNAP--MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVV-------QLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITV--SDKDTDVNGKVICF---IEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDS---GKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD---MFLTTISATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFLF--TVTARDNGTRALQS 553          

HSP 3 Score: 60.4622 bits (145), Expect = 1.234e-8
Identity = 92/354 (25.99%), Postives = 149/354 (42.09%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGF-----NQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTEN 1220
            L  ++S    T+ L E  PINT I +   +DK   +  V G        +  FHL     K V   Q  LE S L        D     +++F I   +     L  T  + + +ED ND  P F Q    +   E   ++    L  I+   + S +N  I YQ+     G N     +D   +   L      D E +  ++  + A D   +  + +  + V ++D N+ +P+F+      F V E+  K + +  +  TD DA    N   +L  LN+ E    F ++  +G +K     D E+Q  Y+  + A D+   S   SS+  +TI++IDVNDN P + +   N
Sbjct:  359 LRYIISPTNGTVMLSEKDPINTKIALITVSDK---DTDVNGKVICFIEKDVPFHL-----KAVYDNQYLLETSAL-------LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVME--NNLRDMFLTTISATDEDSGRNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADA--GENAVVRLSILNDNE---NFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG--SPPCSSAAKVTINVIDVNDNTPIVIYPPSN 680          
BLAST of Protocadherin delta 1 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 207.223 bits (526), Expect = 4.277e-54
Identity = 195/699 (27.90%), Postives = 311/699 (44.49%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS---PFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + E++  GT +  LQATD D   N  I +   +  +  T   FA+N   G + V   LD E+  I+ +T++A D +    R     ++TI++ DVNDN P +         N    + E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TT++ ++    +   I + +    +FF               +D+ +GVL  +   DRE    +   V   D+          + V + DENDN+P    + FQ  V EN   Y    ++T   +D    N   R+S          + F LD D   ++   S DRE+ SS+ F ++  D   +G+    + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+     +LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDSECSFEIEVVILPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELL---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF-KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARA----TITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADA-GENAVVRLSILNDN-----ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVD---NGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSAIPGSVVAEVFAVDGDTGMNAELKY---TIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 118.242 bits (295), Expect = 2.258e-26
Identity = 123/454 (27.09%), Postives = 201/454 (44.27%), Query Frame = 3
Query: 1158 LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTP-------ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            + I + D NDN P   F +     +I EN  I+S       TD D+  N       L  ++ F L+ +     +K+ Q+   +  DRE+ D Y + +   D G+P  S++  L V + D ND  P F  +     + ENSP  T++        ++Q  D D+       ++     S     +  ++  +G++ V   +DRE T  ++L V  +D S       I ++V D NDN P       I  T+   +  E++ IN   AL+T   SD D+   G  + F     +DV  + K  +D  YL ++   LD E    + F I  SD    G   L  TA V V++ D+NDN P F  P     V+  +  +     +  + A D D G N  ++Y++       + + F LDR TG +  +  F  E+  RF F   ++A D G + +++
Sbjct:  127 IKIIVKDTNDNAP--MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVV-------QLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITV--SDKDTDVNGKVICF---IEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDS---GKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD---MFLTTISATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFLF--TVTARDNGTRALQS 553          

HSP 3 Score: 60.4622 bits (145), Expect = 1.234e-8
Identity = 92/354 (25.99%), Postives = 149/354 (42.09%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGF-----NQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTEN 1220
            L  ++S    T+ L E  PINT I +   +DK   +  V G        +  FHL     K V   Q  LE S L        D     +++F I   +     L  T  + + +ED ND  P F Q    +   E   ++    L  I+   + S +N  I YQ+     G N     +D   +   L      D E +  ++  + A D   +  + +  + V ++D N+ +P+F+      F V E+  K + +  +  TD DA    N   +L  LN+ E    F ++  +G +K     D E+Q  Y+  + A D+   S   SS+  +TI++IDVNDN P + +   N
Sbjct:  359 LRYIISPTNGTVMLSEKDPINTKIALITVSDK---DTDVNGKVICFIEKDVPFHL-----KAVYDNQYLLETSAL-------LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVME--NNLRDMFLTTISATDEDSGRNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADA--GENAVVRLSILNDNE---NFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG--SPPCSSAAKVTINVIDVNDNTPIVIYPPSN 680          
BLAST of Protocadherin delta 1 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 206.838 bits (525), Expect = 5.705e-54
Identity = 195/699 (27.90%), Postives = 311/699 (44.49%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS---PFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + E++  GT +  LQATD D   N  I +   +  +  T   FA+N   G + V   LD E+  I+ +T++A D +    R     ++TI++ DVNDN P +         N    + E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TT++ ++    +   I + +    +FF               +D+ +GVL  +   DRE    +   V   D+          + V + DENDN+P    + FQ  V EN   Y    ++T   +D    N   R+S          + F LD D   ++   S DRE+ SS+ F ++  D   +G+    + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+     +LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDSECSFEIEVVILPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELL---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF-KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARA----TITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADA-GENAVVRLSILNDN-----ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVD---NGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSAIPGSVVAEVFAVDGDTGMNAELKY---TIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 118.242 bits (295), Expect = 2.624e-26
Identity = 123/454 (27.09%), Postives = 202/454 (44.49%), Query Frame = 3
Query: 1158 LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTP-------ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            + I + D NDN P   F +     +I EN  I+S       TD D+  N       L  ++ F L+ +     +K+ Q+   +  DRE+ D Y + +   D G+P  S++  L V + D ND  P F  +     + ENSP  T++        ++Q  D D+       ++     S     +  ++  +G++ V   +DRE T  ++L V  +D S       I ++V D NDN P       I  T+   +  E++ IN   AL+T   SD D+   G  + F +   +DV  + K  +D  YL ++   LD E    + F I  SD    G   L  TA V V++ D+NDN P F  P     V+  +  +     +  + A D D G N  ++Y++       + + F LDR TG +  +  F  E+  RF F   ++A D G + +++
Sbjct:  127 IKIIVKDTNDNAP--MFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVV-------QLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITV--SDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDS---GKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRD---MFLTTISATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREEQERFLF--TVTARDNGTRALQS 553          

HSP 3 Score: 60.8474 bits (146), Expect = 9.969e-9
Identity = 95/353 (26.91%), Postives = 151/353 (42.78%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGFNQY---FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTEN 1220
            L  ++S    T+ L E  PINT I +   +DK    N KVI   F +    FHL     K V   Q  LE S L        D     +++F I   +     L  T  + + +ED ND  P F Q    +   E   ++    L  I+   + S +N  I YQ+     G N     +D   +   L      D E +  ++  + A D   +  + +  + V ++D N+ +P+F+      F V E+  K + +  +  TD DA    N   +L  LN+ E    F ++  +G +K     D E+Q  Y+  + A D+   S   SS+  +TI++IDVNDN P + +   N
Sbjct:  359 LRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSAL-------LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVME--NNLRDMFLTTISATDEDSGRNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADA--GENAVVRLSILNDNE---NFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG--SPPCSSAAKVTINVIDVNDNTPIVIYPPSN 680          
BLAST of Protocadherin delta 1 vs. Ensembl Zebrafish
Match: pcdhb (protocadherin b [Source:ZFIN;Acc:ZDB-GENE-020731-3])

HSP 1 Score: 201.445 bits (511), Expect = 5.113e-53
Identity = 158/533 (29.64%), Postives = 269/533 (50.47%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFS---NGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR---FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE--LTFFIDNKHTSDNATSVI-QIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS-IHVVCTD--IYVDVEDENDNTPILYT 1865
            +Y  ++K   ++ +V+++D E   LC      C   LD      +R+F          + + I DIND  P F++ +  ++  E   S G++  LP A D D    N + TY++    HF+   + G        DGT    +L+L+ ALD E K  + L L A DG    + G   I V+V D N+ AP+F + L S  ++ E++  GTV+  L ATD D  PN ++T+      + +T   F+++ + G++ V G +DYE  KI+ + + A D+ P+     S  S+ ++  D+NDNYPE+    ++ K+T+ EN P+ S +  + ++DRD+  NG+V        NR   F LN   D  Y++  +K  DRE +  Y + ++  D G+P LS + T+TV + D ND  PQF    +   VKEN+            L  I  ID D+     L +FI  +  ++ + S++  I+  +G LY     D E+  ++   +   DS +  + ++  +++ + D+NDNTP++ +
Sbjct:   67 KYLDINKRTGELFIVEKMDRE--TLCPAKTTTCFLKLDLIIESPLRMF---------NIELGITDINDNAPHFRRDKIELDVSES-ASPGERFSLPNAFDPDVGA-NTVKTYKLSENEHFTVDIHSGS-------DGTKYV-DLVLMKALDREDKAVHNLILTAIDGGVPARSGTASIIVRVQDTNDNAPQFDQALYS-LNISENSPAGTVVVKLNATDADEGPNADLTYSFTLYTSEKTQEMFSLDSNTGEIAVKGTIDYEDMKIFEMFVEAKDNGPVPLSGQSRVSVYVT--DMNDNYPEITI--KSLKNTVDENIPVGSVIALVGVSDRDTGDNGKVNLTM----NRALPFLLNQSSDHLYELLVSKPLDREVVPEYEITLVVTDKGNPPLSDNETITVHLLDVNDNAPQFPQTFYTIPVKENNAPGAL-------LGSITAIDPDLNENQYLVYFIIEREIANTSMSMLFSINPENGNLYALKTFDYEIEKDFLFHIEARDSGVPPLSSNVTVHIIIMDQNDNTPLIVS 562          

HSP 2 Score: 122.479 bits (306), Expect = 8.687e-28
Identity = 142/552 (25.72%), Postives = 232/552 (42.03%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFL-----KSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKY--------SGVLY---VAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALL-TFRPSDLDSTNTGFRVSFD-----QSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP---NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            I + + DIN+ AP F R+ K    V ES   G   +   A D D   N   T+KL    +      F +++H+G       DL ++  LD E + ++++ + A D       +S + S+ + + D NDN P+  FD       I EN P  + V  L  TD D   N ++T  F      K++  F L+       +I      D E++  + + +   D+G   LS    ++V + D ND  P+    + + +V EN P  + +                ++G     + ++ T DN    + +++         S  LY   V+  +DRE+  EY + +   D  +   +D   I V + D NDN P      + + V+EN  N   ALL +    D D     + V F       +TS  +L     ++  LY  K+ D E    F F I+  D    G   L +   V + + DQNDN+P  + P     +     +      G ++ KV A D D  +N  + Y+    L + D  LF LD++ GEI
Sbjct:  114 IELGITDINDNAPHFRRD-KIELDVSESASPGERFSLPNAFDPDVGANTVKTYKLSENEH------FTVDIHSGSDGTKYVDLVLMKALDREDKAVHNLILTAIDGG--VPARSGTASIIVRVQDTNDNAPQ--FDQALYSLNISENSPAGTVVVKLNATDADEGPNADLTYSFTLYTSEKTQEMFSLDS---NTGEIAVKGTIDYEDMKIFEMFVEAKDNGPVPLSGQSRVSVYVTDMNDNYPEITIKSLKNTVDENIPVGSVIA---------------LVG-----VSDRDTGDNGKVNLTMNRALPFLLNQSSDHLYELLVSKPLDREVVPEYEITLVVTDKGNPPLSDNETITVHLLDVNDNAPQFPQTFYTIPVKEN--NAPGALLGSITAIDPDLNENQYLVYFIIEREIANTSMSMLFSINPENGNLYALKTFDYEIEKDFLFHIEARDS---GVPPLSSNVTVHIIIMDQNDNTPLIVSPWRAQGSEVKETIPRSTDKGTLIAKVIAIDSDSVHNSRITYQ---FLQNTDATLFSLDQYNGEI 623          

HSP 3 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 74/266 (27.82%), Postives = 118/266 (44.36%), Query Frame = 3
Query: 1695 IQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT-----DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALL--TFRPSDLDSTNTGFRVS------FDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + I+K +G L++   +DRE     +   C      ++ +     +I + + D NDN P    D  +L V E+    +R  L   F P    +T   +++S       D  +  D  KY  L      L K+LDRE+ +    ++   D      S    TA + V+V D NDN+P+F   +   + LN+S + P G VV K+ A D D G N  + Y  +    +K   +F LD +TGEI +      E    F   + + A+D G
Sbjct:   69 LDINKRTGELFIVEKMDRETLCPAKTTTCFLKLDLIIESPLRMFNIELGITDINDNAPHFRRDKIELDVSESASPGERFSLPNAFDPDVGANTVKTYKLSENEHFTVDIHSGSDGTKYVDL-----VLMKALDREDKAVHNLILTAIDGGVPARSG---TASIIVRVQDTNDNAPQF---DQALYSLNISENSPAGTVVVKLNATDADEGPNADLTYSFTLYTSEKTQEMFSLDSNTGEIAVKGTIDYEDMKIFE--MFVEAKDNG 321          

HSP 4 Score: 77.7962 bits (190), Expect = 6.390e-14
Identity = 125/504 (24.80%), Postives = 211/504 (41.87%), Query Frame = 3
Query:  354 IVLVKQIDLEDSELCVHNQ--NCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQ--IHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFS-RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESN-------KVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFS---VKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND 1790
            +VL+K +D ED    VHN      D  +  +           ASI+     + ++D ND  P F Q  Y +   E   + G   +   A D D    N  +TY   ++ S   Q +F L     S    + +   +D E    + + + A D       G+  + V V D+N+  PE + + LK++  V E+   G+VIA +  +D D   N  +   +        A  F +N    H  +L V   LD E    Y IT++  D    P+S+ ++    +T+ ++DVNDN P+  F        ++EN    + +  +   D D N+N  +    ++ E     N  +   + I          K FD E    +  +I   D G P LS++VT+ ++I D+ND  P  +S  +R     VKE  P     T+    ++K+  ID D +    +T+ F+ N        ++  +D+Y+G +          + + RL V   D
Sbjct:  189 LVLMKALDREDK--AVHNLILTAIDGGVPAR--------SGTASII-----VRVQDTNDNAPQFDQALYSLNISENSPA-GTVVVKLNATDAD-EGPNADLTYSFTLYTSEKTQEMFSL----DSNTGEIAVKGTIDYEDMKIFEMFVEAKDNGPVPLSGQSRVSVYVTDMNDNYPEITIKSLKNT--VDENIPVGSVIALVGVSDRDTGDNGKVNLTMNR------ALPFLLNQSSDHLYELLVSKPLDREVVPEYEITLVVTDKGNPPLSDNET----ITVHLLDVNDNAPQ--FPQTFYTIPVKENNAPGALLGSITAIDPDLNENQYLVYFIIERE---IANTSMSMLFSINPENGNLYALKTFDYEIEKDFLFHIEARDSGVPPLSSNVTVHIIIMDQNDNTPLIVS-PWRAQGSEVKETIPRS---TDKGTLIAKVIAIDSDSVHNSRITYQFLQNTD-----ATLFSLDQYNGEIRTMRMFSYRDSRDQRLVVIAKD 645          

HSP 5 Score: 70.4774 bits (171), Expect = 9.967e-12
Identity = 82/332 (24.70%), Postives = 140/332 (42.17%), Query Frame = 3
Query: 1494 IEDENDQDPQFLSNNFRFSVKEN-SPFHT-TLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHD--KLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDR---HTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            I D ND  P F  +     V E+ SP    +L N+ +       +    + E   F  + H+  + T  +        L +  A+DRE    + L +   D           I V V+D NDN P     L+ L + EN+      ++    +D D   N     SF   TSE   + F LD +  ++ ++ ++D E++  F+  ++  D  P     L   ++V V V+D NDN P+    +  +    V  + P+G V+  V   D D G+NG V   +++ LP      F L++   H  E+ ++ P   E    +   ++++  D GN
Sbjct:  118 ITDINDNAPHFRRDKIELDVSESASPGERFSLPNAFDPDVGANTVKTYKLSENEHFTVDIHSGSDGTKYVD-------LVLMKALDREDKAVHNLILTAIDGGVPARSGTASIIVRVQDTNDNAPQFDQALYSLNISENS-PAGTVVVKLNATDADEGPNADLTYSFTLYTSEKTQEMFSLDSNTGEIAVKGTIDYEDMKIFEMFVEAKDNGP---VPLSGQSRVSVYVTDMNDNYPEITIKSLKN---TVDENIPVGSVIALVGVSDRDTGDNGKVNLTMNRALP------FLLNQSSDHLYELLVSKPLDREVVPEYEITLVVT--DKGN 427          
BLAST of Protocadherin delta 1 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 209.534 bits (532), Expect = 1.039e-54
Identity = 185/653 (28.33%), Postives = 295/653 (45.18%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK----FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLS 2399
            K+   IEDIND +P F      +   E   +V  +  +P AID D    N +  Y++     GQN+F L    T +    P L++  +LD E K  Y++ +   DG    +    ++ V V D+N+  P F +E     ++ E    GT +  L ATD D   N  I F   +         FA++ + G + V   LD E+   + +T++A D +    R     ++TI+I D+NDN P +      +  N    + E  P+++ +  + +TD+D++ NG+VTC F   +  F L  + D  + +E+    D E    Y + I+  D G P L+ S  L + I+DEND  P F       S  EN+P  T LT       KI   D D     EL++ +       NA ++  +D+ +G+L     +DRE  + Y   V   D+ +      T + + V D+NDN+P    + +   V EN   Y    L+T   +D DS      V+     + D    F +D     +R ++  DRE+  S+ F ++  DK   G+ Q  +T KV + V D NDN P F+ P++ +    V      G VV +V A D D G N  + Y    I+      LF +   +G I +    L+
Sbjct:  142 KIRFLIEDINDNSPLFPSTVINISIPEN-TAVNSRYSVPSAIDPDVG-VNGIQHYELL---KGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVF-KEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRA----TVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC-FTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELT-------KISATDADSGRNAELSYML-----GPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITV--TDADSGENAV-VTLSLVNARD---NFIIDPLTGVIRPNITFDREQQGSYTFQVKALDK---GSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRY---SIIGGNSRGLFAIGERSGNITLKEKLLA 759          

HSP 2 Score: 134.42 bits (337), Expect = 3.523e-31
Identity = 155/568 (27.29%), Postives = 242/568 (42.61%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEK--QASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQ--NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRE-----LKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI---HVVCTDIYVDVEDENDNTPIL 1859
            + EN+ +N+   +P   D   P++ V G    Q++ L K +N   L V +    D    +  Q   D      +V  I++ +    A   T  L + + D+ND  P FK++   V   E   +VG       A D D     +     IHF  G Q  NL +  +   +    + +   LD E   ++ L +LA+DG+    R  + + + DIN+  P          +  +  + E     T IA +  TD DA  N  +T        F+L+ + +    N F        L+    LDYE  + Y+I I+A DS   P+++    S  L I I D NDN P   F       +  EN P  + +T +  TD DS +N E++  ++   N   +  L  +   + + +  DRE+ DRY   +I  D+G+PSL T+ T+T+ + D+ND  P F  N + F V EN P + T+     GL  I V D D        +   +  DN      ID  +GV+      DRE    Y  +V   D           + + VED NDN P+ 
Sbjct:  166 IPENTAVNSRYSVPSAID---PDVGVNGI---QHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPED-AAVGTSVTQLHATDADLGSNAK-----IHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFD----NQFL-------LETAAPLDYESTREYAIKIVASDSGKPPLNQ----SAMLLIKIKDENDNAP--VFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELS--YMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTV-----GL--ITVTDADSGENAVVTLSLVNARDN----FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVF 691          

HSP 3 Score: 102.449 bits (254), Expect = 2.229e-21
Identity = 148/575 (25.74%), Postives = 237/575 (41.22%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESN-------KVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            V I   + DIN+ +P F   +  + S+ E+T   +  +   A D D   N    ++L      +  N F +++     GD    L V   LD E++  Y + I   D    +  +SS+  L +++ DVNDN P   F  ++ +  I E+  + + VT L  TD D   N ++   F        +  L  + + I++N       +  DREE   + + ++  D    S  +  T+T+ I D ND  P    +++ N  N    + E +P +T +      L  +   D D+ G++T F D+    D    +  +     +L  A  +D E T EY +++  +DS          + + ++DENDN P+    +  L+  EN       L     +D DS   G           +    F LD     L   + LDRE+   + F +   D   +GN  L T   V + V DQNDNSP F     TH   N    E  P+   VG +   D D G N  V   +     +     F +D  TG I  N  F  EQ   + F   + A D G+ +
Sbjct:  141 VKIRFLIEDINDNSPLFPSTV-INISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-----LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGG--NPARSSTAILQVTVTDVNDNRP--VFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQ-----ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKI-----ALITVTDKDADLNGKVTCFTDH----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENN-PPGTELTKISATDADS---GRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKD---NGNPSLQTNTTVTLSVLDQNDNSPSF-----THNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN-----FIIDPLTGVIRPNITFDREQQGSYTF--QVKALDKGSPQ 670          
BLAST of Protocadherin delta 1 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 209.534 bits (532), Expect = 1.186e-54
Identity = 185/653 (28.33%), Postives = 295/653 (45.18%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK----FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLS 2399
            K+   IEDIND +P F      +   E   +V  +  +P AID D    N +  Y++     GQN+F L    T +    P L++  +LD E K  Y++ +   DG    +    ++ V V D+N+  P F +E     ++ E    GT +  L ATD D   N  I F   +         FA++ + G + V   LD E+   + +T++A D +    R     ++TI+I D+NDN P +      +  N    + E  P+++ +  + +TD+D++ NG+VTC F   +  F L  + D  + +E+    D E    Y + I+  D G P L+ S  L + I+DEND  P F       S  EN+P  T LT       KI   D D     EL++ +       NA ++  +D+ +G+L     +DRE  + Y   V   D+ +      T + + V D+NDN+P    + +   V EN   Y    L+T   +D DS      V+     + D    F +D     +R ++  DRE+  S+ F ++  DK   G+ Q  +T KV + V D NDN P F+ P++ +    V      G VV +V A D D G N  + Y    I+      LF +   +G I +    L+
Sbjct:  142 KIRFLIEDINDNSPLFPSTVINISIPEN-TAVNSRYSVPSAIDPDVG-VNGIQHYELL---KGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVF-KEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRA----TVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC-FTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELT-------KISATDADSGRNAELSYML-----GPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITV--TDADSGENAV-VTLSLVNARD---NFIIDPLTGVIRPNITFDREQQGSYTFQVKALDK---GSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRY---SIIGGNSRGLFAIGERSGNITLKEKLLA 759          

HSP 2 Score: 134.806 bits (338), Expect = 3.131e-31
Identity = 155/568 (27.29%), Postives = 242/568 (42.61%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEK--QASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQ--NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRE-----LKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI---HVVCTDIYVDVEDENDNTPIL 1859
            + EN+ +N+   +P   D   P++ V G    Q++ L K +N   L V +    D    +  Q   D      +V  I++ +    A   T  L + + D+ND  P FK++   V   E   +VG       A D D     +     IHF  G Q  NL +  +   +    + +   LD E   ++ L +LA+DG+    R  + + + DIN+  P          +  +  + E     T IA +  TD DA  N  +T        F+L+ + +    N F        L+    LDYE  + Y+I I+A DS   P+++    S  L I I D NDN P   F       +  EN P  + +T +  TD DS +N E++  ++   N   +  L  +   + + +  DRE+ DRY   +I  D+G+PSL T+ T+T+ + D+ND  P F  N + F V EN P + T+     GL  I V D D        +   +  DN      ID  +GV+      DRE    Y  +V   D           + + VED NDN P+ 
Sbjct:  166 IPENTAVNSRYSVPSAID---PDVGVNGI---QHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPED-AAVGTSVTQLHATDADLGSNAK-----IHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFD----NQFL-------LETAAPLDYESTREYAIKIVASDSGKPPLNQ----SAMLLIKIKDENDNAP--VFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELS--YMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTV-----GL--ITVTDADSGENAVVTLSLVNARDN----FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVF 691          

HSP 3 Score: 102.834 bits (255), Expect = 2.169e-21
Identity = 148/575 (25.74%), Postives = 237/575 (41.22%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESN-------KVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            V I   + DIN+ +P F   +  + S+ E+T   +  +   A D D   N    ++L      +  N F +++     GD    L V   LD E++  Y + I   D    +  +SS+  L +++ DVNDN P   F  ++ +  I E+  + + VT L  TD D   N ++   F        +  L  + + I++N       +  DREE   + + ++  D    S  +  T+T+ I D ND  P    +++ N  N    + E +P +T +      L  +   D D+ G++T F D+    D    +  +     +L  A  +D E T EY +++  +DS          + + ++DENDN P+    +  L+  EN       L     +D DS   G           +    F LD     L   + LDRE+   + F +   D   +GN  L T   V + V DQNDNSP F     TH   N    E  P+   VG +   D D G N  V   +     +     F +D  TG I  N  F  EQ   + F   + A D G+ +
Sbjct:  141 VKIRFLIEDINDNSPLFPSTV-INISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-----LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGG--NPARSSTAILQVTVTDVNDNRP--VFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQ-----ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKI-----ALITVTDKDADLNGKVTCFTDH----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENN-PPGTELTKISATDADS---GRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKD---NGNPSLQTNTTVTLSVLDQNDNSPSF-----THNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN-----FIIDPLTGVIRPNITFDREQQGSYTF--QVKALDKGSPQ 670          
BLAST of Protocadherin delta 1 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 209.149 bits (531), Expect = 1.209e-54
Identity = 185/653 (28.33%), Postives = 295/653 (45.18%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK----FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLS 2399
            K+   IEDIND +P F      +   E   +V  +  +P AID D    N +  Y++     GQN+F L    T +    P L++  +LD E K  Y++ +   DG    +    ++ V V D+N+  P F +E     ++ E    GT +  L ATD D   N  I F   +         FA++ + G + V   LD E+   + +T++A D +    R     ++TI+I D+NDN P +      +  N    + E  P+++ +  + +TD+D++ NG+VTC F   +  F L  + D  + +E+    D E    Y + I+  D G P L+ S  L + I+DEND  P F       S  EN+P  T LT       KI   D D     EL++ +       NA ++  +D+ +G+L     +DRE  + Y   V   D+ +      T + + V D+NDN+P    + +   V EN   Y    L+T   +D DS      V+     + D    F +D     +R ++  DRE+  S+ F ++  DK   G+ Q  +T KV + V D NDN P F+ P++ +    V      G VV +V A D D G N  + Y    I+      LF +   +G I +    L+
Sbjct:  122 KIRFLIEDINDNSPLFPSTVINISIPEN-TAVNSRYSVPSAIDPDVG-VNGIQHYELL---KGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVF-KEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRA----TVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC-FTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELT-------KISATDADSGRNAELSYML-----GPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITV--TDADSGENAV-VTLSLVNARD---NFIIDPLTGVIRPNITFDREQQGSYTFQVKALDK---GSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRY---SIIGGNSRGLFAIGERSGNITLKEKLLA 739          

HSP 2 Score: 134.035 bits (336), Expect = 4.121e-31
Identity = 155/568 (27.29%), Postives = 242/568 (42.61%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEK--QASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQ--NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRE-----LKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI---HVVCTDIYVDVEDENDNTPIL 1859
            + EN+ +N+   +P   D   P++ V G    Q++ L K +N   L V +    D    +  Q   D      +V  I++ +    A   T  L + + D+ND  P FK++   V   E   +VG       A D D     +     IHF  G Q  NL +  +   +    + +   LD E   ++ L +LA+DG+    R  + + + DIN+  P          +  +  + E     T IA +  TD DA  N  +T        F+L+ + +    N F        L+    LDYE  + Y+I I+A DS   P+++    S  L I I D NDN P   F       +  EN P  + +T +  TD DS +N E++  ++   N   +  L  +   + + +  DRE+ DRY   +I  D+G+PSL T+ T+T+ + D+ND  P F  N + F V EN P + T+     GL  I V D D        +   +  DN      ID  +GV+      DRE    Y  +V   D           + + VED NDN P+ 
Sbjct:  146 IPENTAVNSRYSVPSAID---PDVGVNGI---QHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPED-AAVGTSVTQLHATDADLGSNAK-----IHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFD----NQFL-------LETAAPLDYESTREYAIKIVASDSGKPPLNQ----SAMLLIKIKDENDNAP--VFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELS--YMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTV-----GL--ITVTDADSGENAVVTLSLVNARDN----FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVF 671          

HSP 3 Score: 102.834 bits (255), Expect = 2.139e-21
Identity = 148/575 (25.74%), Postives = 237/575 (41.22%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESN-------KVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            V I   + DIN+ +P F   +  + S+ E+T   +  +   A D D   N    ++L      +  N F +++     GD    L V   LD E++  Y + I   D    +  +SS+  L +++ DVNDN P   F  ++ +  I E+  + + VT L  TD D   N ++   F        +  L  + + I++N       +  DREE   + + ++  D    S  +  T+T+ I D ND  P    +++ N  N    + E +P +T +      L  +   D D+ G++T F D+    D    +  +     +L  A  +D E T EY +++  +DS          + + ++DENDN P+    +  L+  EN       L     +D DS   G           +    F LD     L   + LDRE+   + F +   D   +GN  L T   V + V DQNDNSP F     TH   N    E  P+   VG +   D D G N  V   +     +     F +D  TG I  N  F  EQ   + F   + A D G+ +
Sbjct:  121 VKIRFLIEDINDNSPLFPSTV-INISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-----LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGG--NPARSSTAILQVTVTDVNDNRP--VFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQ-----ITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKI-----ALITVTDKDADLNGKVTCFTDH----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENN-PPGTELTKISATDADS---GRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKD---NGNPSLQTNTTVTLSVLDQNDNSPSF-----THNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN-----FIIDPLTGVIRPNITFDREQQGSYTF--QVKALDKGSPQ 650          
BLAST of Protocadherin delta 1 vs. Ensembl Xenopus
Match: FAT4 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:100145590])

HSP 1 Score: 205.682 bits (522), Expect = 8.907e-53
Identity = 188/720 (26.11%), Postives = 325/720 (45.14%), Query Frame = 3
Query:  312 GFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEK-QASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPI-SERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            G +  F +D     ++  K++D E                  K+  L+R  +  Q+S +  ++NI I D+ND  P F +  Y  +  E   ++    +  I    D S  N  ITY +   +     F     G        +  ALD E + +Y+L + A DG G++  V ++  ++D+N+  P FSR   S+ SV E+   G+ I     TD D   N+ +++ + S    ++   F ++  +G L V+  LD E Q  YS+ +  +D AP  + R +SS  ++I ++DVNDN P        + + ++EN P  + V   + TD DS  N  +    L S    F  G++D   ++      DRE+I  Y + II  D G+PSLS+S+ + +++ D ND  P F   +F+  + E     +TLT    G   IQ+I  D    +   +       N ++  +ID  +GVL +A  +DRE  + Y L++  +D      +D   + + + D ND  P      + ++V EN     + +L     D D      R+++  ++  +   +      +L L KSLDRE    +  +I  +D    G   L  T  + ++V D NDN P F      H  + +    P G  +  V   D D G NG + Y +     +   + F ++  TG+I  +S  L ++  + ++ +++ A D G+
Sbjct: 1769 GADDSFRIDPESGDLIATKRLDRERRS---------------KYSLLVRADDGLQSSDM--RINITISDVNDHIPKFSRAVYSFDVAE--DTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIFFLNPVTGV-----FNVTRALDYELQQYYVLTVCAQDGGGQDSCVRVYFNILDVNDNPPVFSRNSYSA-SVMENLPPGSTILTFNVTDADDGFNSKLSYTISS---GDSMGQFQVS-KDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSF---ISPKLTYVQENTPTDTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDG--EVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISE-----STLT----GTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARD-DDQGLNSRLTYSLASGNEDGAFTLSSSGQLSLIKSLDREVKEWYSLLITATDA---GFPALTGTGTISIQVEDINDNKPTFAL---NHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSL-----NGGNSQFTINPSTGQIISSS--LLDREAKDHYTLLVIATDGGS 2431          

HSP 2 Score: 171.785 bits (434), Expect = 2.409e-42
Identity = 191/685 (27.88%), Postives = 306/685 (44.67%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKN-RMITYQIHFSN-GGQNLFQLLYDGTSQAPNLLLL--NALDCETKH-HYILDLLANDGAGKE-GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD--SAPISERKSSSFSLTISIIDVNDNYPELK---FDTENQKSTIRENQPISSPVTFLKITDRDS-NQNGEVTCRFLKS-ENRFF--LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSV-TLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPI---LYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            ++ I + DIND +P F +    V F E  +  G++ +L  A D D         +Y+I   N  G+    +  + + +   L L+    LD ET   +Y+L  + + G  K  G + ++V V DIN+  P FS   +    + E +  G+ +  ++ATD D  PN  I ++L     AE    F ++  +G + +   LDYE ++ Y+++I A D  + P++ R  +     + +IDVNDN P +K   F   ++ +++ EN  + + V  L +TD DS   NG VT   L   E R F      +     I+     DRE I  Y + +   D G P   +SV +L + + D ND  P F   + +  + E+ P  + +     G+S     D  +   L + I     S N      I + SG++    A+DRE+  +  L +   D      T    + V++ D ND  P    +  +   +++ EN++     LL  + +D D  + G  R  FD          F+LD    KL  R  LDRE+       I  +D    G   L +TAKV V + D NDNSP F +P    +  N+  +EP    V  V A DPDLG NGT+ Y I       D + F +   TG I   +    E+  +  + + + A D G  +  N
Sbjct:  112 EVRITVLDINDNSPVFPEPSIVVSFKEDTQG-GRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSS-QYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQL-----AE-GTPFQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEA----LVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYIC----GVSASDG-DTGLNANLRYSI----VSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSL-VGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDL---GTPPLSSTAKVIVSLLDVNDNSPVF-YP--VQYFANIQENEPPASFVATVTASDPDLGINGTIRYSIRA----GDTSKFQVHPETGAISTKAALDREE--KTAYQLQVVATDGGGLQSHN 762          

HSP 3 Score: 158.688 bits (400), Expect = 3.171e-38
Identity = 179/672 (26.64%), Postives = 300/672 (44.64%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD------------IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSP--FLSEQFCRFNFIIMISAEDLGN 2456
            + I + D  D  P+F Q  Y    +E   +VG      +A   D    N  ITY +  + G Q     +   T     ++  + +D E +  Y L ++A+ GA   G  ++++ V D+N+ +P F   +++   V      G +I   +A D D   N  +++ L+        + F ++   G + + G LD +    Y + IIA D      + +SSF LTIS+ DVNDN P   FD  + + T+ E++P++S    +  TD+DS  NGE+T   +            D    ++S    DRE  D Y + +   D     LST+V +T+++ED ND  P F S N+ F  +E +       +  + + +I  +D D    GE+ +  +            +++  +G +      DRE     R R     ++ V  TD            + + + D NDN P    DL+Q ++ E   N  + +L    SD+D  N G         +E+  K+F +D    ++ L   LD E  +S+  +IQ  D    G   L  T+ + ++V D+NDNSP   FP +  FV +V  +  +G +V  V A D D G+N  + Y I+      +   F +  +TG IF+     F ++   + N    I+A+D GN
Sbjct:  766 VTITVLDTQDNPPSFSQGSYSFVMFEN-VAVGYNVGTVVATTIDL---NTNITYLV--TTGDQKGVFTIDRSTGL---IMTASVVDREEQDFYQLKVVASGGA-VTGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKT-GHIIFQAKAVDPDEGVNGRVSYSLKQ----NPQSLFYVDEVTGAVSLTGPLDVDTGS-YQVEIIASDMG--VPQLASSFILTISVHDVNDNPP--VFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGNVGEAFGIFPDGQLYVKSE--LDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEEN-------SGGSFVGRIYAVDKDSGSNGEIMYAFETMQPD------FELNTVTGEITSTHQFDREAL--MRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQ-VLRVSSSDVDEGNNGLISYSIMKGNEE--KHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDS---GAVPLSATSTLSIEVLDENDNSPS--FPKAALFV-DVVENMRVGELVSSVTATDSDSGDNADIHYSITGT---NNHGTFSISPNTGSIFLAKKLDFETQALYKLN----ITAKDKGN 1384          

HSP 4 Score: 156.377 bits (394), Expect = 1.243e-37
Identity = 176/678 (25.96%), Postives = 297/678 (43.81%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYE---KQK---IYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS--ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN---SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH---VVCTDIYVDVEDENDNTPIL-YTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            ++ L I + D+ND  P F Q  Y V   E  + V  +     A DKD S  N  ITY I   N G+  F +  DG      L + + LD E K  YIL + A+D A +     ++V +I  D+N+  P F+      F   E    G+ +  + A D D+  N  I +  E++        F +N   G++    + D E   +Q+    +++ + + D       K  + ++ I I D+NDN+P  KF  +  +++I E     + V  +  +D D   NG ++   +K   E  F ++       Q+      D E    Y + I   D G   LS + TL++ + DEND  P F        V EN       +++T +++       I + I G       N H          I   +G +++A  +D E    Y+L +   D  +        + + V D NDN P     D+F+  VE   I    ++LT   +D D+   G ++++     +    +F +D     +Y    +DRE  + F+  ++ SD      S+ +    V + +SD NDN P F+  N+  F  + S    IG V+  + AFDPD G+NG + YEI       D   F +DR++G++ + +P L        + ++++A DLG ++
Sbjct:  966 SFILTISVHDVNDNPPVFDQLSYEVTLLES-EPVNSRFFKVYATDKD-SGLNGEITYSIIHGNVGE-AFGIFPDG-----QLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFN-STNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQP-----DFELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQA-TVQIYIRDINDNHP--KFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMD---SSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGT------NNH------GTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIG--TSILTVTATDPDADING-QLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFVSQNA--FAADPSLA--IGSVLSTITAFDPDEGSNGEIEYEIIS----GDTETFIVDRYSGDLRVAAPMLPSHLI---YSLIVAATDLGAER 1597          

HSP 5 Score: 150.984 bits (380), Expect = 5.605e-36
Identity = 186/675 (27.56%), Postives = 289/675 (42.81%), Query Frame = 3
Query:  513 DINDWTPAFKQRQY-----YVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLL---NALDCETKHHYILDLLANDGAGKEGRVLIHVKVI---DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPEL-KFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLNGL--LDKFYQIESNKV-FDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI------HVVCTDIYVDVEDENDNTPILYTDLFQLTVEEN-TINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            D+ND  P  K R +     Y    E  + VG    L    D D    N  +T  I   N  Q  F++    TS+ PNL L+   ++LD E    Y L +  +D      R  +   VI   DIN++ P F +E  S   + E    G+ I  + A+D D   N N+ + + S N       F+++ ++G +     LD E      + I A D  P  + K+S  +L ++++DVND  P     +      ++ EN  + + +  LK TD D   NG  T RF   ++N     GL  LD      SN+   DRE+ DR  + I+  D G P LS++  + V + D ND  P F    +  +++EN P   F  T+T S+  L         I G + + I    TS       Q+   +G +    A+DRE    Y+L+V   D        H + T   + V D  DN P      +   + EN  + Y+   +     DL+ TN  + V     T+ D    F +D     +  +  +DREE   +Q  +  S     G       A V + V D NDNSP F    +    +NV  +   GH++ + +A DPD G NG V Y + +       +LF++D  TG + +  P   +     ++ + I A D+G
Sbjct:  336 DVNDNDPVVKFRYFPATSRYASVDENAQ-VGTVVALLTVTDADSPAANGNVTVAILGGNE-QRHFEVQ---TSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVF-QEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKL---GWFSISENSGLVTSTSALDREIAPQLLLNISARDQGP--QPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNG--TIRFYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPASFVATVTASDPDLG--------INGTIRYSIRAGDTSK-----FQVHPETGAISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVT---ITVLDTQDNPPSFSQGSYSFVMFENVAVGYNVGTVVATTIDLN-TNITYLV-----TTGDQKGVFTIDRSTGLIMTASVVDREEQDFYQLKVVASGGAVTGE------AIVNITVKDLNDNSPHF---VNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQ----NPQSLFYVDEVTGAVSLTGPLDVDT---GSYQVEIIASDMG 959          

HSP 6 Score: 139.813 bits (351), Expect = 1.799e-32
Identity = 191/736 (25.95%), Postives = 301/736 (40.90%), Query Frame = 3
Query:  342 SRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS--ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINE--------YAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDA-YPNNNITFKLESLNNAETANTFAMNLHNGDL-KVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLS---NNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKY-FKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL--NVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
             R K+ +      E + L + +Q   D   +  +  L+ + +K     +   ++N+ ++DIND  P F   QY  +  E    VG   L   A D+D    N  I YQ+         FQ+      ++  + +   LD E++  Y L + A D       GR    V++ID+N+        Y P  SR      SV E+   GTV+A L  TD D+   N N+T  +   N           + N  L KV   LD E+   Y++T+   D      R SS  SL I + D+ND+ P   F   + K  I E+ P  S +  +  +D D+  N  +    + S N+     + +    + S    DRE   +  +NI   D G    ++  TL V + D NDQ P F     N    S+ ENS   T L         ++  D D+   G + F+ D  + S     + ++D  SG L     +DRE  +   L++   D           + V + D NDN+P+ Y   +   ++EN       + T   SD D   N   R S     + D  K+    +   +  + +LDREE +++Q  +  +D    G  Q    A V + V D  DN P F    S  FV+  NV+    +G+ VG V A   DL  N T +     +       +F +DR TG I   S    E+   +   ++ S   +  + + N
Sbjct:  175 GRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEED-SPVGSSVLKVEATDRD-EGPNAAIRYQLAEG----TPFQI----DPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYA----SVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPR-SSVASLVIYVNDINDHPP--VFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIV-SGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELL-------MLKATDGDLGDNGTIRFYFDADNPS-QCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPA-SFVATVTASDPDLGINGTIRYSI---RAGDTSKFQVHPETGAISTKAALDREEKTAYQLQVVATDG---GGLQSHNHAIVTITVLDTQDNPPSF-SQGSYSFVMFENVA----VGYNVGTVVATTIDLNTNITYL-----VTTGDQKGVFTIDRSTGLIMTASVVDREEQDFYQLKVVASGGAVTGEAIVN 867          

HSP 7 Score: 136.732 bits (343), Expect = 1.407e-31
Identity = 179/740 (24.19%), Postives = 319/740 (43.11%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRE--LKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT-------DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYF 2492
            ++F +D S  ++ LV ++D E +                 +  +I+  +  A  L  T  L+I + D ND +P+F +   +V+  E  + VG+      A D D S  N  I Y I  +N     F +    +    ++ L   LD ET+  Y L++ A D     +   + + +KV D N+  P F      KS   V E+ + GT I  + ATD DA  N  +T+ +  +      N F ++   G +    E+D E   ++ +T+ A D A P+  RK +  ++TI I D+NDN P   F ++N  +    +  I S ++ +   D D   NGE+    +  +   F+        ++ +  +     I  Y + +   D G    +T+  LT+++E ++   P F    +   +KE  P  T + +    +        D + E  F +  +        +  I + +GV+  A  +DRE     RL +    +I    +        + + ++D NDN P+  TD+  LTVEEN +     ++    +D D            S ++D    F++D +   L   K LDRE  S +  +++  D     +       ++ + +SD ND+ PKF   +   +  +V+     G +V  + A D D G NG + Y +S    D D  +F L+  TG +F  +  L  +  ++ +++ + A+D G Q   +   R YF
Sbjct: 1243 KHFTMDSSTGQVALVGRLDYEAT---------------ASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMR-VGELVSSVTATDSD-SGDNADIHYSITGTNN-HGTFSI----SPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKS---VVENVLIGTSILTVTATDPDADINGQLTYTI--IQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVP--TFVSQNAFAA-DPSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDTETFIVDRYSGDLRVAA-PMLPSHLI--YSLIVAATDLGAERKATTTELTIILEGQDG--PVFSQPKYITILKEGEPVGTNVIS----IEAASPRGTDSVVEY-FIVSVRCEGRTVGRLFTIGRNTGVIQTAAVLDRE--RGARLYLVDVYAIEKEASLPKTQRAQVEITLQDINDNPPVFPTDILDLTVEEN-VGDGSKIMQLTATDADEGPNALVTYTIISGADD---SFRIDPESGDLIATKRLDRERRSKYSLLVRADDGLQSSD------MRINITISDVNDHIPKF---SRAVYSFDVAEDTIPGSIVAAILATDDDSGVNGEITYAVSD---DDDDGIFFLNPVTG-VFNVTRALDYELQQY-YVLTVCAQDGGGQ---DSCVRVYF 1919          

HSP 8 Score: 135.191 bits (339), Expect = 4.157e-31
Identity = 183/734 (24.93%), Postives = 301/734 (41.01%), Query Frame = 3
Query:  309 DGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIF--IEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT--DRDSNQNGEVTCRFLKSENRFF-----LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSE------DVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAF-DPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            +G N  F ++ S  +I+    +D E  +                +  L+   +  +  LT   N+   I D+ND  P F    Y V     P + G         D+D          ++HFS  G+N  +   D    A    +  A   E        +   DG       L  V V   N+      R  + +F+  E+   GT+++ +  + +      +++F + S N     NTF ++  NG L +   LD+E    Y + + A D    P S  +     L I+++DVNDN P+ K     Q   I E     SP   L I+  D+DS  NG+V           F     +NG      +I + +  DRE+  +Y +++   D G P+ S+ V + + + D+ND  P+F S  F   V EN+     +T       ++   D D          +++T  + +    I+  +GV+ V+  ++RE  + Y +RV  +DS   V TD+ + V D NDN P      + L   E T++    +     +D D    G    F +S SE         + F   H K           I+   F++  SD+   G+  + +   V + + D NDN+PKF   +ST +   VS +  IG  + KV A  D D G N  V Y +S    +     F +D+ TG I + S  + +     N++I + A+D GN
Sbjct: 2391 NGGNSQFTINPSTGQIISSSLLDREAKD---------------HYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPY-VTHIPSPTTAGSFVFAVTVTDEDIGSN-----AELHFSLKGRNSEKFHIDPLRGA----IRTAGAIEGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFPLIRADRKTFTFPENQEVGTLVSTIFGSSSRG---GSLSFYIASGN---FGNTFHIDELNGQLYIKNPLDFETMPKYELWVEARDMGFPPFSSYEK----LEITVLDVNDNQPQFK-----QDPFIAEIIENLSPRKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNG------EIRNTRQLDREKASQYTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRF-SQIFSAFVAENAVLGCFVT-------QVTTSDEDAGANAI----SRYTIADTSLPFHINLNTGVITVSRPLNREDNDRYIVRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPE-TLDIGSKVTQVFATDSDEGLNGHVYYFIKSQSELFRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDR---GSPPIMSETTVSINIVDSNDNAPKF---SSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLST---ENIHGKFQIDKETGWITVASSLMMD--INKNYMIKVFAKDKGN 3054          

HSP 9 Score: 134.42 bits (337), Expect = 6.400e-31
Identity = 179/644 (27.80%), Postives = 284/644 (44.10%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLAND--GAGKEGRVLIHVKVIDINEYAPEFSRELKS-SFSVHES-TVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFY------QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDI-YVDVEDEND-NTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIF-PNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            +NI + DIND +P F QR + VE  E   + G   +  IA D D    N M+ Y I   N   N F++     S    L +   LD E K  Y L + A+D   + +     + + + DIN+  P+F  EL   + SV E+      +I  + A D+D   N+ +T+ L S  N + A T +    +G L +I  LD E ++ YS+ I A D+       + + +++I + D+NDN P   F   +   TI E+ P  + +  +  +D D+ QNG +         R+ LNG   +F       QI S+ + DRE  D Y + +I  D G P L+++  +TV I D ND  P+FL + +   +   SP     T + + +  + V D DI    EL F +  +++         ID   G +  AGAI  E  +E    V   D      TD+  V V   N  + P++  D    T  EN       + T   S     +  F ++     S +    F +D  + +LY++  LD E +  ++  ++  D    G     +  K+ + V D NDN P+F   P     + N+S  +     +  + A D D G+NG V Y    I        F ++R  GEI
Sbjct: 2127 MNIIVLDINDNSPHFSQRHFKVEISESTLT-GTDLIQLIASDAD-EGINGMVRYAIIDGNP-SNEFRI----DSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKF--ELSPYTVSVPENLETLPKIILQVVARDDDQGLNSRLTYSLAS-GNEDGAFTLS---SSGQLSLIKSLDREVKEWYSLLITATDAG--FPALTGTGTISIQVEDINDNKP--TFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVI---------RYSLNGGNSQFTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIP--SP-----TTAGSFVFAVTVTDEDIGSNAELHFSLKGRNSEK-----FHIDPLRGAIRTAGAI--EGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFPLIRADRKTFTFPENQ-EVGTLVSTIFGSSSRGGSLSFYIA-----SGNFGNTFHIDELNGQLYIKNPLDFETMPKYELWVEARDM---GFPPFSSYEKLEITVLDVNDNQPQFKQDPFIAEIIENLSPRK-----ILTISAEDKDSGSNGQVEY---TIFDGNKEAFFSINRVNGEI 2713          

HSP 10 Score: 130.183 bits (326), Expect = 1.540e-29
Identity = 150/575 (26.09%), Postives = 248/575 (43.13%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAID-KDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVF-DREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDI-----YVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPS-DLDSTNTGFRVSFDQSTSEDVLKY-FKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKF 2186
            ++I I D ND  P F   +Y+    +  K +G K +   A+D KDF   N  + Y +   N     FQ+      +   + + ++L  +   +Y++ + A D        + L+++ V + N + PEFS+    S +V ES   GTVI  + A D DA  N  I + + S N A     FA+N   G L ++  LDYE  + + +TI A D   ++  K+    +TI + DVNDN P  K D      ++ EN P  + V  L  TD DS  N  +      S++  F+   +D    I + + F D E    Y + +   +  D    + VT+TV +E  N+  P+F+S  + F V E +P  T +     G       D  I G++ + I             QIDK +G + V+G +DRE      L++   +   +   DI      + + D ND  P+    ++ + + E         +TF  + D DS  +  R S+   +  D   +       ++ +   LDRE    +   +   D    G+     +A + V + D NDN P  
Sbjct: 2957 VSINIVDSNDNAPKFSSTKYFTPVSKNAK-IGTKLIKVTAVDDKDFGL-NSEVGYSLSTENI-HGKFQI----DKETGWITVASSLMMDINKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQS-HVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEA---GLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVA--KTGYCVVTIYVKDVNDNPPIFKAD--EYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSDSDLFV---IDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVV-----GEVFASDRDGGIDGDVHYLIFGSSRKKG----FQIDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDAND-PPVFSLKVYNVQISEGVTPGTH--VTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDS---GSPSATGSAALLVTLDDINDNGPTL 3498          

HSP 11 Score: 129.798 bits (325), Expect = 2.124e-29
Identity = 183/704 (25.99%), Postives = 298/704 (42.33%), Query Frame = 3
Query:  225 LKENSPINTT-IDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS--ILTYK--LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLST--SVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII---GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRA--LLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK-LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDL 2282
            + +N+ I T  I +   +DK F        G N       S   I    QID E   + V +    D N +    ++I++F K      L+ +  +NI + + N  TP F Q    V   E   SVG       A D+D S  N +I Y I   N    LF +     +    L LL  LD E    + L + A DG    K G  ++ + V D+N+  P F  + +   SV E+   GT +  L ATD D+ PN  I + ++S +    ++ F ++ + G +   G LDYE ++ Y +T+ A++     E + S  ++T+ +   N+  P  +F ++     + E  P  + V  +  +DRD   +G+V      S  +     +  K  +I  + + DRE+ +R  + II  + G    +    V + + I D ND  P F    +   + E     T +T        +   D D +      ++FI     S N      I+  +G + V   +DRE+T  Y L V   DS     T    + V ++D NDN P L T     T  E   NY     ++T + +DLD        S+   ++     YF L     L   + +DRE+I+ F   +   D    G  Q+ +T  V + V+DQNDN  +   P +    ++   +   G  +G V+  DPD+
Sbjct: 2980 VSKNAKIGTKLIKVTAVDDKDF--------GLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMMDINKN----YMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLES-LSVGTVIRTISARDRDASM-NGIIAYNISSGNEA-GLFAI----NASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKAD-EYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSD----SDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVP--DEERCSFVTVTVQLEGANEYVP--RFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQ-IDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDANDP-PVFSLKVYNVQISEGVTPGTHVT-------FVSAFDSDSVPSWSRFSYFIG----SGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDDINDNGPTLST-----TKGEVKENYRAGTHVMTLQSTDLDLPPNQGPFSYYLLSTGPATSYFSLSPGGILTTTREIDREQINEFFLSVVTRDS---GFPQMSSTGTVHITVTDQNDNPSE---PRAVDIFVHYYGNLFPGGTLGSVKPQDPDV 3631          

HSP 12 Score: 114.775 bits (286), Expect = 6.544e-25
Identity = 180/725 (24.83%), Postives = 304/725 (41.93%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAF--KQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL-LYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFS-RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQ--NGEVTCRFLKS-ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH---VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRAL-LTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSD---QNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI----PR----SYSAKITL-ITPRLILTV 2591
            +++I + D+ND  P+F   +  Y  E       V + Q    A D D S  N  I Y +  S G  N F + + DG      + L   LD E   +Y L ++A D         + +++ V+DIN+ +P FS R  K   S  EST+ GT +  L A+D D   N  + +   ++ +   +N F ++   G L +   LD E++  Y++ I A D    S  +S + +++I + D+ND  P  KF+      ++ EN   + P   L++  RD +Q  N  +T       E+  F    L    Q+   K  DRE  + Y + I   D G P+L+ + T+++ +ED ND  P F  N+   ++ E++P  T +   N   S      + +I         +++ +   S   I+  +G +  +  +DRE  + Y L V   D         T++ V++ D NDN P      +   +   T        +T    D+ S N     S     SE     F +D  +  +R +   E  S   F + + D   +  + L T    F   +D      +   F FP           ++ +G +V  +  F           Y    I      N FH+D   G+++I +P   E   ++   + + A D+G      P +  Y     EKL IT+LD+    P+     + A+I   ++PR ILT+
Sbjct: 2023 EVSIILLDVNDNPPSFISPKLTYVQENTPTDTVVFRAQ----ATDPD-SGPNSYIQYSLLGSLG--NKFSIGIIDG-----EVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEIS--ESTLTGTDLIQLIASDADEGINGMVRY---AIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRG--SSPRSDTATVSILLSDINDVVP--KFELSPYTVSVPENLE-TLPKIILQVVARDDDQGLNSRLTYSLASGNEDGAFT---LSSSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFALNHHFITIPEDAPTGTDILMVN--CSDSDAGQNGVI---------RYSLNGGNSQFTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSPTTAGSFVFAVTVTDEDIGS-NAELHFSLKGRNSEK----FHIDPLRGAIRTAGAIEGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFPLIRADRKTFTFPE----------NQEVGTLVSTI--FGSSSRGGSLSFY----IASGNFGNTFHIDELNGQLYIKNPLDFETMPKYE--LWVEARDMGF-----PPFSSY-----EKLEITVLDVNDNQPQFKQDPFIAEIIENLSPRKILTI 2678          

HSP 13 Score: 113.235 bits (282), Expect = 2.303e-24
Identity = 164/672 (24.40%), Postives = 275/672 (40.92%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEG--RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDV--EDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG--FRVSFDQSTSEDVLKYFKLDHDKLYLRK---------SLDREEI----SSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHV--VGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFII 2429
            T K+ + + D+ND +P F   QY+    E          +  A D D    N  I Y I    G  + FQ+      +   +    ALD E K  Y L ++A DG G +     ++ + V+D  +  P FS+    SF + E+   G  +  + AT  D   N NIT+ + +    +    F ++   G +     +D E+Q  Y + ++A   A   E       + I++ D+NDN P   F    +   + EN      +   K  D D   NG V+    ++    F    +D+     S       +   Y V II  D G P L++S  LT+ + D ND  P F   ++  ++ E+ P        N+   K+   D D  + GE+T+ I + +  + A  +       G LYV   +DRE+ + Y L+V  +D ++  + T + V +  ED NDN P+            N+ NY   +  F   +   +  G  + V  D  ++ +++  F+       L             DRE +     +  F ++++         L   A V + + D NDN PKF     +  +   S  E   ++  V +V + D D GNNG + Y I K   +K    F +D  TG++ +      E    ++ II
Sbjct:  659 TAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPASFVATV-TASDPDLG-INGTIRYSIR--AGDTSKFQV----HPETGAISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQG-SYSFVMFENVAVGYNVGTVVATTIDL--NTNITYLVTT---GDQKGVFTIDRSTGLIMTASVVDREEQDFYQLKVVASGGAVTGEAI-----VNITVKDLNDNSPH--FVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQNPQSLF---YVDEVTGAVSLTGPLDVDTGSYQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPV-------NSRFFKVYATDKDSGLNGEITYSIIHGNVGE-AFGIFP----DGQLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLF-----------NSTNY---VFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKF-----SKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKH---FTMDSSTGQVALVGRLDYEATASYSLII 1272          

HSP 14 Score: 97.4413 bits (241), Expect = 1.422e-19
Identity = 127/529 (24.01%), Postives = 216/529 (40.83%), Query Frame = 3
Query: 1023 FAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNG--EVTCRFLKS--ENRFFLNGLLD-----KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLT-----VEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK------LYLRKSLDREEISSFQFVIQISDK-HPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI 2534
            F++N   G +     +D E      I ++   S P    +     + I+++D+NDN P   F   +   + +E+      V     TD D+  NG    + R +    + RF L   ++      F  + S    DRE    Y++ +   D G P     + + V ++D ND  P F S+ ++  ++E+SP  +++        K++  D D           ++     T   QID  SG++ +   +D E   +Y L +   D      T   +  V + D NDN P++    F  T     V+EN  +    ALLT   +D  + N    V+      +   ++F++   K      + +  SLDRE I S+   + +SD+ HP   S +   A + + V+D ND+ P F  P   H  + +S   P G  +  V A D D G N  + Y    I+    L  F +  ++G +   S    E       ++ ISA D G Q             ++  L + LLD+
Sbjct:   73 FSINSTTGSIYTTSNIDRESLISDVINLVVLSSQPTYPTE-----VRITVLDINDNSP--VFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVL-------KVEATDRDEGPNAAI----RYQLAEGTP-FQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQ---RHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSV---ASLVIYVNDINDHPPVFQEP---HSKVEISEDLPPGSYICGVSASDGDTGLNANLRY---SIVSGNKLGWFSISENSGLVTSTSALDRE--IAPQLLLNISARDQGPQP----------KTSYATLLVNLLDV 558          

HSP 15 Score: 73.9442 bits (180), Expect = 1.943e-12
Identity = 106/498 (21.29%), Postives = 206/498 (41.37%), Query Frame = 3
Query:  447 FLIRIFEKQAS-ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKD--------FSKKNRMITYQIHFSNGGQ-NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYP-NNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCC---NDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEE 1892
            +++R+    +   ++  + IF+ D+ND  P F +  YY+++ E    +G K     A D D        +  K++   ++I+ + G   N   L Y   S + N+ +        +H +I+               + + ++D N+ AP+FS   K    V ++   GT +  + A D+  +  N+ + + L + N       F ++   G + V   L  +  K Y I + A D    P+S +   + ++T       +NY   +F   +   T+ E+  + + +  +   DRD++ NG +    + S N   L  +      +   K  D E   ++ + I   D G  + +    +T+ ++D ND  P F ++ +  SV EN+P  TT+   N   + +    + +I        +  +SD  + +  ID  +G++   G +D E    Y L V      D        + V +E  N+  P   + L+   V E
Sbjct: 2829 YIVRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPE-TLDIGSKVTQVFATDSDEGLNGHVYYFIKSQSELFRINSTTGEIFNKQHLKYQNPSVSGNINI-------NRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFS-STKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTEN---IHGKFQIDKETGWITVASSLMMDINKNYMIKVFAKDKGNPPLSSQALVNITVT------EENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNG-IIAYNISSGNEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLN--ATDVDSAPNAVIAY------SVQSSD--SDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSE 3297          
BLAST of Protocadherin delta 1 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 199.134 bits (505), Expect = 1.897e-51
Identity = 211/722 (29.22%), Postives = 326/722 (45.15%), Query Frame = 3
Query:  369 QIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP--ELKFDTENQKSTI--RENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVL-KYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLY 2480
            +ID E  +LC  + N  DEN +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A+D D +  N +  Y++     GQ++F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + E+   GT +  L ATD D   N  I +   +   + T   FA+N   G + V   LD E+  ++ +T++A D +    R +    +TI++ DVNDN P  +L++       T+   E  PI++ +  + ++D+D++ N +V C F++ E  F L  + D  Y +E++ + D E I  +   I+  D G PSL+ +  + V +EDEND  P F       SV EN+    + TT++ S+    K    + DI+ +L           NA S   +D+ +GVL  +   DRE    +   V   D+          + V V DENDN+P    + FQ  V EN   Y    ++T   SD    N    +S        VL  Y  L    +    S DRE+ SS+ F ++  D    G     +TAKV + + D NDNSP  I P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +     +        ++ IS  DLG  K   PL+
Sbjct:   91 RIDRE--KLCAGSSNS-DEN-ECFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSTVINISIPEN-TLINSRFPIPSAVDPD-TGFNGVQHYELL---NGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVF-KESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVIC-FIEREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGK----NSDIVYQL---------GPNA-SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDA-GENKAVTLSILNDNENFVLDPYSGLIKSNV----SFDREQQSSYTFDVKAVDG---GQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDTDTGMNAELKY---TIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNIS--DLGYPK---PLH 765          

HSP 2 Score: 109.768 bits (273), Expect = 1.448e-23
Identity = 140/574 (24.39%), Postives = 244/574 (42.51%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIV----LVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS--ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITY--QIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNI--------TFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTL-----TNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPIL 1859
            + EN+ IN+   IP   D   P+      GFN   H +    + V    +V+  + E     +  QN   E  D  +V  I++ +        T  L + + D+ND  P FK+ Q  V   E    +G   +   A D D    N  I Y      ++  + LF L  + T+    + +   LD E    + L +LA DG+    R  + + V D+N+  P          +  +  + E     T IA +  +D D   N+ +         F L+++ + +             L+    LDYE  K +S  I+A D+   S  +++   + + + D NDN P   F     + ++ EN      +T +  +D DS +N ++  +   + + F L+    K   + +++VFDREE +R+   +   D+G P L +   + V + DEND  P+F  N+F+F V EN P ++T+     T+S+ G +K           L+   DN++          +D YSG++    + DRE  + Y   V   D           + +++ D NDN+P++
Sbjct:  151 IPENTLINSRFPIPSAVD---PDT-----GFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDT-YVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPEN-APIGTSVVQLHATDADIGS-NAEIKYIFGAQVTSATKRLFAL--NNTTGL--ITVQRPLDREETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHLKAVYDNQYL-----------LETSSLLDYEGIKEFSFKIVAADTGKPSLNQTAL--VRVELEDENDNPP--IFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLD---RKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVT--------LSILNDNEN--------FVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVV 675          

HSP 3 Score: 63.1586 bits (152), Expect = 2.614e-9
Identity = 96/333 (28.83%), Postives = 144/333 (43.24%), Query Frame = 3
Query:  216 TLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGFNQY-FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP 1196
            T++L E  PINT I +   +DK    N KVI     +  FHL     K V   Q  LE S L        D     +F F I   +     L  T  + + +ED ND  P F Q    +   E  +  G       A D+D S KN  I YQ+     G N     +D   +   L      D E +  +I  + A D      + +  + V V+D N+ +P+F+      F V E+  K + +  + ATD+DA  N  +T  +  LN+ E    F ++ ++G +K     D E+Q  Y+  + A D       +SS+  +TI+I+D NDN P
Sbjct:  370 TVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHL-----KAVYDNQYLLETSSL-------LDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRR-GLYLTTVSASDED-SGKNSDIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHN-HFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSI--LNDNE---NFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGG--QPPRSSTAKVTINIMDANDNSP 673          
BLAST of Protocadherin delta 1 vs. Ensembl Mouse
Match: Pcdhga12 (protocadherin gamma subfamily A, 12 [Source:MGI Symbol;Acc:MGI:1935229])

HSP 1 Score: 194.126 bits (492), Expect = 3.482e-50
Identity = 194/709 (27.36%), Postives = 324/709 (45.70%), Query Frame = 3
Query:  135 MQSRNCCWK--FFSISLQLLNLVMSIEIKTLF---LKENSPI-NTTIDIPVFNDKLFP-NIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSEN-RFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTP-ILYTDLFQLTVEENTINYDRALLTFRPS---------DLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSL-DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSD 2162
            MQ R  C    F  + L +L    S +I+      L++ S + N + D+ +   +L    ++++  G  Q F L+     +V   +ID E  ELC+ +  C   NL+     + +I         Y + I + DIND  P F++ +  ++  E   + G +  LP A D D  K N + +YQ+    HFS   QN      DG ++ P L+L ++LD E K  ++L L A+D     + G   I V V+D N+ AP F+R  +   SV E+   GT +  + ATD D   N  + +    +++ + A  F ++ + G +  IGEL++E+   Y + + A D+A  S R      + ++++DVNDN PE+   +    +++ EN P  + +  L + D+DS +NG+V C     EN  F L      +Y++ ++ V DREE+  Y + +   D G P L+T   L + I D ND  P FL  ++   + EN+P          G S   V  HD       ++T+   ++ H     +S + I+  +GVLY   + D E   + +L+V   DS     +    + + V D+NDN P ILY  L      + +   + A  +  P          D DS    +        SE  L    L   ++   ++L DR+ +     V+ + D   HG   L  T  + V ++D
Sbjct:    4 MQRREDCKGLVFLGVLLGMLWKAGSTQIRYSVPEELEKGSRVGNISKDLGLEPRELEKRGVRIVSRGRAQLFALNPRSGSLVTAGRIDRE--ELCMGSIKC-QLNLEILMEDIGKI---------YGVEIEVRDINDNAPYFRESELEIKMSEN-AAAGMRFPLPHAWDPDIGK-NSLQSYQLSPNAHFSLEVQNGA----DG-NKYPELVLESSLDREEKAAHLLVLTASDAGDPVRTGTARIRVMVVDANDNAPAFARS-EYRVSVRENVAVGTQLLLVNATDPDEGANAEVIYSFRYVDD-KAAKVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGYSARAK----VLVTVLDVNDNAPEVAITS--LTNSVPENSPQGTLIALLNVNDQDSGENGQVICSI--QENLPFKLEKSYGNYYRLVTDAVLDREEVPSYNITMTATDRGSPPLTTETHLALDIADTNDNSPVFLQASYWAYIPENNP---------RGASIASVTAHDPDSDKNAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSFDYEQFPDLQLQVIARDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTL----PTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEISTARALMDRDALKQ-NLVVSVQD---HGQPPLSATVTLTVAIAD 666          

HSP 2 Score: 115.546 bits (288), Expect = 1.845e-25
Identity = 143/568 (25.18%), Postives = 235/568 (41.37%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESN-------KVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLY---VAGAIDRELTNEYRLRVCCNDSIH---VVCTDIYVDVEDENDNTPI-LYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVL--KYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP-----NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMI 2435
            + ++V DIN+ AP F RE +    + E+   G       A D D   N+  +++L    NA     F++ + NG       +L +   LD E++  + + + A D+  P+   ++ +  + + ++D NDN P   F     + ++REN  + + +  +  TD D   N EV   F       +++    K ++++SN          + EE   Y + +   D+   S    V +TVL  D ND  P+    +   SV ENSP  T +       + + V D D  GE    I     S       +++K  G  Y       +DRE    Y + +   D         T + +D+ D NDN+P+ L    +    E N      A +T    D D  N     S  + T + V    Y  ++ D   LY   S D E+    Q  +   D    G+  L +   + + V DQNDN P+ ++P      ST   L     EP G++V KV A D D G N  + Y   ++L   +  LF +  HTGEI      +     + N ++ +
Sbjct:  119 VEIEVRDINDNAPYF-RESELEIKMSENAAAGMRFPLPHAWDPDIGKNSLQSYQLSP--NAH----FSLEVQNGADGNKYPELVLESSLDREEKAAHLLVLTASDAGDPV---RTGTARIRVMVVDANDNAP--AFARSEYRVSVRENVAVGTQLLLVNATDPDEGANAEVIYSFR------YVDDKAAKVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGYSARAKVLVTVL--DVNDNAPEVAITSLTNSVPENSPQGTLI-------ALLNVNDQDS-GENGQVI----CSIQENLPFKLEKSYGNYYRLVTDAVLDREEVPSYNITMTATDRGSPPLTTETHLALDIADTNDNSPVFLQASYWAYIPENNPRGASIASVTAHDPDSDK-NAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSFDYEQFPDLQLQVIARDS---GDPPLSSNVSLSLFVLDQNDNVPEILYPTLPTDGSTGVELAPRSAEP-GYLVTKVVAVDRDSGQNAWLSY---RLLKASEPGLFSVGLHTGEISTARALMDRDALKQNLVVSV 646          
BLAST of Protocadherin delta 1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 194.897 bits (494), Expect = 3.906e-50
Identity = 184/671 (27.42%), Postives = 293/671 (43.67%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            K+   IEDIND  P F      +   E   ++  +  LP AID D    N +  YQ+  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F  E +   S+ E+   G+ +  L ATD D   N  I F   +L +      F +N   G + V   LD E+   + + ++A D      R +    + +++ D+NDN P +      +  N    + EN P+++ +  + + D+DS  NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    SV EN+       +    L+KI   D D     E+++ +       +A     +D+ +G+L     +DRE   +Y   V   D  I  + ++  ++V V D+NDN+PI   + +   V E+   +    L+T    D    N+   +S       DV   F +D     +R   S DRE   S+ F ++  D    G     +TA+V + V D NDN P FI P S +    V      G VV KV A D D+G N  V+Y    I+      LF +++ +G I +    +          +++ A DLG
Sbjct:  124 KIRFLIEDINDNAPLFPTTVINISIPEN-SAINSRYSLPAAIDPDIGI-NGVQNYQLIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARAT----VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENN-------SPGAQLTKISATDADSGQNAEISYML-----GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDY-GENSAVTLSI-----LDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDG---GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLY---SIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHR--VIVKANDLG 757          

HSP 2 Score: 117.472 bits (293), Expect = 4.428e-26
Identity = 153/570 (26.84%), Postives = 237/570 (41.58%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPI 1856
            + ENS IN+   +P   D   P+I + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P F +++  V   E  P      QL   A D D  +  R+     +FSN   N+ + L+   +    + +   LD E    + L +LA DG     R  + V V DIN+  P             +  + E+    T IA +   D D+  N  +T        F+L  +     +N F        L+    LD+E  + Y+I ++A D+      +SS   L I + D NDN P   F       ++ EN    + +T +  TD DS QN E++      +   F L+   G+L         K  DRE+ ++Y+  ++  D+G P L ++ T+ V + D+ND  P F  N + F V E+ P H T+     GL  I V D D        +     +D  T    ID  SGV+    + DRE    Y   V   D   V       + ++V D NDN PI
Sbjct:  148 IPENSAINSRYSLPAAID---PDIGING---VQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLH--ATDADIGENARI---HFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV----FSNQFL-------LETAAFLDFESTREYAIKLLAADAGKPPLNQSSM--LLIKVKDENDNAP--VFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAV------KKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTV-----GL--ITVTDPDYGENSAVTLSILDVNDQFT----IDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI 672          

HSP 3 Score: 115.931 bits (289), Expect = 1.415e-25
Identity = 167/577 (28.94%), Postives = 245/577 (42.46%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-----SENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLT-FRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLN-LFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            V I   + DIN+ AP F   +  + S+ E++   +  +   A D D   N    ++L      ++ N F +++     GD    L V  ELD E++  Y + +   D      ++SS+  L +S+ D NDN+P   F  +  + +I EN PI S VT L  TD D  +N  +   F       ++  F LN   GL      I   +  DREE   + + ++  D G  S     T+ V + D ND  P    +++ N  N    + EN+P +T +       + I V+D D    G +T F D  H        +  +++  +L  A  +D E T EY +++   D+          + + V+DENDN P+       L+V EN  N   A LT    +D DS   G           D    F LD     L   K LDRE+   + F +   D   +G   L + A VFV V DQNDNSP F     TH   N    E  P    VG +   DPD G N  V   I       D+N  F +D  +G I  N  F  E+   + F   + AED G
Sbjct:  123 VKIRFLIEDINDNAPLFPTTV-INISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGG--FPQRSSTAILQVSVADTNDNHP--IFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGL------ITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKI-------ALITVMDKDSEHNGRVTCFTD--HEVPFRLRPVFSNQF--LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPEN--NSPGAQLTKISATDADS---GQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQD---NGIPPLMSNATVFVTVLDQNDNSPIF-----THNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSI------LDVNDQFTIDPQSGVIRPNISFDRERQESYTF--YVKAEDGG 649          

HSP 4 Score: 75.485 bits (184), Expect = 3.403e-13
Identity = 74/273 (27.11%), Postives = 129/273 (47.25%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE-LTNEYRLRVCCNDSIHVVC--------TDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNT-GFRVSFDQST-SEDVLKYFKLDH-DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVK 2468
            +I+I++ +G ++  GA IDRE L     L   C   + V            I   +ED NDN P+  T +  +++ EN+ IN   +L      D+       +++   Q+    DV++  + D   +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P FI        +++  + PIG  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I +  P   E+      +++  A D G+   +
Sbjct:   74 LIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVL--ATDGGSTPAR 338          
BLAST of Protocadherin delta 1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 194.512 bits (493), Expect = 6.563e-50
Identity = 184/671 (27.42%), Postives = 293/671 (43.67%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            K+   IEDIND  P F      +   E   ++  +  LP AID D    N +  YQ+  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F  E +   S+ E+   G+ +  L ATD D   N  I F   +L +      F +N   G + V   LD E+   + + ++A D      R +    + +++ D+NDN P +      +  N    + EN P+++ +  + + D+DS  NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    SV EN+       +    L+KI   D D     E+++ +       +A     +D+ +G+L     +DRE   +Y   V   D  I  + ++  ++V V D+NDN+PI   + +   V E+   +    L+T    D    N+   +S       DV   F +D     +R   S DRE   S+ F ++  D    G     +TA+V + V D NDN P FI P S +    V      G VV KV A D D+G N  V+Y    I+      LF +++ +G I +    +          +++ A DLG
Sbjct:  124 KIRFLIEDINDNAPLFPTTVINISIPEN-SAINSRYSLPAAIDPDIGI-NGVQNYQLIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARAT----VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENN-------SPGAQLTKISATDADSGQNAEISYML-----GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDY-GENSAVTLSI-----LDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDG---GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLY---SIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHR--VIVKANDLG 757          

HSP 2 Score: 117.472 bits (293), Expect = 4.910e-26
Identity = 153/571 (26.80%), Postives = 237/571 (41.51%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPIL 1859
            + ENS IN+   +P   D   P+I + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P F +++  V   E  P      QL   A D D  +  R+     +FSN   N+ + L+   +    + +   LD E    + L +LA DG     R  + V V DIN+  P             +  + E+    T IA +   D D+  N  +T        F+L  +     +N F        L+    LD+E  + Y+I ++A D+      +SS   L I + D NDN P   F       ++ EN    + +T +  TD DS QN E++      +   F L+   G+L         K  DRE+ ++Y+  ++  D+G P L ++ T+ V + D+ND  P F  N + F V E+ P H T+     GL  I V D D        +     +D  T    ID  SGV+    + DRE    Y   V   D   V       + ++V D NDN PI 
Sbjct:  148 IPENSAINSRYSLPAAID---PDIGING---VQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLH--ATDADIGENARI---HFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV----FSNQFL-------LETAAFLDFESTREYAIKLLAADAGKPPLNQSSM--LLIKVKDENDNAP--VFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAV------KKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTV-----GL--ITVTDPDYGENSAVTLSILDVNDQFT----IDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIF 673          

HSP 3 Score: 115.546 bits (288), Expect = 1.904e-25
Identity = 167/577 (28.94%), Postives = 245/577 (42.46%), Query Frame = 3
Query:  819 VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNL---HNGD----LKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-----SENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDP----QFLSN--NFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLT-FRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLN-LFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            V I   + DIN+ AP F   + +  S+ E++   +  +   A D D   N    ++L      ++ N F +++     GD    L V  ELD E++  Y + +   D      ++SS+  L +S+ D NDN+P   F  +  + +I EN PI S VT L  TD D  +N  +   F       ++  F LN   GL      I   +  DREE   + + ++  D G  S     T+ V + D ND  P    +++ N  N    + EN+P +T +       + I V+D D    G +T F D  H        +  +++  +L  A  +D E T EY +++   D+          + + V+DENDN P+       L+V EN  N   A LT    +D DS   G           D    F LD     L   K LDRE+   + F +   D   +G   L + A VFV V DQNDNSP F     TH   N    E  P    VG +   DPD G N  V   I       D+N  F +D  +G I  N  F  E+   + F   + AED G
Sbjct:  123 VKIRFLIEDINDNAPLFPTTVIN-ISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-----IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGG--FPQRSSTAILQVSVADTNDNHP--IFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGL------ITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKI-------ALITVMDKDSEHNGRVTCFTD--HEVPFRLRPVFSNQF--LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPEN--NSPGAQLTKISATDADS---GQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQD---NGIPPLMSNATVFVTVLDQNDNSPIF-----THNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSI------LDVNDQFTIDPQSGVIRPNISFDRERQESYTF--YVKAEDGG 649          

HSP 4 Score: 75.485 bits (184), Expect = 3.307e-13
Identity = 74/273 (27.11%), Postives = 129/273 (47.25%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE-LTNEYRLRVCCNDSIHVVC--------TDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNT-GFRVSFDQST-SEDVLKYFKLDH-DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVK 2468
            +I+I++ +G ++  GA IDRE L     L   C   + V            I   +ED NDN P+  T +  +++ EN+ IN   +L      D+       +++   Q+    DV++  + D   +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P FI        +++  + PIG  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I +  P   E+      +++  A D G+   +
Sbjct:   74 LIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVL--ATDGGSTPAR 338          
BLAST of Protocadherin delta 1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 194.897 bits (494), Expect = 6.719e-50
Identity = 191/701 (27.25%), Postives = 303/701 (43.22%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIF-EKQASILT------YKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            E L    V   R F E + ++L        K+   IEDIND  P F      +   E   ++  +  LP AID D    N +  YQ+  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F  E +   S+ E+   G+ +  L ATD D   N  I F   +L +      F +N   G + V   LD E+   + + ++A D      R +    + +++ D+NDN P +      +  N    + EN P+++ +  + + D+DS  NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    SV EN+       +    L+KI   D D     E+++ +       +A     +D+ +G+L     +DRE   +Y   V   D  I  + ++  ++V V D+NDN+PI   + +   V E+   +    L+T    D    N+   +S       DV   F +D     +R   S DRE   S+ F ++  D    G     +TA+V + V D NDN P FI P S +    V      G VV KV A D D+G N  V+Y    I+      LF +++ +G I +    +          +++ A DLG
Sbjct:   94 EKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPEN-SAINSRYSLPAAIDPDIGI-NGVQNYQLIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARAT----VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENN-------SPGAQLTKISATDADSGQNAEISYML-----GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDY-GENSAVTLSI-----LDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDG---GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLY---SIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHR--VIVKANDLG 757          

HSP 2 Score: 117.087 bits (292), Expect = 7.089e-26
Identity = 153/571 (26.80%), Postives = 237/571 (41.51%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPIL 1859
            + ENS IN+   +P   D   P+I + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P F +++  V   E  P      QL   A D D  +  R+     +FSN   N+ + L+   +    + +   LD E    + L +LA DG     R  + V V DIN+  P             +  + E+    T IA +   D D+  N  +T        F+L  +     +N F        L+    LD+E  + Y+I ++A D+      +SS   L I + D NDN P   F       ++ EN    + +T +  TD DS QN E++      +   F L+   G+L         K  DRE+ ++Y+  ++  D+G P L ++ T+ V + D+ND  P F  N + F V E+ P H T+     GL  I V D D        +     +D  T    ID  SGV+    + DRE    Y   V   D   V       + ++V D NDN PI 
Sbjct:  148 IPENSAINSRYSLPAAID---PDIGING---VQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLH--ATDADIGENARI---HFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV----FSNQFL-------LETAAFLDFESTREYAIKLLAADAGKPPLNQSSM--LLIKVKDENDNAP--VFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAV------KKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTV-----GL--ITVTDPDYGENSAVTLSILDVNDQFT----IDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIF 673          

HSP 3 Score: 75.8702 bits (185), Expect = 2.766e-13
Identity = 74/273 (27.11%), Postives = 129/273 (47.25%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE-LTNEYRLRVCCNDSIHVVC--------TDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNT-GFRVSFDQST-SEDVLKYFKLDH-DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVK 2468
            +I+I++ +G ++  GA IDRE L     L   C   + V            I   +ED NDN P+  T +  +++ EN+ IN   +L      D+       +++   Q+    DV++  + D   +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P FI        +++  + PIG  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I +  P   E+      +++  A D G+   +
Sbjct:   74 LIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVL--ATDGGSTPAR 338          
BLAST of Protocadherin delta 1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 194.512 bits (493), Expect = 7.911e-50
Identity = 191/701 (27.25%), Postives = 303/701 (43.22%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIF-EKQASILT------YKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            E L    V   R F E + ++L        K+   IEDIND  P F      +   E   ++  +  LP AID D    N +  YQ+  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F  E +   S+ E+   G+ +  L ATD D   N  I F   +L +      F +N   G + V   LD E+   + + ++A D      R +    + +++ D+NDN P +      +  N    + EN P+++ +  + + D+DS  NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    SV EN+       +    L+KI   D D     E+++ +       +A     +D+ +G+L     +DRE   +Y   V   D  I  + ++  ++V V D+NDN+PI   + +   V E+   +    L+T    D    N+   +S       DV   F +D     +R   S DRE   S+ F ++  D    G     +TA+V + V D NDN P FI P S +    V      G VV KV A D D+G N  V+Y    I+      LF +++ +G I +    +          +++ A DLG
Sbjct:   94 EKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPEN-SAINSRYSLPAAIDPDIGI-NGVQNYQLIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARAT----VLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENN-------SPGAQLTKISATDADSGQNAEISYML-----GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGE-NSAVTLSI-----LDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDG---GRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLY---SIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHR--VIVKANDLG 757          

HSP 2 Score: 116.701 bits (291), Expect = 9.484e-26
Identity = 153/570 (26.84%), Postives = 237/570 (41.58%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPI 1856
            + ENS IN+   +P   D   P+I + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P F +++  V   E  P      QL   A D D  +  R+     +FSN   N+ + L+   +    + +   LD E    + L +LA DG     R  + V V DIN+  P             +  + E+    T IA +   D D+  N  +T        F+L  +     +N F        L+    LD+E  + Y+I ++A D+      +SS   L I + D NDN P   F       ++ EN    + +T +  TD DS QN E++      +   F L+   G+L         K  DRE+ ++Y+  ++  D+G P L ++ T+ V + D+ND  P F  N + F V E+ P H T+     GL  I V D D        +     +D  T    ID  SGV+    + DRE    Y   V   D   V       + ++V D NDN PI
Sbjct:  148 IPENSAINSRYSLPAAID---PDIGING---VQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLH--ATDADIGENARI---HFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV----FSNQFL-------LETAAFLDFESTREYAIKLLAADAGKPPLNQSSM--LLIKVKDENDNAP--VFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAV------KKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTV-----GL--ITVTDPDYGENSAVTLSILDVNDQFT----IDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI 672          

HSP 3 Score: 75.8702 bits (185), Expect = 3.238e-13
Identity = 74/273 (27.11%), Postives = 129/273 (47.25%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE-LTNEYRLRVCCNDSIHVVC--------TDIYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNT-GFRVSFDQST-SEDVLKYFKLDH-DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVK 2468
            +I+I++ +G ++  GA IDRE L     L   C   + V            I   +ED NDN P+  T +  +++ EN+ IN   +L      D+       +++   Q+    DV++  + D   +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P FI        +++  + PIG  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I +  P   E+      +++  A D G+   +
Sbjct:   74 LIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVL--ATDGGSTPAR 338          
BLAST of Protocadherin delta 1 vs. UniProt/SwissProt
Match: sp|Q5DRB9|PCDGC_PANTR (Protocadherin gamma-A12 OS=Pan troglodytes OX=9598 GN=PCDHGA12 PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.269e-50
Identity = 160/542 (29.52%), Postives = 266/542 (49.08%), Query Frame = 3
Query:  291 NIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTP-ILYTDL 1871
             +++I  G  Q F L+     +V   +ID E  ELC+    C   NLD        + E +  I  Y + + + DIND  P F++ +  ++  E   +   +  LP A D D  K N + +Y++    HFS     + Q   DG S+ P L+L  ALD E K  + L L A+DG    + G   I V V+D N+ AP F++  +   SV E+   GT +  + ATD D   N  + +   S+++ + A  F ++ ++G +  IGELD+E+   Y + + A D+A  S R      + I+++DVNDN PE+   +    S++ EN P  + +  L + D+DS +NG+V C F++    F L      +Y + ++ V DRE++  Y + +   D G P LST   +++ + D ND  P F   ++   + EN+P          G+S + V  HD       ++T+   +N     + +S + I+  +GVLY   + D E   + +++V   D+ H   +    + + V D+NDN P ILY  L
Sbjct:   63 GVRIIPRGRTQLFALNPRSGSLVTAGRIDRE--ELCMGAIKC-QLNLDI-------LMEDKVKI--YGVEVEVRDINDNAPYFRESELEIKISEN-AATEMRFPLPHAWDPDIGK-NSLQSYELSPNTHFSL----IVQNGADG-SKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQP-EYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRSVDD-KAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAK----VLITVLDVNDNAPEVVLTS--LASSVPENSPRGTLIALLNVNDQDSEENGQVIC-FIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNP---------RGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAPEILYPAL 567          

HSP 2 Score: 112.849 bits (281), Expect = 7.530e-24
Identity = 150/595 (25.21%), Postives = 248/595 (41.68%), Query Frame = 3
Query:  732 LLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-FAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLD-KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT----NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQST--SEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP-----NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMI 2435
            L + A+ C+      LD+L  D     G   + V+V DIN+ AP F RE +    + E+           A D D   N+  +++L       + NT F++ + NG       +L +   LD E++  + + + A D   P+   ++ +  + + ++D NDN P   F     ++++ EN  + + +  +  TD D   N EV   F   +++      LD     I +    D EE   Y + +   D+   S    V +TVL  D ND  P+ +  +   SV ENSP  T +     N  +     QVI   I G L F ++  +           + YS V  +   +DRE    Y + V   D         T I ++V D NDN P+     +   + EN      +L++    D D   N     S  ++T     +  Y  ++ D   LY   S D E+    Q  +   D   +G+  L +   + + V DQNDN+P+ ++P      ST   L     EP G++V KV A D D G N  + Y   ++L   +  LF +  HTGE+      L     + + ++ +
Sbjct:   95 LCMGAIKCQLN----LDILMEDKVKIYG---VEVEVRDINDNAPYF-RESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYEL-------SPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPV---RTGTARIRVMVLDANDNAP--AFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRSVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVL--DVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICF-IQGNLPFKLEKSYG----------NYYSLVTDIV--LDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPR-GVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARD---NGHPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTSVELAPRSAEP-GYLVTKVVAVDRDSGQNAWLSY---RLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAV 646          

HSP 3 Score: 85.8853 bits (211), Expect = 1.407e-15
Identity = 76/257 (29.57%), Postives = 124/257 (48.25%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLE--SLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDT-ENQKSTIRENQPISSP----VTFLKITDRDSNQNGEVTCRFLK-SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS 1565
            I + V D N+  P F +   S++ + E+  +G  +  + A D D   N  IT+ L   ++  A  ++  ++N   G L  +   DYE+ +   + ++A D+   P+S    S+ SL++ ++D NDN PE+ +       ST  E  P S+     VT +   DRDS QN  ++ R LK SE   F  GL     +  +  + DR+ + +  V +   DHG P LS +VTLTV +    +  PQ L++        NS
Sbjct:  438 ISLNVADTNDNPPVFPQASYSAY-IPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLS----SNVSLSLFVLDQNDNAPEILYPALPTDGSTSVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSATVTLTVAVA---NSIPQVLADLGSLESPANS 684          
BLAST of Protocadherin delta 1 vs. UniProt/SwissProt
Match: sp|O60330|PCDGC_HUMAN (Protocadherin gamma-A12 OS=Homo sapiens OX=9606 GN=PCDHGA12 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 3.139e-50
Identity = 181/649 (27.89%), Postives = 300/649 (46.22%), Query Frame = 3
Query:  291 NIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTP-ILYTDLFQLTVEENTINYDRALLTFRPS---------DLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLY-LRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSD 2162
             +++I  G  Q F L+     +V   +ID E  ELC+    C   NLD        + E +  I  Y + + + DIND  P F++ +  ++  E   +   +  LP A D D  K N + +Y++    HFS     + Q   DG S+ P L+L  ALD E K  + L L A+DG    + G   I V V+D N+ AP F++  +   SV E+   GT +  + ATD D   N  + +    +++ + A  F ++ ++G +  IGELD+E+   Y + + A D+A  S R      + I+++DVNDN PE+   +    S++ EN P  + +  L + D+DS +NG+V C F++    F L      +Y + ++ V DRE++  Y + +   D G P LST   +++ + D ND  P F   ++   + EN+P          G+S + V  HD       ++T+   +N     + +S + I+  +GVLY   + D E   + +++V   D+ H   +    + + V D+NDN P ILY  L      + +   + A  +  P          D DS    +        SE  L    L   ++   R  LDR+ +     V+ + D   HG   L  T  + V V+D
Sbjct:   63 GVRIIPRGRTQLFALNPRSGSLVTAGRIDRE--ELCMGAIKC-QLNLDI-------LMEDKVKI--YGVEVEVRDINDNAPYFRESELEIKISEN-AATEMRFPLPHAWDPDIGK-NSLQSYELSPNTHFSL----IVQNGADG-SKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQP-EYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDD-KAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAK----VLITVLDVNDNAPEVVLTS--LASSVPENSPRGTLIALLNVNDQDSEENGQVIC-FIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNP---------RGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAPEILYPAL----PTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQ-SLVVAVQD---HGQPPLSATVTLTVAVAD 666          

HSP 2 Score: 112.464 bits (280), Expect = 1.116e-23
Identity = 150/595 (25.21%), Postives = 248/595 (41.68%), Query Frame = 3
Query:  732 LLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-FAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLD-KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT----NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQST--SEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP-----NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMI 2435
            L + A+ C+      LD+L  D     G   + V+V DIN+ AP F RE +    + E+           A D D   N+  +++L       + NT F++ + NG       +L +   LD E++  + + + A D   P+   ++ +  + + ++D NDN P   F     ++++ EN  + + +  +  TD D   N EV   F   +++      LD     I +    D EE   Y + +   D+   S    V +TVL  D ND  P+ +  +   SV ENSP  T +     N  +     QVI   I G L F ++  +           + YS V  +   +DRE    Y + V   D         T I ++V D NDN P+     +   + EN      +L++    D D   N     S  ++T     +  Y  ++ D   LY   S D E+    Q  +   D   +G+  L +   + + V DQNDN+P+ ++P      ST   L     EP G++V KV A D D G N  + Y   ++L   +  LF +  HTGE+      L     + + ++ +
Sbjct:   95 LCMGAIKCQLN----LDILMEDKVKIYG---VEVEVRDINDNAPYF-RESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYEL-------SPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPV---RTGTARIRVMVLDANDNAP--AFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVL--DVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICF-IQGNLPFKLEKSYG----------NYYSLVTDIV--LDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPR-GVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARD---NGHPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEP-GYLVTKVVAVDRDSGQNAWLSY---RLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAV 646          

HSP 3 Score: 87.8113 bits (216), Expect = 3.569e-16
Identity = 77/257 (29.96%), Postives = 124/257 (48.25%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLE--SLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDT-ENQKSTIRENQPISSP----VTFLKITDRDSNQNGEVTCRFLK-SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS 1565
            I + V D N+  P F +   S++ + E+  +G  +  + A D D   N  IT+ L   ++  A  ++  ++N   G L  +   DYE+ +   + ++A D+   P+S    S+ SL++ ++D NDN PE+ +       ST  E  P S+     VT +   DRDS QN  ++ R LK SE   F  GL     +  +  + DR+ + +  V +   DHG P LS +VTLTV +    D  PQ L++        NS
Sbjct:  438 ISLNVADTNDNPPVFPQASYSAY-IPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNGHPPLS----SNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRT-ARALLDRDALKQSLV-VAVQDHGQPPLSATVTLTVAVA---DSIPQVLADLGSLESPANS 684          
BLAST of Protocadherin delta 1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 5.506e-50
Identity = 177/648 (27.31%), Postives = 289/648 (44.60%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTH-FVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            K+   IEDIND  P F      +   E   ++  K  LP A+D D    N +  Y++  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F +E +   S+ E+   GT +  L ATD D   N  I F   +L +      F +N   G + +   LD E+   + + ++A D   +  R      + +++ DVNDN P +      +  N    + EN P+++ +  + +TD+D++ NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    S+ EN+       +    L+K+   D D     E+ + +       +A     +D+ +G+L V   +DRE  ++Y   +   D+     T    ++V + D+NDN+P+   + +   V EN   +    L+T    D    N+   +S      +     F +D     +R   S DRE+  S+ F ++  D    G     ++AKV + V D NDN P FI P S + + L +    P G VV +V A D D G N  V Y    I+     +LF +D+ TG I +
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGT-NGVQNYELIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM----VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN-------SPGIQLTKVSATDADSGPNAEINYLL-----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD-----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG---GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVMAVDNDTGMNAEVRY---SIVGGNTRDLFAIDQETGNITL 735          

HSP 2 Score: 121.324 bits (303), Expect = 2.841e-26
Identity = 155/568 (27.29%), Postives = 243/568 (42.78%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPI 1856
            + ENS IN+   +P   D   P++   G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P FK+ +  V   E  P      QL   A D D  +  ++      FSN   N+ + L+   +    + +   LD E   ++ L +LA+DG     R ++ V V D+N+  P          +  +  + E+    T IA +  TD DA  N  +T        F+L  +     +N F        L+    LDYE  K Y+I ++A D+   P+++    S  L I + D NDN P   F       +I EN      +T +  TD DS  N E+   +L   +      L  +   +   K  DRE+ D+Y   I+  D+G P L+++VT+ V I D+ND  P F  N + F V EN P H T+     GL  +   D+     +T  I +++  D+ T    ID  +GV+    + DRE    Y   V   D   V       + ++V D NDN P+
Sbjct:  148 IPENSAINSKYTLPAAVD---PDV---GTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLH--ATDADIGENAKI---HFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV----FSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQ----SAMLFIKVKDENDNAP--VFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEI--NYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTV-----GLITVTDPDYGDNSAVTLSILDEN--DDFT----IDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPV 672          

HSP 3 Score: 114.005 bits (284), Expect = 4.547e-24
Identity = 130/446 (29.15%), Postives = 193/446 (43.27%), Query Frame = 3
Query: 1170 IIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE---LTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS-IHVVCTDIYVDVEDENDNTP---ILY-----TDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            I D+NDN P       N   +I EN  I+S  T     D D   NG      +KS+N F L+ +     DK  Q+   K  DREE D Y + +   D G P  S++  L V + D ND  P F       S+ EN+P  T++T       ++   D DI GE   + F   N   S+ A  +  ++  +G++ +   +DRE T  ++L V  +D  +      + V+V D NDN P   I Y      D   L+ E   +N   AL+T   +D D+ + G    F        L+    +   L     LD E    +   +  +D    G   L  +A +F+KV D+NDN+P F     T   + VS  E    G  + KV A D D G N  + Y +    P +    F LDR TG + +      E+  ++ F I+  A+D G
Sbjct:  129 IEDINDNAPLFPATVIN--ISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT-------QLHATDADI-GENAKIHFSFSNL-VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS-ENIPLNTKIALITV--TDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADA---GKPPLNQSAMLFIKVKDENDNAPVF-----TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTIL--AKDNG 546          

HSP 4 Score: 104.76 bits (260), Expect = 2.773e-21
Identity = 102/357 (28.57%), Postives = 164/357 (45.94%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND 1790
            LD E+   Y + LLA D AGK       ++ +KV D N+ AP F++    + S+ E+   G  +  + ATD D+ PN  I + L      +    F+++   G L V+ +LD EK+  Y  TI+A D+   P++    S+ ++ +SIID NDN P    +  N    + EN P    V  + +TD D   N  VT   L   + F ++    +   I  N  FDRE+ + Y   +   D G  S S+S  +T+ + D ND  P F+     +S      +   L ++N G    QV+    D  +  E+ + I   +T D    +  ID+ +G + +    D      +R+ V  ND
Sbjct:  424 LDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSF-VTVSIPENNSPGIQLTKVSATDADSGPNAEINYLL----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLT----SNVTVFVSIIDQNDNSPVFTHNEYN--FYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS---QTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYS------YELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD----LFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755          

HSP 5 Score: 73.559 bits (179), Expect = 1.129e-11
Identity = 72/267 (26.97%), Postives = 126/267 (47.19%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE--LTNEYRLRVCCNDSIHVVCTD-------IYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDS-TNTGFRVSFDQSTSE-----DVLKYFKLDH-DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            +I+I++ +G ++  GA IDRE       R   C  +    +  D       I   +ED NDN P+    +  +++ EN+ IN    L    P+ +D    T    +++   S+     DV++  + D   +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P F     T   +++  + P+G  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I I  P   E+      +++ S
Sbjct:   74 LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTL----PAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS 330          
BLAST of Protocadherin delta 1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 5.849e-50
Identity = 177/648 (27.31%), Postives = 289/648 (44.60%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTH-FVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            K+   IEDIND  P F      +   E   ++  K  LP A+D D    N +  Y++  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F +E +   S+ E+   GT +  L ATD D   N  I F   +L +      F +N   G + +   LD E+   + + ++A D   +  R      + +++ DVNDN P +      +  N    + EN P+++ +  + +TD+D++ NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    S+ EN+       +    L+K+   D D     E+ + +       +A     +D+ +G+L V   +DRE  ++Y   +   D+     T    ++V + D+NDN+P+   + +   V EN   +    L+T    D    N+   +S      +     F +D     +R   S DRE+  S+ F ++  D    G     ++AKV + V D NDN P FI P S + + L +    P G VV +V A D D G N  V Y    I+     +LF +D+ TG I +
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGT-NGVQNYELIKS---QNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM----VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN-------SPGIQLTKVSATDADSGPNAEINYLL-----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD-----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG---GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVMAVDNDTGMNAEVRY---SIVGGNTRDLFAIDQETGNITL 735          

HSP 2 Score: 121.324 bits (303), Expect = 2.914e-26
Identity = 155/568 (27.29%), Postives = 243/568 (42.78%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPI 1856
            + ENS IN+   +P   D   P++   G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P FK+ +  V   E  P      QL   A D D  +  ++      FSN   N+ + L+   +    + +   LD E   ++ L +LA+DG     R ++ V V D+N+  P          +  +  + E+    T IA +  TD DA  N  +T        F+L  +     +N F        L+    LDYE  K Y+I ++A D+   P+++    S  L I + D NDN P   F       +I EN      +T +  TD DS  N E+   +L   +      L  +   +   K  DRE+ D+Y   I+  D+G P L+++VT+ V I D+ND  P F  N + F V EN P H T+     GL  +   D+     +T  I +++  D+ T    ID  +GV+    + DRE    Y   V   D   V       + ++V D NDN P+
Sbjct:  148 IPENSAINSKYTLPAAVD---PDV---GTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSS--TAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLH--ATDADIGENAKI---HFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV----FSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQ----SAMLFIKVKDENDNAP--VFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEI--NYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTV-----GLITVTDPDYGDNSAVTLSILDEN--DDFT----IDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPV 672          

HSP 3 Score: 114.005 bits (284), Expect = 4.785e-24
Identity = 130/446 (29.15%), Postives = 193/446 (43.27%), Query Frame = 3
Query: 1170 IIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE---LTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS-IHVVCTDIYVDVEDENDNTP---ILY-----TDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            I D+NDN P       N   +I EN  I+S  T     D D   NG      +KS+N F L+ +     DK  Q+   K  DREE D Y + +   D G P  S++  L V + D ND  P F       S+ EN+P  T++T       ++   D DI GE   + F   N   S+ A  +  ++  +G++ +   +DRE T  ++L V  +D  +      + V+V D NDN P   I Y      D   L+ E   +N   AL+T   +D D+ + G    F        L+    +   L     LD E    +   +  +D    G   L  +A +F+KV D+NDN+P F     T   + VS  E    G  + KV A D D G N  + Y +    P +    F LDR TG + +      E+  ++ F I+  A+D G
Sbjct:  129 IEDINDNAPLFPATVIN--ISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT-------QLHATDADI-GENAKIHFSFSNL-VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS-ENIPLNTKIALITV--TDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADA---GKPPLNQSAMLFIKVKDENDNAPVF-----TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTIL--AKDNG 546          

HSP 4 Score: 104.76 bits (260), Expect = 2.918e-21
Identity = 102/357 (28.57%), Postives = 164/357 (45.94%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND 1790
            LD E+   Y + LLA D AGK       ++ +KV D N+ AP F++    + S+ E+   G  +  + ATD D+ PN  I + L      +    F+++   G L V+ +LD EK+  Y  TI+A D+   P++    S+ ++ +SIID NDN P    +  N    + EN P    V  + +TD D   N  VT   L   + F ++    +   I  N  FDRE+ + Y   +   D G  S S+S  +T+ + D ND  P F+     +S      +   L ++N G    QV+    D  +  E+ + I   +T D    +  ID+ +G + +    D      +R+ V  ND
Sbjct:  424 LDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSF-VTVSIPENNSPGIQLTKVSATDADSGPNAEINYLL----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLT----SNVTVFVSIIDQNDNSPVFTHNEYN--FYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS---QTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYS------YELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD----LFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755          

HSP 5 Score: 73.559 bits (179), Expect = 1.139e-11
Identity = 72/267 (26.97%), Postives = 126/267 (47.19%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE--LTNEYRLRVCCNDSIHVVCTD-------IYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDS-TNTGFRVSFDQSTSE-----DVLKYFKLDH-DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            +I+I++ +G ++  GA IDRE       R   C  +    +  D       I   +ED NDN P+    +  +++ EN+ IN    L    P+ +D    T    +++   S+     DV++  + D   +L ++K LDREE  ++   +++ D    G  Q  +TA + V V+D NDN P F     T   +++  + P+G  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I I  P   E+      +++ S
Sbjct:   74 LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTL----PAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG---GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS 330          
BLAST of Protocadherin delta 1 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.352e-49
Identity = 177/648 (27.31%), Postives = 289/648 (44.60%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTH-FVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            K+   IEDIND  P F      +   E   ++  K  LP A+D D    N +  Y++  S   QN+F L    T +    P L++   LD E K  Y++ +   DG    +    ++ V V D N+  P F +E +   S+ E+   GT +  L ATD D   N  I F   +L +      F +N   G + +   LD E+   + + ++A D   +  R      + +++ DVNDN P +      +  N    + EN P+++ +  + +TD+D++ NG VTC F   E  F L  +    + +E+    D E    Y + ++  D G P L+ S  L + ++DEND  P F  +    S+ EN+       +    L+K+   D D     E+ + +       +A     +D+ +G+L V   +DRE  ++Y   +   D+     T    ++V + D+NDN+P+   + +   V EN   +    L+T    D    N+   +S      +     F +D     +R   S DRE+  S+ F ++  D    G     ++AKV + V D NDN P FI P S + + L +    P G VV +V A D D G N  V Y    I+     +LF +D+ TG I +
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGI-NGVQNYELIKS---QNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF-KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM----VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENN-------SPGIQLTKVSATDADSGPNAEINYLL-----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD-----FTIDSQTGVIRPNISFDREKQESYTFYVKAEDG---GRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRY---SIVGGNTRDLFAIDQETGNITL 735          

HSP 2 Score: 122.479 bits (306), Expect = 1.277e-26
Identity = 155/568 (27.29%), Postives = 244/568 (42.96%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL-VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRI----FEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNIT--------FKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPI 1856
            + ENS IN+   +P   D   P++ + G    Q + L KS+N   L V +    D    +  Q   D      +V  +++    F +++S  T  L + + D ND  P FK+ +  V   E  P      QL   A D D  +  ++      FSN   N+ + L+   +    + +   LD E   ++ L +LA+DG     R ++ V V D+N+  P          +  +  + E+    T IA +  TD DA  N  +T        F+L  +     +N F        L+    LDYE  K Y+I ++A D+   P+++    S  L I + D NDN P   F       +I EN      +T +  TD DS  N E+   +L   +      L  +   +   K  DRE+ D+Y   I+  D+G P L+++VT+ V I D+ND  P F  N + F V EN P H T+     GL  +   D+     +T  I +++  D+ T    ID  +GV+    + DRE    Y   V   D   V       + ++V D NDN P+
Sbjct:  148 IPENSAINSKYTLPAAVD---PDVGING---VQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSS--TAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLH--ATDADIGENAKI---HFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPV----FSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQ----SAMLFIKVKDENDNAP--VFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEI--NYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTV-----GLITVTDPDYGDNSAVTLSILDEN--DDFT----IDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPV 672          

HSP 3 Score: 112.079 bits (279), Expect = 1.786e-23
Identity = 129/446 (28.92%), Postives = 193/446 (43.27%), Query Frame = 3
Query: 1170 IIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGE---LTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS-IHVVCTDIYVDVEDENDNTP---ILY-----TDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            I D+NDN P       N   +I EN  I+S  T     D D   NG      +KS+N F L+ +     DK  Q+   K  DRE+ D Y + +   D G P  S++  L V + D ND  P F       S+ EN+P  T++T       ++   D DI GE   + F   N   S+ A  +  ++  +G++ +   +DRE T  ++L V  +D  +      + V+V D NDN P   I Y      D   L+ E   +N   AL+T   +D D+ + G    F        L+    +   L     LD E    +   +  +D    G   L  +A +F+KV D+NDN+P F     T   + VS  E    G  + KV A D D G N  + Y +    P +    F LDR TG + +      E+  ++ F I+  A+D G
Sbjct:  129 IEDINDNAPLFPATVIN--ISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT-------QLHATDADI-GENAKIHFSFSNL-VSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLS-ENIPLNTKIALITV--TDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADA---GKPPLNQSAMLFIKVKDENDNAPVF-----TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTIL--AKDNG 546          

HSP 4 Score: 105.916 bits (263), Expect = 1.370e-21
Identity = 103/357 (28.85%), Postives = 164/357 (45.94%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEG---RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND 1790
            LD E+   Y + LLA D AGK       ++ +KV D N+ AP F++    + S+ E+   G  +  + ATD D+ PN  I + L      +    F+++   G L V+ +LD EK+  Y  TI+A D+   P++    S+ ++ +SIID NDN P    +  N    + EN P    V  + +TD D   N  VT   L   + F ++    +   I  N  FDRE+ + Y   +   D G  S S+S  +T+ + D ND  P F+     +S      +   L ++N G    QVI    D  +  E+ + I   +T D    +  ID+ +G + +    D      +R+ V  ND
Sbjct:  424 LDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSF-VTVSIPENNSPGIQLTKVSATDADSGPNAEINYLL----GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLT----SNVTVFVSIIDQNDNSPVFTHNEYN--FYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS---QTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYS------YELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD----LFAIDQETGNITLMEKCDVTDLGLHRVLVKAND 755          

HSP 5 Score: 70.4774 bits (171), Expect = 9.456e-11
Identity = 71/272 (26.10%), Postives = 124/272 (45.59%), Query Frame = 3
Query: 1692 VIQIDKYSGVLYVAGA-IDRE--LTNEYRLRVCCNDSIHVVCTD-------IYVDVEDENDNTPILYTDLFQLTVEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLK---YFKLD---------HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            +I+I++ +G ++  GA IDRE       R   C  +    +  D       I   +ED NDN P+    +  +++ EN+ IN    L    P+ +D       V  +   + +++K    F LD           +L ++K LDRE+  ++   +++ D    G  Q  +TA + V V+D NDN P F     T   +++  + P+G  V ++ A D D+G N  + +  S ++ +    LFHL+  TG I I  P   E+      +++ S
Sbjct:   74 LIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTL----PAAVDP-----DVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDG---GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS 330          

HSP 6 Score: 54.6842 bits (130), Expect = 6.105e-6
Identity = 72/291 (24.74%), Postives = 123/291 (42.27%), Query Frame = 3
Query: 1476 VTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT-----NSNNGLSKIQVIDHDIIGELTFF-IDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI---HVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSP----KFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTV 2300
            V +  LIED ND  P F +     S+ ENS  ++  T     + + G++ +Q  ++++I     F +D   T +        DK    L V   +DRE  + Y ++V   D           + V V D NDN P+      ++++ EN      ++     +D D   N     SF    S    + F L+     + +++ LDREE  + + ++  SD        +   A V V V+D NDN P    ++I  N  +  + +S + P+   +  +   D D  +NG V
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQ--NYELIKSQNMFGLDVIETPEG-------DKMPQ-LIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENA-PVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-----GGLMPARAMVLVNVTDVNDNVPSIDIRYIV-NPVNDTVVLSENIPLNTKIALITVTDKDADHNGRV 396          
BLAST of Protocadherin delta 1 vs. TrEMBL
Match: A0A504YTN0 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_00183 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 3.468e-107
Identity = 310/1087 (28.52%), Postives = 479/1087 (44.07%), Query Frame = 3
Query:  204 IEIKTLFLKENSPINTTI--DIPVFNDKLFPNIKVIGDG-FNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLD--------------------------------------CK---FVFLIRIFEKQASILTYKLNIFIEDINDWTPAFK----QRQYYVE--------------------FYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHF-----------------------------SNG--GQNL--FQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSS---------------FSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLN-NAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-----PISER-----------KSSSFSLTISIIDVNDNYPELKFDTENQ-----------------------------KSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSK-IQVIDHDIIGELTFFIDNKHTSDNATSVI---------------------QIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSF--------------------------DQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQL------------FTT-AKVFVKVSDQNDNSPKFIFPNSTHFV---LNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIP-------------------RSYSAKI--------------TLITPRLILTVILSFSTLFLMCLLIAWALIIF---RQRQRNLR 2678
            I + T+++ EN+ I + I  DI         ++  +G G   Q+F LD    ++V +  +DLE  E+C   ++CC + L                                       C+   FV      EKQ + +T +L + + D+ND  P F+     RQ   E                    F EG   +  +Q LP A D DF+  NR+  Y + +                              NG    NL  F+L+Y    ++  L L + LD E +  Y L L+A DG G  G++ I V+V+D+NE+ P F+ E  S                +SV ES   G+ +  L+A D D  P N IT++L   N   +  +TF ++  +G LK++G LDYE  + Y +TIIA D       P+S R           +S++  + I++IDVNDN P ++F+ E+                              +  I+E+ P  SPVTF  ++DRD   NG VTC  +    RF L+      Y +E+   FDRE  D Y++ I CHDHG P L T   L + IED ND  P F    ++F V+ENSP  T L   N    K +   D D+   + + ++ +  +     +I                     QID  +G++   G +DRE       +VC +D  HV CTD+ V ++D NDN P    D + + VEEN +++ +  LTFR +D D+ N GF   F                          +Q     V  +F L  + LY+R+ LDRE  S++ F + ++D       Q             FT+ A++F+ V D NDN+P FIFPNST      L+VSCHE +G  V ++QA DPDLG N TV + +    P+ D  LF+LD  +GE+F+N+  L+++ C  + I+++S +D G      P  ++  S   E++ I + D P                    S   ++               +++ R IL+V+L  ST+FL+ LL+ W +++     +R++NLR
Sbjct:   51 ISMPTVYVLENATIGSVIIQDIRSHLGLSINSMVKLGPGSLTQFFRLDSDSGRLVTISSLDLESPEICQAEKSCCRQELPNGAQQFPMAKLTYSDPSLPNNTPNTITDAIRELSGRDVCRMMAFVLSELGAEKQLTPIT-RLYVTVVDLNDNAPVFRLTEENRQTSSEGKTTYNINKHVGDMPAVKLVFSEGSVGLHSRQDLPSAYDADFALVNRVKRYWLEWDKDKSKFPIDSLDSGTLLETIPNILSVDDQNGLTWANLGPFRLIYLEPGRSIALELDSELDREQQDFYQLRLVAEDGGGLRGQIRIEVEVLDVNEFTPVFADEPPSKEQLIQMKPRAIYRKRYSVKESLTTGSELGQLRAYDADQSPGNWITYRLGPSNPPGDLTDTFQIHPKSGVLKLVGTLDYETTQQYRLTIIAQDGPTSDNIPLSARNSQPRNLAGTYRSATAIVEINVIDVNDNAPVIRFEKEDNLPPNTSGGSHPTVTVLSKTVPADGSKIPYEVWIKEDLPKGSPVTFFSVSDRDLADNGRVTCSLMNWTERFRLHEFT-GLYGLETMDGFDRELTDSYYLTIRCHDHGIPVLQTDRALLIHIEDVNDLPPVFQLPVYQFHVQENSPPGTPLKPVNANFPKLVTATDPDLNSTIKYHLEPRRMNTKPHGLIRTESGTTRLESLDGSLDHTLFQIDSLTGLITTQGELDREERTRLNFQVCADDGKHVTCTDVTVLLDDVNDNRPQFDRDTYVIRVEENQLSH-KPCLTFRVTDADAGNHGFVYDFLEEPTATLEPKHKLVGRNQTGISHEWEQFEPGSVRYHFALRENTLYVRRPLDREFRSNYHFFVMVTDSQEAPRIQSDEPGYRNSYPKNFTSKAEIFIDVGDVNDNAPTFIFPNSTGPSGNRLSVSCHETMGSSVSRLQATDPDLGLNSTVTFSLIHT-PEAD-QLFYLDAQSGELFVNTGQLADR-CGESLIVIVSVDDQG-----PPESKQARSAPVERMLIKIEDKPTLAELIAAEARQQWRVLGETSSDGRLGKNPDTSADGIFTYGVLSTRTILSVVLGGSTVFLIGLLVVWMILLLYNRSKRRKNLR 1126          
BLAST of Protocadherin delta 1 vs. TrEMBL
Match: A0A2H1CW72 (Cadherin domain protein OS=Fasciola hepatica OX=6192 GN=D915_00642 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 3.570e-107
Identity = 314/1087 (28.89%), Postives = 479/1087 (44.07%), Query Frame = 3
Query:  204 IEIKTLFLKENSPINTTI--DIPVFNDKLFPNIKVIGDG-FNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLD--------------------------------------CK---FVFLIRIFEKQASILTYKLNIFIEDINDWTPAFK----QRQYYVE--------------------FYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHF-----------------------------SNG--GQNL--FQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSS---------------FSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLN-NAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDS-----APISERKSSSFSLT-----------ISIIDVNDNYPELKFDTENQ-----------------------------KSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSK-IQVIDHDIIGELTFFIDNKHTSDNATSVI---------------------QIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSF--------------------------DQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQI----------SDKHPHGNS--QLFTT-AKVFVKVSDQNDNSPKFIFPNSTHFV---LNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPR------------------------------SYSAKI---TLITPRLILTVILSFSTLFLMCLLIAWALIIF---RQRQRNLR 2678
            I + T+++ EN+ I + I  DI         ++  +G G   Q+F LD    ++V +  +DLE  E+C   ++CC + L                                       C+   FV      EKQ + +T +L + + D+ND  P F+     +Q   E                    F EG   +  +  LP A D DF+  NR+  Y + +                              NG    NL  F+L+Y    ++  L L + LD E +  Y L L+A DG G  G++ I V+V+D+NE+ P F+ E  S                +SV ES   G+ +  L+A D D  P N IT++L   N   +  NTF ++  +G LK++G LDYE  + Y +TIIA D       P+S R SS  +L            I +IDVNDN P ++F+ E+                              +  I+E+ P  SPVTF  ++DRD   NG VTC  +    RF L+      Y +E+   FDRE  D Y++ I CHD+G P L T   L + IED ND  P F    ++F V+ENSP  T L   N    K +   D D+   + + ++ +        +I                     QID  +G++   G +DRE       +VC +D  HV CTD+ V ++D NDN P    D + + VEEN +++ +  LTFR +D D+ N GF   F                          +Q     V  +F L  + LY+R+ LDRE  S++ F + +          SD+  + NS  + FT+ A++F+ V D NDN+P FIFPNST      L+VSCHE +G  V ++QA DPDLG N TV + +    P+ D  LF+LD  +GE+F+N+  L+++ C  + I+++S +D G      P  ++  S   E++ I + D P                               S S  I    +++ R IL+V+L  ST+FL+ LL+ W +++     +R++NLR
Sbjct:   26 ISMPTVYVLENATIGSVIIQDIRSHLGLSMNSMVKLGPGSLTQFFRLDSDSGRLVTISSLDLESPEICQAEKSCCRQELPNGAQQFPMAKLTYNDPSLPGNTPNTMTDAIRELSGRDVCRMMAFVLSESGAEKQLTPIT-RLYVTVVDLNDNAPVFRLTEENKQTSSEGKTTYNINKHVGDIPAVKLVFSEGSVGLHSRHDLPSAYDADFALANRVKRYWLEWDKDKSKFPIDSLDTGTLLETIPNILSVDDQNGLTWANLGPFRLIYLEPGRSIALELDSELDREQQDFYQLRLVAEDGGGLRGQIRIEVEVLDVNEFTPVFADEPPSKEQLIQMKPRTIYRKRYSVKESLTTGSELGQLRAYDADQSPGNWITYRLGPSNPPGDLTNTFQIHPKSGVLKLVGTLDYETTQQYRLTIIAQDGPTSDNVPLSARNSSPRNLAGTYRSATAIVEIIVIDVNDNAPVIRFEKEDNLPPNTSGGSHPTVTVVSKTVSTDGSKIPYEVWIKEDLPKGSPVTFFSVSDRDLADNGRVTCSLMNWTERFRLHEFT-GLYGLETMDGFDREHTDSYYLTIRCHDYGVPVLQTDRALLIHIEDVNDLPPVFQLPVYQFHVQENSPPGTPLKPINANFPKLVTATDPDLNSTIKYHLEPRRMGTKPNPLIRTESGTTRLESLDGSLDHTLFQIDSLTGLITTQGELDREERTRLNFQVCADDGKHVTCTDVTVLLDDVNDNRPQFDRDTYVIRVEENQLSH-KPCLTFRVTDADAGNHGFVFDFLEEPTATLKPKHKLVGRNQTGISHEWEQFEPGSVRYHFALRENTLYVRRPLDREFRSNYHFFVTVTDSQEAPRIQSDESGYRNSYPKNFTSKAEIFIDVGDVNDNAPTFIFPNSTGPSGNRLSVSCHETMGSSVSRLQATDPDLGLNSTVTFSLIHT-PEAD-QLFYLDAQSGELFVNTGQLADR-CGESLIMIVSVDDQG-----PPESKQARSAPVERMLIKIEDKPTLAELIAAEARQQWRVLGETSSDGRHGKNQDSSSDGIFTYGVLSTRTILSVVLGGSTVFLIGLLVVWMILLLYNRSKRRKNLR 1101          
BLAST of Protocadherin delta 1 vs. TrEMBL
Match: A0A5K3FP61 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 1.439e-105
Identity = 288/979 (29.42%), Postives = 476/979 (48.62%), Query Frame = 3
Query:  231 ENSPINTTIDIPVFND--KLFPNIKV-IGDG-FNQYFHLDKSRNKIVLVKQ-IDLEDSELCVHNQNCCDENL---------------DCKFVFLIRIFEKQASILT--YKLNIFIEDINDWTPAFKQ---------RQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI------HFSNGGQN---------------LFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEF-----------SRELKSSFSV---HESTVKGTVIAHLQATDNDAYPNNNITFKLES-LNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PI-----------------------SERKSSSFSLTISIIDVNDNYPELKFD-----------TENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTN-SNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATS------VIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGF-------RVSFDQSTSEDVLKY----FKLDHDKLYLRKSLDREEISSFQFVIQISD--KHPHGNSQ--LFTTAKVFVKVSDQNDNSPKFIFPNSTHF-----VLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIP-----------RSYSAKIT----------LITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSM 2714
            EN+ + + + IP   D  ++ P+ ++ +G G    +F L  ++N  +LV+  +DLE  ELC   ++CC                   +CK   ++      ++ L    ++ + I D+ND  P F           ++ ++ F+EG K VG++  LP A D+DF  +N ++TY +       FS    N                F+L++     +  L +   LD ET+  Y L L A DG GK+  +++HV V+D+NEYAP F           S  L+S+  V   +E+    T    + A D DA P N IT+K  +  + +E A+ F+++ +NG +++   LDYE+ K Y + ++A D++  P                         E K+S+ +L + + D ND+ PE+K             T  ++ T+ EN P  + + F    DRD    G   C  L     F ++   D F+ +E+++  DRE    Y + I C D+G P   +   L V++ D ND++P F    + F V ENSP  T L   S++  + +   D D    LT+ ++    +D+  S      +  +D  +G LY   A+DRE  + ++  +C ND +H  CT+I V ++D NDN P+   +   + + ENT  Y+  L+TF  +D+D  N GF       +++ ++S S+D   Y    F +  ++L+LR+ LDRE  + + F ++++D  K P G  Q  L +T +VF++VSD NDN P FIFPN++        LNVSC E +G  VG+V+A D DLG NGTV+Y +  I       LF+LD+ +GE+F+NS  LSE  C   F+++ISA+D+G      P  +K      E+L I L D P           +  SA+ +           +  + +L+V+L    +FL  L +AW +++   R +  R +  E+  Y ++
Sbjct:   39 ENATVGSVV-IPDLRDYLQVSPDRQIRLGPGSLGSFFSL--TQNYTLLVQSDLDLESGELCRAEESCCRSEAVIRDDIYLSYTHFTPNCKLKAVVLANAGGSTPLKPIGRIVVVIRDLNDHAPEFVLPKGDAHSVVQRIHIPFFEGFKGVGERFQLPTAKDQDFLPENSVVTYSLTKLGVAGFSESSPNEILASNDAPTWQLVGPFRLVHKRKEDSLALEVARELDRETQSEYELVLHAADGEGKKASLILHVHVLDVNEYAPTFVGVKPFGAAEISEGLESNTRVVHLYENASIHTPFVQVIAEDKDAPPANRITYKFANNFHLSEAASVFSIDPNNGLIRLEKPLDYERIKRYVLPVLAIDASYEPTFGEEKALTQAAQKVAQEIAESIKKEPKTSTMTLEVRVNDCNDHAPEIKLQGTVSNAGEVTRTGIEELTVVENSPPGTSLVFFSAVDRDQGDAGATQCHLLNWTEYFRIHNFSD-FFGLETSRELDREVQPEYLITIECSDNGSPRQFSQKRLRVVLLDVNDEEPSFQHPVYSFHVLENSPPMTKLIPVSDSYKNPVTAFDKDTNSTLTYHLEPSMLADSDQSNMFDYQLFDVDSETGTLYTKSALDREQKSSHKFSLCANDGVHKACTNIIVHLDDVNDNPPLFDRETHIIRLVENTQIYE-PLITFNVADVDIGNQGFTFTIEAPQLTTNESDSQDTANYLQRFFNIRDNRLFLRQPLDREAKAHYHFFVRVADLQKFPSGRLQESLSSTTEVFIEVSDINDNVPVFIFPNTSAANDGGNQLNVSCRETMGSSVGRVEAIDLDLGQNGTVVYSV--IQGPVSNELFYLDKQSGELFVNSGSLSEN-CDSVFLLVISADDMG-----PPSSKKGRPLPVERLLIRLQDQPTLAEYMSLNSQQPSSARGSDGSRGDAGYFGLPAKTMLSVVLGGCIVFLTGLFLAWVILMLISRSKRRRCERSEDAEYQAV 1004          
BLAST of Protocadherin delta 1 vs. TrEMBL
Match: A0A158QTH4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3045 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 2.323e-104
Identity = 289/983 (29.40%), Postives = 478/983 (48.63%), Query Frame = 3
Query:  219 LFLKENSPINTTIDIPVFND--KLFPNIKV-IGDG-FNQYFHLDKSRNKIVLVKQ-IDLEDSELCVHNQNCCDENL---------------DCKFVFLIRIFEKQASILT--YKLNIFIEDINDWTPAFKQ---------RQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI------HFSNGGQN---------------LFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEF-----------SRELKSSFSV---HESTVKGTVIAHLQATDNDAYPNNNITFKLES-LNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PI-----------------------SERKSSSFSLTISIIDVNDNYPELKFD-----------TENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTN-SNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATS------VIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGF-------RVSFDQSTSEDVLKY----FKLDHDKLYLRKSLDREEISSFQFVIQISD--KHPHGNSQ--LFTTAKVFVKVSDQNDNSPKFIFPNSTHF-----VLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIP-----------RSYSAKIT----------LITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSM 2714
            L + EN+ + + + IP   D  ++ P+ ++ +G G    +F L  ++N  +LV+  +DLE  ELC   ++CC                   +CK   ++      ++ L    ++ + I D+ND  P F           ++ ++ F+EG K VG++  LP A D+DF  +N ++TY +       FS    N                F+L++     +  L +   LD ET+  Y L L A DG GK+  +++HV V+D+NEYAP F           S  L+S+  V   +E+    T    + A D DA P N IT+K  +  + +E A+ F+++ +NG +++   LDYE+ K Y + ++A D++  P                         E K+S+ +L + + D ND+ PE+K             T  ++ T+ EN P  + + F    DRD    G   C  L     F ++   D F+ +E+++  DRE    Y + I C D+G P   +   L V++ D ND++P F    + F V ENSP  T L   S++  + +   D D    LT+ ++    +D+  S      +  +D  +G LY   A+DRE  + ++  +C ND +H  CT+I V ++D NDN P+   +   + + ENT  Y+  L+TF  +D+D  N GF       +++ ++S S+D   Y    F +  ++L+LR+ LDRE  + + F ++++D  K P G  Q  L +T +VF++VSD NDN P FIFPN++        LNVSC E +G  VG+V+A D DLG NGTV+Y +  I       LF+LD+ +GE+F+NS  LSE  C   F+++ISA+D+G      P  +K      E+L I L D P           +  SA+ +           +  + +L+V+L    +FL  L +AW +++   R +  R +  E+  Y ++
Sbjct:   35 LQVYENATVGSVV-IPDLRDYLQVSPDRQIRLGPGSLGSFFSL--TQNYTLLVQSDLDLESGELCRAEESCCRSEAVIRDDIYLSYTHFTPNCKLKAVVLANAGGSTPLKPIGRIVVVIRDLNDHAPEFVLPKGDAHSVVQRIHIPFFEGFKGVGERFQLPTAKDQDFLPENSVVTYSLTKLGVAGFSESSPNEILASNDAPTWQLVGPFRLVHKRKEDSLALEVARELDRETQSEYELVLHAADGEGKKASLILHVHVLDVNEYAPTFVGVKPFGAAEISEGLESNTRVVHLYENASIHTPFVQVIAEDKDAPPANRITYKFANNFHLSEAASVFSIDPNNGLIRLEKPLDYERIKRYVLPVLAIDASYEPTFGEEKALTQAAQKVAQEIAESIKKEPKTSTMTLEVRVNDCNDHAPEIKLQGTVSNAGEVTRTGIEELTVVENSPPGTSLVFFSAVDRDQGDAGATQCHLLNWTEYFRIHNFSD-FFGLETSRELDREVQPEYLITIECSDNGSPRQFSQKRLRVVLLDVNDEEPSFQHPVYSFHVLENSPPMTKLIPVSDSYKNPVTAFDKDTNSTLTYHLEPSMLADSDQSNMFDYQLFDVDSETGTLYTKSALDREQKSSHKFSLCANDGVHKACTNIIVHLDDVNDNPPLFDRETHIIRLVENTQIYE-PLITFNVADVDIGNQGFTFTIEAPQLTTNESDSQDTANYLQRFFNIRDNRLFLRQPLDREAKAHYHFFVRVADLQKFPSGRLQESLSSTTEVFIEVSDINDNVPVFIFPNTSAANDGGNQLNVSCRETMGSSVGRVEAIDLDLGQNGTVVYSV--IQGPVSNELFYLDKQSGELFVNSGSLSEN-CDSVFLLVISADDMG-----PPSSKKGRPLPVERLLIRLQDQPTLAEYMSLNSQQPSSARGSDGSRGDAGYFGLPAKTMLSVVLGGCIVFLTGLFLAWVILMLISRSKRRRCERSEDAEYQAV 1004          
BLAST of Protocadherin delta 1 vs. TrEMBL
Match: A0A5J4NZP8 (Protocadherin delta 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0003810 PE=4 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 6.168e-103
Identity = 307/1044 (29.41%), Postives = 455/1044 (43.58%), Query Frame = 3
Query:  294 IKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCC-----------------------------------------DENLDCK---FVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQR----------------QYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFS-----------------------------NGGQ----NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSS----------------FSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLN-NAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPI-----------------SERKSSSFSLTISIIDVNDNYPELKFDTENQKST------------------IRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSN-NGLSKIQVIDHDIIGELTFFIDN-----------KHTSDNATSVI-----QIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSF-------DQSTSEDVLK--------------------YFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLF--------------TTAKVFVKVSDQNDNSPKFIFPNSTHFV---LNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIP----------------------------RSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIF-----RQRQRN-LRLKSDENKCY 2705
            +K+      Q+F LD    +++ V+ +DLE  E+C   ++CC                                         +E+  C+   FV      E Q + ++ KL + + D+ND  P FK                  + +V F EG   +  +Q L +A D DFS  NR+  Y + +                              NG        F+L+Y    +   L L   LD E + +Y + L+A DG    G + I V VIDINE+AP F  E +S                 +++ ES   GT +  L+ATD D  P+  IT++L   N   E + TF +N   G L ++G LDYE+ K Y +T+IA D   +                    +S++  + I++ DVNDN P ++F+ +N+  T                  IRE+    SPVT+    D D  +NG V+C  L   +RF L       Y IE+   FDRE  D Y++ I C DHG P L  S  L + IED ND  P F    ++F V E+S   T L   N N  + +   D D+   + + ++            +  S  ++ ++     QID  S  L   G +DRE        VC +D  H  CTD+ V ++D NDN PI   D + L VEEN ++  R L+ FR +D DS N GF   F        + TS  V K                    +F L  + LYLR+ LDRE  SS+ F I++ D H     + F              + A++FV V D NDN+P  IFPNST  +   L VSCHE +G  VG++QA D DLG N +V++ +    PD D  LF+LD ++GE+F+N+  L E+ C    I+++SA+D G+ + K     K  +   E+L I L D P                            R  S   + ++ R IL+V+L  ST+FL+ LLI W +++      RQ+Q N L+L   + K +
Sbjct:   28 VKLSPGSLTQFFRLDAESGQLINVRSVDLESLEMCEAEKSCCRVEANGLSASIAVESQLASRGSLSAGILNDHSALQNERRMTEESKPCRLMAFVLASSTVESQLAPIS-KLYVTVIDLNDNPPVFKVENTNLRYELSETMSSPPRIHVAFLEGSGGLNSRQDLVLAYDADFSVINRVKRYWLEWGATDKESLTPTASGSISSIRSSNPLNVDDQNGLTWSILGPFRLIYLEAGRTLALELDMELDRERQRNYHMRLIAEDGGNLRGELHILVDVIDINEFAPIFVDEFRSDGLQLPLHRQSTMYQKHYTLKESLPLGTEVGRLRATDEDDSPDKVITYRLGPGNPQNEVSKTFHLNPTTGSLVLVGLLDYERTKRYRLTVIAQDGPSLIYGSNLQAVNDQFQQTGKTCRSTTGIVEITVTDVNDNAPMIRFEKDNKIDTGVDPGTSHTRTSAHYEVWIREDIVKGSPVTYFSTLDPDFAENGRVSCNLLNWTDRFRLREFT-GLYGIETVTEFDRETTDVYYLTIKCQDHGVPPLQNSQILIIHIEDVNDLPPSFSLPVYQFHVLEDSTPGTPLLPVNANYPAAVTATDPDLNSTIVYRLEPLDPNRAINMEVRLGSPGSSRIMDHLLFQIDPRSATLTTQGELDRETRALLAFHVCADDGKHSACTDVTVILDDVNDNRPIFDRDTYVLRVEENQLS-SRPLVVFRVTDADSNNQGFTFEFVNDGKTPSKITSSAVQKTNSSEFQQYKTQFEPGSVQHHFALRENTLYLRRPLDRELRSSYHFFIRVVDVHDFSPIREFVKSGWAVNHPQNLTSQAEIFVDVGDVNDNAPVLIFPNSTGPLGNRLTVSCHETMGSAVGRLQATDMDLGQNASVLFTLIHT-PDVD-QLFYLDTNSGELFVNTGQLEER-CGQTAIMVVSADDQGSIESK-----KSRTAPVERLLIKLEDKPTIAEVIAAEARYKLRNLGDSAVGSAVQNRDTSTIYSSLSARAILSVVLGGSTVFLIGLLIVWMILLVYNRSKRQKQLNQLQLTQTKRKPH 1060          
BLAST of Protocadherin delta 1 vs. Ensembl Cavefish
Match: ENSAMXT00000003988.2 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:103037566])

HSP 1 Score: 202.601 bits (514), Expect = 5.307e-52
Identity = 206/740 (27.84%), Postives = 332/740 (44.86%), Query Frame = 3
Query:  303 IGDGFN--QYFHLDKSRNKIVLVK-----------QIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE--GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            +GDGF   Q    D       LV            +ID E  +L    +   D     K+  L+R  + Q S     +NI + D+ND TP F +  Y  +  E   P S+    L   A D D S  N  ITY +   +G    +  L +  +   N+     LD ET+ +YIL + A DG G+   V ++  V+D+N+  P F+  + S+ S+ ES   G+ I  + A+D D  PN  +++ + S    +    F +    G L+    LD E Q  Y++ +   D A P + R +S+  +++ ++DVND  P     T  + + I+EN  + + V  ++ TD DS  N  V      S    F    +D   ++      DREE+  Y + I+  D G P LS+++ +T+++ D ND  P F  N +   ++EN     TL+    G   +QV     D    G++ F I     + N  S  +ID  +GV+ VA  +DRE    Y L V   D   S  V    + + + D ND  P+     + + V+EN  +  + +L     D D  + G ++S+  S   +   +      +L L ++LDRE    +  +I   D    G+  L  +A V V V D ND  P F   +S+ F  +++   P G  V  V A D D+G NG + Y +S          F ++  TG+I  +S  L ++  R N+ +++ A D G
Sbjct: 1734 VGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKR--LDRERRSKYSLLVRADDGQQS-SDMTVNITVSDVNDHTPKFSRSVYSFDIPEDMAPGSIVAAIL---ASDSD-SGVNGEITYSLEEDDGD---YTFLLNPVTGVFNVT--QPLDYETQQYYILTVRAVDGGGQASSVRVYFNVLDVNDNRPAFNTSVYST-SISESLTPGSSILTVAASDADDGPNAQLSYSIAS---GDPQAHFGITTA-GVLQTRKLLDRETQSFYNLVVTVNDMALPPATRFTSTAQVSVILLDVNDCPPVF---TSQKMAYIQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYGVKFSIDNIDGSVRLVGE--LDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEEN-----TLS----GTDVLQVFASDADEGTNGQIRFSI----AAGNGNSDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLPKNILQVVGRDDDYGSNG-QLSYSLSGGNEDAAFSLTSSGQLKLIRTLDRETQDRYSLIITAIDS---GSPSLSGSATVLVLVDDVNDMVPLF---SSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLS-----GGDGQFSINPATGQIITSS--LLDRESRGNYQLLVVASDGG 2424          

HSP 2 Score: 189.504 bits (480), Expect = 5.186e-48
Identity = 198/706 (28.05%), Postives = 316/706 (44.76%), Query Frame = 3
Query:  399 VHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKN-RMITYQIHFSNGGQNLFQLLY----DGTSQAPNLLLLNALDCETKHHYILDLLAND-GAGKE-GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK---FDTENQKSTIRENQPISSPVTFLKITDRDSNQ-NGEVTCRFLKSENRFFL---NGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            V+  +  D       V  + +   Q +  T ++ I + DIND +P F      V F E   S G++ +L  A D D         TY+I   N  Q  F+L       G     +L+    LD E    Y L +   D G  K  G + ++V + DIN+  P F  + +   SV+E    G+ +  + ATD D   N++I + L+          F ++   G + +   LDYE +K YS+TI A D+   S   S     TI ++DVNDN P +K   F T ++ +++ EN  I + V  L ++D DS+  NG ++   L    +         +     I+   V DRE I  Y + +   D+G P S S+  +L + + D ND  P F    ++  + E+ P  + +     G+S     D      L + +     S N+     I + SG++  A  +DRE  +   L +   D      +  T + V++ D ND  P      + +++ E++      LL+   +D D   N   R +FD  T   V + F+LD    KL     LDRE++ S+   ++ +D    G   L + AKV V + D NDN P F +P    +  N+  +EP G  V  V A DPDLG NGTV Y I+      D   FH++ +TG+  I +  L ++  +  + + +SA D G
Sbjct:   78 VYTSSVIDRESLASSVINVVVLSSQPTYPT-EVRIVVLDINDNSPVFPDTSIVVSFKEDATS-GRQVILDTATDADIGSNGVDHTTYRIVQGN-EQRKFRLDITVNPSGEGAFLHLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLD-QYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDE------GTPFQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPS--LSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIFQEAVYKVDISEDVPKGSYI----KGVSATDG-DSGQNANLRYSL----VSGNSLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQSSYHVSLVEHS-PAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYVRATDA---GAPPLHSIAKVNVTLKDINDNRPVF-YP--VQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITA----GDTFKFHINSNTGK--ITTLVLLDREEKTAYQLQVSATDGG 749          

HSP 3 Score: 140.969 bits (354), Expect = 4.401e-33
Identity = 189/680 (27.79%), Postives = 292/680 (42.94%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAP----EFSRELKSSFSVHESTVKGTVIAHLQATDND-AYPNNNITFKLESLNNAETANTFAMNLHNGDL-KVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHG-DPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKY-FKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL--NVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            ++N+ I+DIND  PAF   QY    YE   ++G   L   A D+D    N  I Y   F + G   FQ+      +A  +++  ALD E K  Y L + A D       GR    +K++D+N+  P     +        SV E+   GTV+A L  +D+D +  N NI+  +   N           + N  L KV   LD E+   Y++T+   D+  P+S  +SS  SL I + D+ND+ P   F     K  I E+ P  S +  +  TD DS QN  +  R+ L S N      + +    + S  + DRE      +NI   D G  P +S +  L V I D NDQ P F  +++  S+ E+SP  + L +       +   D D+    T  F  +  T      + ++D  +G L     +DRE    Y L V   D+    +H +   + V ++D NDN P+ Y   +   ++EN       + T   SD D   N   R +    T+ D  K+    +  K+     LDREE +++Q  +  +D    G  +  T A V + V D  DN P F       FV+  NV+ +     V+G + A   DL  N T +     I       LF ++  TG I   S    E+   +   ++    D+  + + N
Sbjct:  223 QVNVTIQDINDNPPAFDLDQYQTSVYED-AAIGSSVLQITATDQD-EGANSDIRY---FLDEG-TPFQI----DPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVS--RSSFASLVIFVNDINDHPP--IFQEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANL--RYSLVSGNSLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYT-KLIVNITDVNDQVPTFTQSSYHVSLVEHSPAGSELLS-------LSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHSIA-KVNVTLKDINDNRPVFYPVQYFANIKENEPP-GSYVTTVSASDPDLGRNGTVRYTI---TAGDTFKFHINSNTGKITTLVLLDREEKTAYQLQVSATDG---GELRSHTHAIVTITVVDTQDNPPIFT-QKEYSFVMFENVAPNT----VIGTISASTVDLNTNITYL-----IASGDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARGGDVTGEALVN 860          

HSP 4 Score: 138.272 bits (347), Expect = 2.907e-32
Identity = 175/633 (27.65%), Postives = 283/633 (44.71%), Query Frame = 3
Query:  432 DCKFVFLIRIFEKQAS--ILTYK--LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKK-NRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSV-HESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVT-CRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLST--SVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSK-IQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKL-DHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDL 2282
            D   V+L+ I  K     +L+ K  L I + + N  TP F Q Q      E   +VG       A DKD  K+ N +ITY I  S+G  +   ++ + T     L L   LD E K  + L + A DG    K   V ++++V D+N+  P F  E    F V  E+   GT++  L ATD D+  N+ + + ++S +    ++ F ++ + G +   G LDYE +++Y +T+ A++  P  ER S + ++ I +   N+  P  +F ++     + E  P  + V  +  +DRD   +G V    F +S  + F  G+  K  QI      DRE+ ++  + ++  + G    +    V + + I D ND  P F    +   V E          S  GL   +   D D +   + F  +  T+D   +   I+  +G + VA  +DRE T  Y L +   DS     T    + V +ED NDN P L T   +  V EN       ++T    D D        S+   ++   + YF L    +L   + +DRE+IS F   + I D    G  Q+ +T  V VK++DQNDN  +   P S    ++   +   G  +G V+  DPD+
Sbjct: 3033 DINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSES-LTVGTAIRTLSARDKDKDKQMNGLITYNI--SSGNDDGLFVVNEKTGV---LSLAKPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMF--EPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAYVIQSSD----SDLFIIDPNTGVITTQGFLDYEAKQVYHLTVKAFN-VPDEERCSFA-NVNIQLKGANEYVP--RFVSKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYYLIFGRSRRKGF--GINKKTGQIYVTGPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDANDP-PVFTQELYDVQVSEGL--------SPGGLVTFVSAEDSDSVPSWSRFTYSV-TTDREKNAFTINPQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGPTLVTTTGE--VMENQ-RAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVTYFTLTSSGELSTSREIDREQISDFYLSVVIKDS---GVPQMSSTGTVHVKINDQNDNPSQ---PRSVEIFVHYFGNMFPGGSLGIVKPQDPDI 3628          

HSP 5 Score: 136.732 bits (343), Expect = 8.516e-32
Identity = 187/743 (25.17%), Postives = 303/743 (40.78%), Query Frame = 3
Query:  327 FHLDKSRNKIVLVKQIDLE---DSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQY-----YVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLL---NALDCETKHHYILDLLANDGAGKEGRVLIHVKVI---DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-----LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS------IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            F +D     +V+ + +D E   +  L +H  +    +L  +    I++                 D+ND  P  K R +     +    E  + +G    L    D D S  N  I+  I   N  Q  F++    TS  PNL L+   + LD E    Y L +  +D      R      VI   DIN++ P F +E      + E   KG+ I  + ATD D+  N N+ + L S N   +   FA++ ++G +     LD E   +  + I A D     + K S   L ++I DVND  P   F   +   ++ E+ P  S +  L  TD D   NG V   F        +  F L+ +  K   + +    DRE++  Y + +   D G P L +   + V ++D ND  P F    +  ++KEN P   + TT++ S+  L +   + + I    TF F  N +T    T V+              +DRE    Y+L+V   D        H + T   + V D  DN PI     +   + EN +  +  + T   S +D +TN  + ++     S D    F ++    ++  +  +DREE + +Q  +        G       A V + V D NDN+P F+     H   +VS  E    GH + + +AFD D G NG ++Y + +        LFH+    G I +  P    +    ++ + + A D G
Sbjct:  283 FQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLL----------------DVNDNDPVVKFRYFPTTSKFASVDENAQ-IGTVVALLTVSDSDSSSANGNISVSILGGNE-QGHFEVH---TSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIF-QEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGN---SLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQG--LQPKISYTKLIVNITDVNDQVP--TFTQSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGK---LSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTFKFHINSNTGKITTLVL--------------LDREEKTAYQLQVSATDGGELRSHTHAIVT---ITVVDTQDNPPIFTQKEYSFVMFEN-VAPNTVIGTISASTVDLNTNITYLIA-----SGDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARGGDVTGE------ALVNITVKDLNDNAPHFL-----HSEEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQ----NPKGLFHIHEKHGLITLTGPL---EVTTSSYQVEVVASDRG 952          

HSP 6 Score: 136.346 bits (342), Expect = 9.918e-32
Identity = 180/681 (26.43%), Postives = 305/681 (44.79%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAH-LQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYE---KQK---IYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFY-QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFH-----TTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILY-TDLFQLTVEENTINYDRALLTFRPSDLDS-TNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            T  L + + D+ND  P F Q  Y V   E  + V  +     A DKD S  N  I Y I   N   ++F +  DG      L +   LD E +  Y L L+A D A +     ++V +I  D+N+  P F+      F   E   +G+++A  + A D D  PN+ + +  E+         F +N   G+L    ++D E   +Q+   +++ T+I+ D       K  +  + + I D+NDN P  KF  +  +++I E+ P  + +  +  +D D N+NG+V  R+  SE        +D    Q+      D E    Y + II  D G   LS+S  L+V + DEND  P F  ++    + EN          T T+S++G +           ++T+ I     ++N      I   +G +++   +D E  + Y+L +   D+          + + V D NDN P+    D+F+ ++ EN +    +++T    D D+  N     S  Q T      +F +D     ++    +DRE  + F+  ++ +D+      + F    + V V+DQND+ P FI  N+     N+     IG ++  V AFDPD G NG V YE+ K     D + F +DR++G+I + S  +  +     + + +SA D G  +
Sbjct:  959 TLILTVSVYDVNDNAPVFDQLSYEVVILES-EPVNSRFFKVEATDKD-SGLNGEIVYDITGGNT-NDIFGIFPDG-----QLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFN-STNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSFET-----PQPNFELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQA-KVQVYIQDINDNAP--KFTKDIYQASISESAPNMTQLLRVSASDVDENKNGQV--RYHISEGNEETQFSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGSN----------ADITYSI----MANNNHGTFSISPSTGSIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFK-SIPEN-LPLSTSIMTITAHDTDADINGELEYSIVQQTPRG--NHFSIDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFISQNALVAEANIV----IGSILTTVMAFDPDEGANGEVEYELVK----GDSDTFIMDRYSGDIRVASQLVPSKLI---YSLTVSATDHGTDR 1591          

HSP 7 Score: 135.961 bits (341), Expect = 1.489e-31
Identity = 187/751 (24.90%), Postives = 318/751 (42.34%), Query Frame = 3
Query:  195 VMSIEIKTLFLKENSPINTTI-DIPVFNDKLFPNIKVIGDG-FNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTY----KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR-FFLNGLLDKFY-----QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNS-NNGLSKIQVIDHD-----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEEN-TINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            ++ I+ K+    EN  INT +  +   + +  P    I  G  +  FH+D+   ++ L   +D E+ E               K+V  I    +  S   Y    K+ I + D+ND  P F++  ++ E  E      Q+ L+  A+D+D S  N  + Y I   N  +N F +          +     LD E    Y L + A D     K   V + + V+D+N+ AP FS+    S +V E+   G  +  +  TD D   N    + +     ++T+  F++N   GD+ +   L+ E    Y   + A+DS       + S  +TI + D+NDN P  +F   +      E   + S VT +  TD D   NG++   F++S++  F +N    + +     + +++   +   I+R+   +   D G   L +  T+ V I D ND  P F          E+S + T +T S   G + I+V  HD     +  E+ + I    +  N++S  ++DK +G + VA ++  ++   Y L +   D  + V +D   + + V +EN +TP          V E+ T+      L+ R  D D    G       S ++D L         L L K LD E+    +  I  +D      +   T   V ++V+D NDN P F       +   V  + P G +V K+ A D D  +N  + Y    ++   D +LF +D +TG I
Sbjct: 2549 IIKIKDKSFTYPENQAINTIVTKVSGTSTRAGPLSYYIASGNLDNAFHVDQLSGELSLKAPLDYENIE---------------KYVLWIE--ARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILENLSP--QRVLVVSALDQD-SGPNGQLDYTIIDGN-KENSFSI----NRATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKIF--SATVPENAPVGYTVTRVTTTDEDTGANAVSRYTI-----SDTSLPFSINPSTGDITISRPLNREDTDHYIAKVSAHDSG-----WTVSTDVTIFVTDINDNAP--RFSKPSYYLEYPELTDVGSLVTKVSATDLDEGFNGKI-FYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLMSETTVIVNIVDSNDNPPTF----------ESSSYFTPVTKSVKVGTNLIKVTAHDKKDFGVNSEIEYVI----SGGNSSSKFRLDKQTGWVTVASSLTSDINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATDGGWIAKTSYVT---VNIQVTDVNDNPPMF---EPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAY----VIQSSDSDLFIIDPNTGVI 3235          

HSP 8 Score: 129.413 bits (324), Expect = 1.387e-29
Identity = 166/666 (24.92%), Postives = 290/666 (43.54%), Query Frame = 3
Query:  513 DINDWTPAFKQRQYYVEFYEGPKSVGQKQLL-PIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT--DRDSNQNGEVTCRFLKS--ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSL--------DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFD-PDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            DIND  P F    Y       P S     L+  + +  + S  N     Q+H+S  G+N  +   D    A  +     L   ++  + + +       K     + V+ +   ++     +    SF+  E+    T++  +  T   A P   +++ + S N     N F ++  +G+L +   LDYE  + Y + I A D +  P S  +     + I+++DVNDN P   F+ E   + I EN    SP   L ++  D+DS  NG++    +    EN F +N       +I + +  DRE+  +Y + +   D G P  ST+V++ + + D ND  P+F S  F  +V EN+P   T+T       ++   D D          +++T  + +    I+  +G + ++  ++RE T+ Y  +V  +DS   V TD+ + V D NDN P      + L   E T +    +     +DLD    G    F +S SE+    F+++    ++++++ L        +   I+   F++  SD+   G   L +   V V + D NDN P F    S+ +   V+    +G  + KV A D  D G N  + Y IS        + F LD+ TG + + S   S+      +++ I+A+D GN
Sbjct: 2441 DINDNPPRFHHHPYVTHI---PASTAPGSLVFAVTVTDEDSGSNS----QLHYSLSGRNSEKFKIDPVRGA--ITASEKLTGSSEVTFTVRVKDGGSNPKTDSTTVTVRFVTGGDFP--IIKIKDKSFTYPENQAINTIVTKVSGTSTRAGP---LSYYIASGN---LDNAFHVDQLSGELSLKAPLDYENIEKYVLWIEARDQSFPPYSAYEK----IEITVLDVNDNNP--VFEKEPFHAEILENL---SPQRVLVVSALDQDSGPNGQLDYTIIDGNKENSFSINRATG---EIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRF-SKIFSATVPENAPVGYTVT-------RVTTTDEDTGANAV----SRYTISDTSLPFSINPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELT-DVGSLVTKVSATDLDEGFNGKIFYFIRSQSEN----FRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDR---GIKPLMSETTVIVNIVDSNDNPPTF---ESSSYFTPVTKSVKVGTNLIKVTAHDKKDFGVNSEIEYVISG---GNSSSKFRLDKQTGWVTVASSLTSD--INKVYLLEITAKDKGN 3049          

HSP 9 Score: 125.176 bits (313), Expect = 2.886e-28
Identity = 164/647 (25.35%), Postives = 280/647 (43.28%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDN---KHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD------------IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            + I + D  D  P F Q++Y    +E   +V    ++   I       N  ITY I  ++G Q   + L+   S   ++   + +D E +  Y L ++A  G    G  L+++ V D+N+ AP F    +   S  E+   G  I   +A D D   N  I + L+          F ++  +G + + G L+      Y + ++A D      +++S+  LT+S+ DVNDN P   FD  + +  I E++P++S    ++ TD+DS  NGE+                 D    I+++   DRE  DRY + ++  D     LS SV +T++++D ND  P F S N+ F   E  P             +  ++   +  E   F  N   +++ +      +++  +G L     +DRE  +  R R     +  V+ +D            + V ++D NDN P    D++Q ++ E+  N  + LL    SD+D    G  R    +   E     F +D    ++ L   LD E  SS+   I   D    G+  L ++  + V V D+NDNSP F   + +  +L    +  IG +V  + A D D G+N  + Y    I+ + +   F +   TG IF+
Sbjct:  759 VTITVVDTQDNPPIFTQKEYSFVMFE---NVAPNTVIG-TISASTVDLNTNITYLI--ASGDQ---RGLFAVNSATGHITATSLIDREEQAFYQLKVVAR-GGDVTGEALVNITVKDLNDNAPHFLHS-EEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQ----NPKGLFHIHEKHGLITLTGPLEVTTSS-YQVEVVASDRG--VPQRTSTLILTVSVYDVNDNAP--VFDQLSYEVVILESEPVNSRFFKVEATDKDSGLNGEIVYDITGGNTNDIFGIFPDGQLYIKAD--LDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQP-------------RGSLVARRVFAEDKDFGPNSEVRYSFETPQPNFELNAITGELSSTLQMDRE--SLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQ-LLRVSASDVDENKNGQVRYHISEGNEE---TQFSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDS---GSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILE---NMRIGELVVSITATDSDSGSNADITY---SIMANNNHGTFSISPSTGSIFL 1355          

HSP 10 Score: 121.324 bits (303), Expect = 4.734e-27
Identity = 181/740 (24.46%), Postives = 305/740 (41.22%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFF----LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDV--EDENDNTPILYTD--LFQLTVEENTINYDRALLTFR---PSDLD-STNTGFRVSFD--------QSTSEDVLKYFKLDHDKLYLRKSLDREEISS-FQFVIQISDKH-PHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + F LD    K+    ++D ED                  ++  +R  +  A  L    K+N+ ++DIND  P F   QY+    E  +  G       A D D  + N  + Y I     G      +   T +   L+LL   D E K  Y L + A DG         ++ + V+D  +  P F+++ + SF + E+    TVI  + A+  D   N NIT+ + S    +    FA+N   G +     +D E+Q  Y + ++A       E       + I++ D+NDN P     +E   S + EN      +   K  D+D   NG +     ++    F     +GL+     +E            Y V ++  D G P  ++++ LTV + D ND  P F   ++   + E+ P        N+   K++  D D  + GE+ + I   +T+D    +  I    G LY+   +DRE+ + Y L +   D ++  +   + V +  +D NDN P+  +   +F+   E+      R  L  R     D D   N+  R SF+         + + ++    ++D      R+SL R+  ++ F F +  SD+  P     L   AKV V + D NDN+PKF       +  ++S   P    + +V A D D   NG V Y IS+     +   F +D  +G++ +      E    ++  I+  AED G
Sbjct:  610 ELFRLDTITGKLSTTTELDREDM---------------GSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVFYPVQYFANIKEN-EPPGSYVTTVSASDPDLGR-NGTVRYTI---TAGDTFKFHINSNTGKITTLVLL---DREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQK-EYSFVMFENVAPNTVIGTISASTVDL--NTNITYLIAS---GDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARGGDVTGEAL-----VNITVKDLNDNAPHF-LHSEEHVSAV-ENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQNPKGLFHIHEKHGLITLTGPLEVTT-------SSYQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILESEPV-------NSRFFKVEATDKDSGLNGEIVYDITGGNTND----IFGIFP-DGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQ-----PRGSLVARRVFAEDKDFGPNSEVRYSFETPQPNFELNAITGELSSTLQMD------RESLMRQRGAAVFTFTVISSDQGLPK---PLKDQAKVQVYIQDINDNAPKF---TKDIYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISE---GNEETQFSIDSSSGQVTLVGKLDYEATSSYSLKII--AEDSG 1272          

HSP 11 Score: 120.939 bits (302), Expect = 6.048e-27
Identity = 172/708 (24.29%), Postives = 299/708 (42.23%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAF-KQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD--SAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISS-PVTFLKITDRDSN--QNGEVTCRFLKS-ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT--TLTNSNNG-LSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH----VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISD--KHPHGNSQL----FTTAKVF--VKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL-NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI 2534
            T ++++ + D+ND  P F  Q+  Y++      +V        A D D S  N  + Y +    GG    +   D    +  + L+  LD E   +Y L ++A D         + + + V+D+N+  P FS+ +     + E+T+ GT +  + A+D D   N  I F + + N     + F ++   G + V   LD E +  YS+ + A D  S+P  +R +    + I ++DVND  P  +        T+R  + ++  P   L++  RD +   NG+++       E+  F    L    Q++  +  DRE  DRY + I   D G PSLS S T+ VL++D ND  P F S++F  S+ E++P  +   L N+++G + +  VI + + G    F               I+  +G +  +  +DRE    Y+L V  +D            + V V D NDN P  +   +   +  +T             +   +N+    S     SE     FK+D  +  +  S      S   F +++ D   +P  +S      F T   F  +K+ D++     F +P           ++ I  +V KV       G        +S  +   +L N FH+D+ +GE+ + +P   E   +  +++ I A D        P Y  Y     EK+ IT+LD+
Sbjct: 2015 TAQVSVILLDVNDCPPVFTSQKMAYIQENTAVDTV---VFTVQATDAD-SGPNSYVEYSL----GGSYGVKFSIDNIDGS--VRLVGELDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYD-IEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNGN---SDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRAT----VNIVLLDVNDCAPVFEL----SPYTVRVQENLADLPKNILQVVGRDDDYGSNGQLSYSLSGGNEDAAFS---LTSSGQLKLIRTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSGGDGQF--------------SINPATGQIITSSLLDRESRGNYQLLVVASDGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPASTAPGSLVFAVTVTDEDSGSNSQLHYSLSGRNSEK----FKIDPVRGAITASEKLTGSSEVTFTVRVKDGGSNPKTDSTTVTVRFVTGGDFPIIKIKDKS-----FTYPE----------NQAINTIVTKVSGTSTRAG-------PLSYYIASGNLDNAFHVDQLSGELSLKAPLDYENIEK--YVLWIEARDQ-----SFPPYSAY-----EKIEITVLDV 2645          

HSP 12 Score: 119.013 bits (297), Expect = 1.908e-26
Identity = 163/660 (24.70%), Postives = 289/660 (43.79%), Query Frame = 3
Query:  585 VGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR-----VLIHVKVIDINEYAPEFSRE--LKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRE-NQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFL----NGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATS-VIQIDKYSGVLYVAGAIDRE------LTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSP--FLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYF 2492
            +G+  +   A D D S  N  ITY I  +N     F +    +    ++ L+  LD ET+  Y L++ A D  G+  R     ++IHV+  D N+  P F+     KS   + E+    T I  + A D DA  N  + + +  +      N F+++  +G +   G++D E   ++ +T+ A D A P   RK +  ++T+ + D ND+ P       +Q + + E N  I S +T +   D D   NGEV    +K ++  F+    +G +    Q+  +K+        Y + +   DHG    ++   LT++++  +   P F    +   +KE  P  T      N +S           ++ +FI +  +   A   +  I +++GV+  A  +DRE      L + Y +    +   H    ++ + ++D NDN PI  TD+  +TV+EN  +  R ++    +D D            S ++D    F++D +   L   K LDRE  S +  +++  D       Q  +   V + VSD ND++PKF   + + +  ++      G +V  + A D D G NG + Y + +   D     F L+  TG   +  P  + ++Q+    +I+ + A D G Q       R YF
Sbjct: 1311 IGELVVSITATDSD-SGSNADITYSI-MANNNHGTFSI----SPSTGSIFLVRKLDYETQSLYKLNITAKDN-GRPPRSSSIPLVIHVR--DFNDNPPVFTPGDIFKS---IPENLPLSTSIMTITAHDTDADINGELEYSI--VQQTPRGNHFSIDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFI----SQNALVAEANIVIGSILTTVMAFDPDEGANGEVEYELVKGDSDTFIMDRYSGDIRVASQLVPSKLI-------YSLTVSATDHGTDRKTSRTELTIILQGTDG--PVFSQPKYITILKEGQPPGT------NVISLDASSPRGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQP-HTQRAEVEITLQDINDNPPIFPTDILDVTVQENVGDGFR-IMQLTATDADEGPNALVTYTIISGADD---SFRIDPESGDLIATKRLDRERRSKYSLLVRADD------GQQSSDMTVNITVSDVNDHTPKF---SRSVYSFDIPEDMAPGSIVAAILASDSDSGVNGEITYSLEE---DDGDYTFLLNPVTGVFNVTQPLDYETQQY----YILTVRAVDGGGQASS---VRVYF 1913          

HSP 13 Score: 114.39 bits (285), Expect = 5.646e-25
Identity = 137/507 (27.02%), Postives = 217/507 (42.80%), Query Frame = 3
Query:  420 DENLDCKFVFLIRIFEKQASILTYKLN--IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILD---LLANDGAG---------KEG-------RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI------HVVCTDIYVDVEDENDNTP 1853
            D  +  ++  L+   ++    L+  +N  I ++D+ND  P F    Y   F E             A DKDF   +                 ++ Y   +  PN  L NA+  E      +D   L+   GA           +G       +  + V + DIN+ AP+F++++  + S+ ES    T +  + A+D D   N  + + + S  N ET   F+++  +G + ++G+LDYE    YS+ IIA DS   S   SSS  L++S++D NDN     F   +    I EN  I   V  +  TD DS  N ++T   + + N   F ++      + +   +  D E    Y +NI   D+G P  S+S+ L + + D ND  P F   +   S+ EN P  T++             D DI GEL + I  +    N  S   ID  SG+++  G IDRE +N + L V   D             +I V V D+ND+ P
Sbjct: 1039 DREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNS-----------------EVRYSFETPQPNFEL-NAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQA-SISESAPNMTQLLRVSASDVDENKNGQVRYHI-SEGNEETQ--FSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDSG--SVPLSSSCLLSVSVLDENDN--SPSFSKSSMSVDILENMRIGELVVSITATDSDSGSNADITYSIMANNNHGTFSISPSTGSIFLV---RKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPENLPLSTSIMTIT-----AHDTDADINGELEYSIVQQTPRGNHFS---IDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVP 1508          

HSP 14 Score: 109.768 bits (273), Expect = 1.351e-23
Identity = 168/725 (23.17%), Postives = 291/725 (40.14%), Query Frame = 3
Query:  324 YFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI-AIDKDFSKKNRM-ITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFD--QSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVG-KVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCR------FNFIIMISAEDL 2450
            +F + ++   +     +D E + + V N +  D+ L  K  +              KL + I D+ND  P F Q  Y+V   E   S    +LL + A D D      +  T+        Q LF+L     +    L     LD E    Y+L + A D        +  V V   DIN+  P F   ++   ++ E+   G+ +  + A+D D   N  + + + + +  +    F +N + G +  +  LD E++  Y + + A D   +  R  +   +TI+++D  DN P   F  +     + EN   ++ +  +  +  D N N       + S ++  L  +      I +  + DREE   Y + ++    GD +    V +TV  +D ND  P FL +    S  EN        N+ + + + +  D D   E T  +       N   +  I +  G++ + G ++   T+ Y++ V  +D      T    + V V D NDN P+     +++ + E+     R       +D DS   G  + +D     + D+   F     +LY++  LDRE    +  ++   D+       L  +  V + + D NDN P F   NST++V      +P G +V  +V A D D G N  V Y      P+     F L+  TGE+        E   R      F F ++ S + L
Sbjct:  503 WFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYT-------------KLIVNITDVNDQVPTFTQSSYHVSLVE--HSPAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRL----DTITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVF-YPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTFK----FHINSNTGKITTLVLLDREEKTAYQLQVSATDGGEL--RSHTHAIVTITVVDTQDNPP--IFTQKEYSFVMFENVAPNTVIGTISASTVDLNTN---ITYLIASGDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARG-GDVTGEALVNITV--KDLNDNAPHFLHSEEHVSAVEN-------WNTGHHIFQAKAFDQD---EGTNGMIVYSLQQNPKGLFHIHEKHGLITLTGPLEV-TTSSYQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILESEPVNSR-FFKVEATDKDSGLNG-EIVYDITGGNTNDIFGIFP--DGQLYIKADLDREVQDRYNLLLVARDR---AVEPLSASVNVTIILDDVNDNRPLF---NSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSFETPQPN-----FELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGL 1167          

HSP 15 Score: 109.383 bits (272), Expect = 1.800e-23
Identity = 138/580 (23.79%), Postives = 254/580 (43.79%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIY--------SITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNG-------LLDK---FYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQ 2405
            L+ E   HYI  + A+D +G      + + V DIN+ AP FS   K S+ +   E T  G+++  + ATD D   N  I + + S      +  F +N   G++ V  +L Y+    +        S  + A D    P+     S  ++ ++I+D NDN P   F++ +  + + ++  + +    +K+T  D    G      + SE  + ++G        LDK   +  + S+   D  ++  Y + I   D G+P LS   TL + + +EN   P+F  +    +V E+    T        +  +   D D   ++   I    +S N   +  +++ +GVL +A  +D E   ++ LR+   D   +  T    + + V D NDN P+   D +   V+EN +     ++    +D DS++        QS+  D+   F +D +   +  +  LD E    +   ++  +     + +  + A V +++   N+  P+F+   S  +   VS   P G +VG+V A D DLG++G V Y    I        F +++ TG+I++  P   E+
Sbjct: 2816 LNREDTDHYIAKVSAHD-SGWTVSTDVTIFVTDINDNAPRFS---KPSYYLEYPELTDVGSLVTKVSATDLDEGFNGKIFYFIRS-----QSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLM----SETTVIVNIVDSNDNPP--TFESSSYFTPVTKSVKVGT--NLIKVTAHDKKDFG------VNSEIEYVISGGNSSSKFRLDKQTGWVTVASSLTSDINKV--YLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGT-------AIRTLSARDKDKDKQMNGLITYNISSGNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQEN-VPSGTIVVKLNATDKDSSSNSVMAYVIQSSDSDL---FIIDPNTGVITTQGFLDYEAKQVYHLTVKAFNVP---DEERCSFANVNIQLKGANEYVPRFV---SKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYY---LIFGRSRRKGFGINKKTGQIYVTGPLDREK 3350          

HSP 16 Score: 98.9821 bits (245), Expect = 3.075e-20
Identity = 134/553 (24.23%), Postives = 227/553 (41.05%), Query Frame = 3
Query:  870 SRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNG--EVTCRFLKS--ENRFFLNGLLD-----KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRV-CCNDSIHVVC--TDIYVDVEDENDNTPILYTDLFQLT-----VEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK---SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQ 2459
            S +++  F V E    GT +  +Q            T++      +ET   FA+N   G +     +D E      I ++   S P    +     + I ++D+NDN P   F   +   + +E+      V     TD D   NG    T R ++   + +F L+  ++      F  + +    DRE    Y + I   D G+P     + + V I+D ND  P F  + ++ SV E++   +++        +I   D D     ++ +F+D         +  QID  +G + +  A+D E+  EY L +   ++ +  +   T+  + + D NDN P++    F  T     V+EN  I    ALLT   SD  S N    VS      +   +        L L K    LDRE ISS+   + +SD     +   F +  +F  V+D ND+ P F       + +++S   P G  +  V A D D G N  + Y    ++    L  F +  ++G   + S  L ++      ++ ISA+D G Q
Sbjct:   30 STQVRQEFQVLEEQPVGTYVGTVQT-------RPGFTYRF-----SETHRLFAINATTGVVYTSSVIDRESLASSVINVVVLSSQPTYPTE-----VRIVVLDINDNSP--VFPDTSIVVSFKEDATSGRQVILDTATDADIGSNGVDHTTYRIVQGNEQRKFRLDITVNPSGEGAFLHLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVL-------QITATDQDEGANSDIRYFLDEG-------TPFQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIF--VNDINDHPPIF---QEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRY---SLVSGNSLGWFAISENSG--LVTSAALLDRETASVVVLNISAKDQGLQ 539          
BLAST of Protocadherin delta 1 vs. Ensembl Cavefish
Match: ENSAMXT00000031516.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:103037566])

HSP 1 Score: 202.216 bits (513), Expect = 6.133e-52
Identity = 206/740 (27.84%), Postives = 332/740 (44.86%), Query Frame = 3
Query:  303 IGDGFN--QYFHLDKSRNKIVLVK-----------QIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE--GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            +GDGF   Q    D       LV            +ID E  +L    +   D     K+  L+R  + Q S     +NI + D+ND TP F +  Y  +  E   P S+    L   A D D S  N  ITY +   +G    +  L +  +   N+     LD ET+ +YIL + A DG G+   V ++  V+D+N+  P F+  + S+ S+ ES   G+ I  + A+D D  PN  +++ + S    +    F +    G L+    LD E Q  Y++ +   D A P + R +S+  +++ ++DVND  P     T  + + I+EN  + + V  ++ TD DS  N  V      S    F    +D   ++      DREE+  Y + I+  D G P LS+++ +T+++ D ND  P F  N +   ++EN     TL+    G   +QV     D    G++ F I     + N  S  +ID  +GV+ VA  +DRE    Y L V   D   S  V    + + + D ND  P+     + + V+EN  +  + +L     D D  + G ++S+  S   +   +      +L L ++LDRE    +  +I   D    G+  L  +A V V V D ND  P F   +S+ F  +++   P G  V  V A D D+G NG + Y +S          F ++  TG+I  +S  L ++  R N+ +++ A D G
Sbjct: 1734 VGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKR--LDRERRSKYSLLVRADDGQQS-SDMTVNITVSDVNDHTPKFSRSVYSFDIPEDMAPGSIVAAIL---ASDSD-SGVNGEITYSLEEDDGD---YTFLLNPVTGVFNVT--QPLDYETQQYYILTVRAVDGGGQASSVRVYFNVLDVNDNRPAFNTSVYST-SISESLTPGSSILTVAASDADDGPNAQLSYSIAS---GDPQAHFGITTA-GVLQTRKLLDRETQSFYNLVVTVNDMALPPATRFTSTAQVSVILLDVNDCPPVF---TSQKMAYIQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYGVKFSIDNIDGSVRLVGE--LDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEEN-----TLS----GTDVLQVFASDADEGTNGQIRFSI----AAGNGNSDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLPKNILQVVGRDDDYGSNG-QLSYSLSGGNEDAAFSLTSSGQLKLIRTLDRETQDRYSLIITAIDS---GSPSLSGSATVLVLVDDVNDMVPLF---SSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLS-----GGDGQFSINPATGQIITSS--LLDRESRGNYQLLVVASDGG 2424          

HSP 2 Score: 189.504 bits (480), Expect = 5.938e-48
Identity = 198/706 (28.05%), Postives = 316/706 (44.76%), Query Frame = 3
Query:  399 VHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKN-RMITYQIHFSNGGQNLFQLLY----DGTSQAPNLLLLNALDCETKHHYILDLLAND-GAGKE-GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK---FDTENQKSTIRENQPISSPVTFLKITDRDSNQ-NGEVTCRFLKSENRFFL---NGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            V+  +  D       V  + +   Q +  T ++ I + DIND +P F      V F E   S G++ +L  A D D         TY+I   N  Q  F+L       G     +L+    LD E    Y L +   D G  K  G + ++V + DIN+  P F  + +   SV+E    G+ +  + ATD D   N++I + L+          F ++   G + +   LDYE +K YS+TI A D+   S   S     TI ++DVNDN P +K   F T ++ +++ EN  I + V  L ++D DS+  NG ++   L    +         +     I+   V DRE I  Y + +   D+G P S S+  +L + + D ND  P F    ++  + E+ P  + +     G+S     D      L + +     S N+     I + SG++  A  +DRE  +   L +   D      +  T + V++ D ND  P      + +++ E++      LL+   +D D   N   R +FD  T   V + F+LD    KL     LDRE++ S+   ++ +D    G   L + AKV V + D NDN P F +P    +  N+  +EP G  V  V A DPDLG NGTV Y I+      D   FH++ +TG+  I +  L ++  +  + + +SA D G
Sbjct:   78 VYTSSVIDRESLASSVINVVVLSSQPTYPT-EVRIVVLDINDNSPVFPDTSIVVSFKEDATS-GRQVILDTATDADIGSNGVDHTTYRIVQGN-EQRKFRLDITVNPSGEGAFLHLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLD-QYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDE------GTPFQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPS--LSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIFQEAVYKVDISEDVPKGSYI----KGVSATDG-DSGQNANLRYSL----VSGNSLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQSSYHVSLVEHS-PAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYVRATDA---GAPPLHSIAKVNVTLKDINDNRPVF-YP--VQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITA----GDTFKFHINSNTGK--ITTLVLLDREEKTAYQLQVSATDGG 749          

HSP 3 Score: 140.584 bits (353), Expect = 5.668e-33
Identity = 189/680 (27.79%), Postives = 292/680 (42.94%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAP----EFSRELKSSFSVHESTVKGTVIAHLQATDND-AYPNNNITFKLESLNNAETANTFAMNLHNGDL-KVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHG-DPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKY-FKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL--NVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            ++N+ I+DIND  PAF   QY    YE   ++G   L   A D+D    N  I Y   F + G   FQ+      +A  +++  ALD E K  Y L + A D       GR    +K++D+N+  P     +        SV E+   GTV+A L  +D+D +  N NI+  +   N           + N  L KV   LD E+   Y++T+   D+  P+S  +SS  SL I + D+ND+ P   F     K  I E+ P  S +  +  TD DS QN  +  R+ L S N      + +    + S  + DRE      +NI   D G  P +S +  L V I D NDQ P F  +++  S+ E+SP  + L +       +   D D+    T  F  +  T      + ++D  +G L     +DRE    Y L V   D+    +H +   + V ++D NDN P+ Y   +   ++EN       + T   SD D   N   R +    T+ D  K+    +  K+     LDREE +++Q  +  +D    G  +  T A V + V D  DN P F       FV+  NV+ +     V+G + A   DL  N T +     I       LF ++  TG I   S    E+   +   ++    D+  + + N
Sbjct:  223 QVNVTIQDINDNPPAFDLDQYQTSVYED-AAIGSSVLQITATDQD-EGANSDIRY---FLDEG-TPFQI----DPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVS--RSSFASLVIFVNDINDHPP--IFQEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANL--RYSLVSGNSLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYT-KLIVNITDVNDQVPTFTQSSYHVSLVEHSPAGSELLS-------LSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHSIA-KVNVTLKDINDNRPVFYPVQYFANIKENEPP-GSYVTTVSASDPDLGRNGTVRYTI---TAGDTFKFHINSNTGKITTLVLLDREEKTAYQLQVSATDG---GELRSHTHAIVTITVVDTQDNPPIFT-QKEYSFVMFENVAPNT----VIGTISASTVDLNTNITYL-----IASGDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARGGDVTGEALVN 860          

HSP 4 Score: 137.887 bits (346), Expect = 3.440e-32
Identity = 175/633 (27.65%), Postives = 283/633 (44.71%), Query Frame = 3
Query:  432 DCKFVFLIRIFEKQAS--ILTYK--LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKK-NRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSV-HESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVT-CRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLST--SVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSK-IQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKL-DHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDL 2282
            D   V+L+ I  K     +L+ K  L I + + N  TP F Q Q      E   +VG       A DKD  K+ N +ITY I  S+G  +   ++ + T     L L   LD E K  + L + A DG    K   V ++++V D+N+  P F  E    F V  E+   GT++  L ATD D+  N+ + + ++S +    ++ F ++ + G +   G LDYE +++Y +T+ A++  P  ER S + ++ I +   N+  P  +F ++     + E  P  + V  +  +DRD   +G V    F +S  + F  G+  K  QI      DRE+ ++  + ++  + G    +    V + + I D ND  P F    +   V E          S  GL   +   D D +   + F  +  T+D   +   I+  +G + VA  +DRE T  Y L +   DS     T    + V +ED NDN P L T   +  V EN       ++T    D D        S+   ++   + YF L    +L   + +DRE+IS F   + I D    G  Q+ +T  V VK++DQNDN  +   P S    ++   +   G  +G V+  DPD+
Sbjct: 3033 DINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSES-LTVGTAIRTLSARDKDKDKQMNGLITYNI--SSGNDDGLFVVNEKTGV---LSLAKPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMF--EPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAYVIQSSD----SDLFIIDPNTGVITTQGFLDYEAKQVYHLTVKAFN-VPDEERCSFA-NVNIQLKGANEYVP--RFVSKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYYLIFGRSRRKGF--GINKKTGQIYVTGPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDANDP-PVFTQELYDVQVSEGL--------SPGGLVTFVSAEDSDSVPSWSRFTYSV-TTDREKNAFTINPQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGPTLVTTTGE--VMENQ-RAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVTYFTLTSSGELSTSREIDREQISDFYLSVVIKDS---GVPQMSSTGTVHVKINDQNDNPSQ---PRSVEIFVHYFGNMFPGGSLGIVKPQDPDI 3628          

HSP 5 Score: 136.732 bits (343), Expect = 9.418e-32
Identity = 187/743 (25.17%), Postives = 303/743 (40.78%), Query Frame = 3
Query:  327 FHLDKSRNKIVLVKQIDLE---DSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQY-----YVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLL---NALDCETKHHYILDLLANDGAGKEGRVLIHVKVI---DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-----LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS------IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            F +D     +V+ + +D E   +  L +H  +    +L  +    I++                 D+ND  P  K R +     +    E  + +G    L    D D S  N  I+  I   N  Q  F++    TS  PNL L+   + LD E    Y L +  +D      R      VI   DIN++ P F +E      + E   KG+ I  + ATD D+  N N+ + L S N   +   FA++ ++G +     LD E   +  + I A D     + K S   L ++I DVND  P   F   +   ++ E+ P  S +  L  TD D   NG V   F        +  F L+ +  K   + +    DRE++  Y + +   D G P L +   + V ++D ND  P F    +  ++KEN P   + TT++ S+  L +   + + I    TF F  N +T    T V+              +DRE    Y+L+V   D        H + T   + V D  DN PI     +   + EN +  +  + T   S +D +TN  + ++     S D    F ++    ++  +  +DREE + +Q  +        G       A V + V D NDN+P F+     H   +VS  E    GH + + +AFD D G NG ++Y + +        LFH+    G I +  P    +    ++ + + A D G
Sbjct:  283 FQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLL----------------DVNDNDPVVKFRYFPTTSKFASVDENAQ-IGTVVALLTVSDSDSSSANGNISVSILGGNE-QGHFEVH---TSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIF-QEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGN---SLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQG--LQPKISYTKLIVNITDVNDQVP--TFTQSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGK---LSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTFKFHINSNTGKITTLVL--------------LDREEKTAYQLQVSATDGGELRSHTHAIVT---ITVVDTQDNPPIFTQKEYSFVMFEN-VAPNTVIGTISASTVDLNTNITYLIA-----SGDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARGGDVTGE------ALVNITVKDLNDNAPHFL-----HSEEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQ----NPKGLFHIHEKHGLITLTGPL---EVTTSSYQVEVVASDRG 952          

HSP 6 Score: 136.346 bits (342), Expect = 1.266e-31
Identity = 180/681 (26.43%), Postives = 305/681 (44.79%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAH-LQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYE---KQK---IYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFY-QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFH-----TTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILY-TDLFQLTVEENTINYDRALLTFRPSDLDS-TNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            T  L + + D+ND  P F Q  Y V   E  + V  +     A DKD S  N  I Y I   N   ++F +  DG      L +   LD E +  Y L L+A D A +     ++V +I  D+N+  P F+      F   E   +G+++A  + A D D  PN+ + +  E+         F +N   G+L    ++D E   +Q+   +++ T+I+ D       K  +  + + I D+NDN P  KF  +  +++I E+ P  + +  +  +D D N+NG+V  R+  SE        +D    Q+      D E    Y + II  D G   LS+S  L+V + DEND  P F  ++    + EN          T T+S++G +           ++T+ I     ++N      I   +G +++   +D E  + Y+L +   D+          + + V D NDN P+    D+F+ ++ EN +    +++T    D D+  N     S  Q T      +F +D     ++    +DRE  + F+  ++ +D+      + F    + V V+DQND+ P FI  N+     N+     IG ++  V AFDPD G NG V YE+ K     D + F +DR++G+I + S  +  +     + + +SA D G  +
Sbjct:  959 TLILTVSVYDVNDNAPVFDQLSYEVVILES-EPVNSRFFKVEATDKD-SGLNGEIVYDITGGNT-NDIFGIFPDG-----QLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFN-STNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSFET-----PQPNFELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQA-KVQVYIQDINDNAP--KFTKDIYQASISESAPNMTQLLRVSASDVDENKNGQV--RYHISEGNEETQFSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGSN----------ADITYSI----MANNNHGTFSISPSTGSIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFK-SIPEN-LPLSTSIMTITAHDTDADINGELEYSIVQQTPRG--NHFSIDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFISQNALVAEANIV----IGSILTTVMAFDPDEGANGEVEYELVK----GDSDTFIMDRYSGDIRVASQLVPSKLI---YSLTVSATDHGTDR 1591          

HSP 7 Score: 135.576 bits (340), Expect = 1.950e-31
Identity = 187/751 (24.90%), Postives = 318/751 (42.34%), Query Frame = 3
Query:  195 VMSIEIKTLFLKENSPINTTI-DIPVFNDKLFPNIKVIGDG-FNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTY----KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR-FFLNGLLDKFY-----QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNS-NNGLSKIQVIDHD-----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEEN-TINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            ++ I+ K+    EN  INT +  +   + +  P    I  G  +  FH+D+   ++ L   +D E+ E               K+V  I    +  S   Y    K+ I + D+ND  P F++  ++ E  E      Q+ L+  A+D+D S  N  + Y I   N  +N F +          +     LD E    Y L + A D     K   V + + V+D+N+ AP FS+    S +V E+   G  +  +  TD D   N    + +     ++T+  F++N   GD+ +   L+ E    Y   + A+DS       + S  +TI + D+NDN P  +F   +      E   + S VT +  TD D   NG++   F++S++  F +N    + +     + +++   +   I+R+   +   D G   L +  T+ V I D ND  P F          E+S + T +T S   G + I+V  HD     +  E+ + I    +  N++S  ++DK +G + VA ++  ++   Y L +   D  + V +D   + + V +EN +TP          V E+ T+      L+ R  D D    G       S ++D L         L L K LD E+    +  I  +D      +   T   V ++V+D NDN P F       +   V  + P G +V K+ A D D  +N  + Y    ++   D +LF +D +TG I
Sbjct: 2549 IIKIKDKSFTYPENQAINTIVTKVSGTSTRAGPLSYYIASGNLDNAFHVDQLSGELSLKAPLDYENIE---------------KYVLWIE--ARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILENLSP--QRVLVVSALDQD-SGPNGQLDYTIIDGN-KENSFSI----NRATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKIF--SATVPENAPVGYTVTRVTTTDEDTGANAVSRYTI-----SDTSLPFSINPSTGDITISRPLNREDTDHYIAKVSAHDSG-----WTVSTDVTIFVTDINDNAP--RFSKPSYYLEYPELTDVGSLVTKVSATDLDEGFNGKI-FYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLMSETTVIVNIVDSNDNPPTF----------ESSSYFTPVTKSVKVGTNLIKVTAHDKKDFGVNSEIEYVI----SGGNSSSKFRLDKQTGWVTVASSLTSDINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATDGGWIAKTSYVT---VNIQVTDVNDNPPMF---EPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAY----VIQSSDSDLFIIDPNTGVI 3235          

HSP 8 Score: 129.028 bits (323), Expect = 1.697e-29
Identity = 166/666 (24.92%), Postives = 290/666 (43.54%), Query Frame = 3
Query:  513 DINDWTPAFKQRQYYVEFYEGPKSVGQKQLL-PIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT--DRDSNQNGEVTCRFLKS--ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSL--------DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFD-PDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            DIND  P F    Y       P S     L+  + +  + S  N     Q+H+S  G+N  +   D    A  +     L   ++  + + +       K     + V+ +   ++     +    SF+  E+    T++  +  T   A P   +++ + S N     N F ++  +G+L +   LDYE  + Y + I A D +  P S  +     + I+++DVNDN P   F+ E   + I EN    SP   L ++  D+DS  NG++    +    EN F +N       +I + +  DRE+  +Y + +   D G P  ST+V++ + + D ND  P+F S  F  +V EN+P   T+T       ++   D D          +++T  + +    I+  +G + ++  ++RE T+ Y  +V  +DS   V TD+ + V D NDN P      + L   E T +    +     +DLD    G    F +S SE+    F+++    ++++++ L        +   I+   F++  SD+   G   L +   V V + D NDN P F    S+ +   V+    +G  + KV A D  D G N  + Y IS        + F LD+ TG + + S   S+      +++ I+A+D GN
Sbjct: 2441 DINDNPPRFHHHPYVTHI---PASTAPGSLVFAVTVTDEDSGSNS----QLHYSLSGRNSEKFKIDPVRGA--ITASEKLTGSSEVTFTVRVKDGGSNPKTDSTTVTVRFVTGGDFP--IIKIKDKSFTYPENQAINTIVTKVSGTSTRAGP---LSYYIASGN---LDNAFHVDQLSGELSLKAPLDYENIEKYVLWIEARDQSFPPYSAYEK----IEITVLDVNDNNP--VFEKEPFHAEILENL---SPQRVLVVSALDQDSGPNGQLDYTIIDGNKENSFSINRATG---EIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRF-SKIFSATVPENAPVGYTVT-------RVTTTDEDTGANAV----SRYTISDTSLPFSINPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELT-DVGSLVTKVSATDLDEGFNGKIFYFIRSQSEN----FRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDR---GIKPLMSETTVIVNIVDSNDNPPTF---ESSSYFTPVTKSVKVGTNLIKVTAHDKKDFGVNSEIEYVISG---GNSSSKFRLDKQTGWVTVASSLTSD--INKVYLLEITAKDKGN 3049          

HSP 9 Score: 124.79 bits (312), Expect = 3.876e-28
Identity = 164/647 (25.35%), Postives = 280/647 (43.28%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDN---KHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD------------IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFI 2381
            + I + D  D  P F Q++Y    +E   +V    ++   I       N  ITY I  ++G Q   + L+   S   ++   + +D E +  Y L ++A  G    G  L+++ V D+N+ AP F    +   S  E+   G  I   +A D D   N  I + L+          F ++  +G + + G L+      Y + ++A D      +++S+  LT+S+ DVNDN P   FD  + +  I E++P++S    ++ TD+DS  NGE+                 D    I+++   DRE  DRY + ++  D     LS SV +T++++D ND  P F S N+ F   E  P             +  ++   +  E   F  N   +++ +      +++  +G L     +DRE  +  R R     +  V+ +D            + V ++D NDN P    D++Q ++ E+  N  + LL    SD+D    G  R    +   E     F +D    ++ L   LD E  SS+   I   D    G+  L ++  + V V D+NDNSP F   + +  +L    +  IG +V  + A D D G+N  + Y    I+ + +   F +   TG IF+
Sbjct:  759 VTITVVDTQDNPPIFTQKEYSFVMFE---NVAPNTVIG-TISASTVDLNTNITYLI--ASGDQ---RGLFAVNSATGHITATSLIDREEQAFYQLKVVAR-GGDVTGEALVNITVKDLNDNAPHFLHS-EEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQ----NPKGLFHIHEKHGLITLTGPLEVTTSS-YQVEVVASDRG--VPQRTSTLILTVSVYDVNDNAP--VFDQLSYEVVILESEPVNSRFFKVEATDKDSGLNGEIVYDITGGNTNDIFGIFPDGQLYIKAD--LDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQP-------------RGSLVARRVFAEDKDFGPNSEVRYSFETPQPNFELNAITGELSSTLQMDRE--SLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQ-LLRVSASDVDENKNGQVRYHISEGNEE---TQFSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDS---GSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILE---NMRIGELVVSITATDSDSGSNADITY---SIMANNNHGTFSISPSTGSIFL 1355          

HSP 10 Score: 120.939 bits (302), Expect = 5.696e-27
Identity = 181/740 (24.46%), Postives = 305/740 (41.22%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFF----LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDV--EDENDNTPILYTD--LFQLTVEENTINYDRALLTFR---PSDLD-STNTGFRVSFD--------QSTSEDVLKYFKLDHDKLYLRKSLDREEISS-FQFVIQISDKH-PHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + F LD    K+    ++D ED                  ++  +R  +  A  L    K+N+ ++DIND  P F   QY+    E  +  G       A D D  + N  + Y I     G      +   T +   L+LL   D E K  Y L + A DG         ++ + V+D  +  P F+++ + SF + E+    TVI  + A+  D   N NIT+ + S    +    FA+N   G +     +D E+Q  Y + ++A       E       + I++ D+NDN P     +E   S + EN      +   K  D+D   NG +     ++    F     +GL+     +E            Y V ++  D G P  ++++ LTV + D ND  P F   ++   + E+ P        N+   K++  D D  + GE+ + I   +T+D    +  I    G LY+   +DRE+ + Y L +   D ++  +   + V +  +D NDN P+  +   +F+   E+      R  L  R     D D   N+  R SF+         + + ++    ++D      R+SL R+  ++ F F +  SD+  P     L   AKV V + D NDN+PKF       +  ++S   P    + +V A D D   NG V Y IS+     +   F +D  +G++ +      E    ++  I+  AED G
Sbjct:  610 ELFRLDTITGKLSTTTELDREDM---------------GSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVFYPVQYFANIKEN-EPPGSYVTTVSASDPDLGR-NGTVRYTI---TAGDTFKFHINSNTGKITTLVLL---DREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQK-EYSFVMFENVAPNTVIGTISASTVDL--NTNITYLIAS---GDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARGGDVTGEAL-----VNITVKDLNDNAPHF-LHSEEHVSAV-ENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQNPKGLFHIHEKHGLITLTGPLEVTT-------SSYQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILESEPV-------NSRFFKVEATDKDSGLNGEIVYDITGGNTND----IFGIFP-DGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQ-----PRGSLVARRVFAEDKDFGPNSEVRYSFETPQPNFELNAITGELSSTLQMD------RESLMRQRGAAVFTFTVISSDQGLPK---PLKDQAKVQVYIQDINDNAPKF---TKDIYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISE---GNEETQFSIDSSSGQVTLVGKLDYEATSSYSLKII--AEDSG 1272          

HSP 11 Score: 120.553 bits (301), Expect = 7.592e-27
Identity = 172/708 (24.29%), Postives = 299/708 (42.23%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAF-KQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD--SAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISS-PVTFLKITDRDSN--QNGEVTCRFLKS-ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT--TLTNSNNG-LSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH----VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISD--KHPHGNSQL----FTTAKVF--VKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL-NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI 2534
            T ++++ + D+ND  P F  Q+  Y++      +V        A D D S  N  + Y +    GG    +   D    +  + L+  LD E   +Y L ++A D         + + + V+D+N+  P FS+ +     + E+T+ GT +  + A+D D   N  I F + + N     + F ++   G + V   LD E +  YS+ + A D  S+P  +R +    + I ++DVND  P  +        T+R  + ++  P   L++  RD +   NG+++       E+  F    L    Q++  +  DRE  DRY + I   D G PSLS S T+ VL++D ND  P F S++F  S+ E++P  +   L N+++G + +  VI + + G    F               I+  +G +  +  +DRE    Y+L V  +D            + V V D NDN P  +   +   +  +T             +   +N+    S     SE     FK+D  +  +  S      S   F +++ D   +P  +S      F T   F  +K+ D++     F +P           ++ I  +V KV       G        +S  +   +L N FH+D+ +GE+ + +P   E   +  +++ I A D        P Y  Y     EK+ IT+LD+
Sbjct: 2015 TAQVSVILLDVNDCPPVFTSQKMAYIQENTAVDTV---VFTVQATDAD-SGPNSYVEYSL----GGSYGVKFSIDNIDGS--VRLVGELDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYD-IEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNGN---SDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRAT----VNIVLLDVNDCAPVFEL----SPYTVRVQENLADLPKNILQVVGRDDDYGSNGQLSYSLSGGNEDAAFS---LTSSGQLKLIRTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSGGDGQF--------------SINPATGQIITSSLLDRESRGNYQLLVVASDGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPASTAPGSLVFAVTVTDEDSGSNSQLHYSLSGRNSEK----FKIDPVRGAITASEKLTGSSEVTFTVRVKDGGSNPKTDSTTVTVRFVTGGDFPIIKIKDKS-----FTYPE----------NQAINTIVTKVSGTSTRAG-------PLSYYIASGNLDNAFHVDQLSGELSLKAPLDYENIEK--YVLWIEARDQ-----SFPPYSAY-----EKIEITVLDV 2645          

HSP 12 Score: 119.013 bits (297), Expect = 2.336e-26
Identity = 163/660 (24.70%), Postives = 289/660 (43.79%), Query Frame = 3
Query:  585 VGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR-----VLIHVKVIDINEYAPEFSRE--LKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRE-NQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFL----NGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATS-VIQIDKYSGVLYVAGAIDRE------LTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSP--FLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYF 2492
            +G+  +   A D D S  N  ITY I  +N     F +    +    ++ L+  LD ET+  Y L++ A D  G+  R     ++IHV+  D N+  P F+     KS   + E+    T I  + A D DA  N  + + +  +      N F+++  +G +   G++D E   ++ +T+ A D A P   RK +  ++T+ + D ND+ P       +Q + + E N  I S +T +   D D   NGEV    +K ++  F+    +G +    Q+  +K+        Y + +   DHG    ++   LT++++  +   P F    +   +KE  P  T      N +S           ++ +FI +  +   A   +  I +++GV+  A  +DRE      L + Y +    +   H    ++ + ++D NDN PI  TD+  +TV+EN  +  R ++    +D D            S ++D    F++D +   L   K LDRE  S +  +++  D       Q  +   V + VSD ND++PKF   + + +  ++      G +V  + A D D G NG + Y + +   D     F L+  TG   +  P  + ++Q+    +I+ + A D G Q       R YF
Sbjct: 1311 IGELVVSITATDSD-SGSNADITYSI-MANNNHGTFSI----SPSTGSIFLVRKLDYETQSLYKLNITAKDN-GRPPRSSSIPLVIHVR--DFNDNPPVFTPGDIFKS---IPENLPLSTSIMTITAHDTDADINGELEYSI--VQQTPRGNHFSIDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFI----SQNALVAEANIVIGSILTTVMAFDPDEGANGEVEYELVKGDSDTFIMDRYSGDIRVASQLVPSKLI-------YSLTVSATDHGTDRKTSRTELTIILQGTDG--PVFSQPKYITILKEGQPPGT------NVISLDASSPRGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQP-HTQRAEVEITLQDINDNPPIFPTDILDVTVQENVGDGFR-IMQLTATDADEGPNALVTYTIISGADD---SFRIDPESGDLIATKRLDRERRSKYSLLVRADD------GQQSSDMTVNITVSDVNDHTPKF---SRSVYSFDIPEDMAPGSIVAAILASDSDSGVNGEITYSLEE---DDGDYTFLLNPVTGVFNVTQPLDYETQQY----YILTVRAVDGGGQASS---VRVYF 1913          

HSP 13 Score: 114.39 bits (285), Expect = 6.350e-25
Identity = 137/507 (27.02%), Postives = 217/507 (42.80%), Query Frame = 3
Query:  420 DENLDCKFVFLIRIFEKQASILTYKLN--IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILD---LLANDGAG---------KEG-------RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSI------HVVCTDIYVDVEDENDNTP 1853
            D  +  ++  L+   ++    L+  +N  I ++D+ND  P F    Y   F E             A DKDF   +                 ++ Y   +  PN  L NA+  E      +D   L+   GA           +G       +  + V + DIN+ AP+F++++  + S+ ES    T +  + A+D D   N  + + + S  N ET   F+++  +G + ++G+LDYE    YS+ IIA DS   S   SSS  L++S++D NDN     F   +    I EN  I   V  +  TD DS  N ++T   + + N   F ++      + +   +  D E    Y +NI   D+G P  S+S+ L + + D ND  P F   +   S+ EN P  T++             D DI GEL + I  +    N  S   ID  SG+++  G IDRE +N + L V   D             +I V V D+ND+ P
Sbjct: 1039 DREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNS-----------------EVRYSFETPQPNFEL-NAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQA-SISESAPNMTQLLRVSASDVDENKNGQVRYHI-SEGNEETQ--FSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDSG--SVPLSSSCLLSVSVLDENDN--SPSFSKSSMSVDILENMRIGELVVSITATDSDSGSNADITYSIMANNNHGTFSISPSTGSIFLV---RKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPENLPLSTSIMTIT-----AHDTDADINGELEYSIVQQTPRGNHFS---IDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVP 1508          

HSP 14 Score: 109.768 bits (273), Expect = 1.545e-23
Identity = 168/725 (23.17%), Postives = 291/725 (40.14%), Query Frame = 3
Query:  324 YFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI-AIDKDFSKKNRM-ITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFD--QSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVG-KVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCR------FNFIIMISAEDL 2450
            +F + ++   +     +D E + + V N +  D+ L  K  +              KL + I D+ND  P F Q  Y+V   E   S    +LL + A D D      +  T+        Q LF+L     +    L     LD E    Y+L + A D        +  V V   DIN+  P F   ++   ++ E+   G+ +  + A+D D   N  + + + + +  +    F +N + G +  +  LD E++  Y + + A D   +  R  +   +TI+++D  DN P   F  +     + EN   ++ +  +  +  D N N       + S ++  L  +      I +  + DREE   Y + ++    GD +    V +TV  +D ND  P FL +    S  EN        N+ + + + +  D D   E T  +       N   +  I +  G++ + G ++   T+ Y++ V  +D      T    + V V D NDN P+     +++ + E+     R       +D DS   G  + +D     + D+   F     +LY++  LDRE    +  ++   D+       L  +  V + + D NDN P F   NST++V      +P G +V  +V A D D G N  V Y      P+     F L+  TGE+        E   R      F F ++ S + L
Sbjct:  503 WFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYT-------------KLIVNITDVNDQVPTFTQSSYHVSLVE--HSPAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRL----DTITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVF-YPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTFK----FHINSNTGKITTLVLLDREEKTAYQLQVSATDGGEL--RSHTHAIVTITVVDTQDNPP--IFTQKEYSFVMFENVAPNTVIGTISASTVDLNTN---ITYLIASGDQRGLFAVNSATGHITATSLIDREEQAFYQLKVVARG-GDVTGEALVNITV--KDLNDNAPHFLHSEEHVSAVEN-------WNTGHHIFQAKAFDQD---EGTNGMIVYSLQQNPKGLFHIHEKHGLITLTGPLEV-TTSSYQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILESEPVNSR-FFKVEATDKDSGLNG-EIVYDITGGNTNDIFGIFP--DGQLYIKADLDREVQDRYNLLLVARDR---AVEPLSASVNVTIILDDVNDNRPLF---NSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSFETPQPN-----FELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGL 1167          

HSP 15 Score: 108.997 bits (271), Expect = 2.148e-23
Identity = 138/589 (23.43%), Postives = 258/589 (43.80%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIY--------SITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNG-------LLDK---FYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIM 2432
            L+ E   HYI  + A+D +G      + + V DIN+ AP FS   K S+ +   E T  G+++  + ATD D   N  I + + S      +  F +N   G++ V  +L Y+    +        S  + A D    P+     S  ++ ++I+D NDN P   F++ +  + + ++  + +    +K+T  D    G      + SE  + ++G        LDK   +  + S+   D  ++  Y + I   D G+P LS   TL + + +EN   P+F  +    +V E+    T        +  +   D D   ++   I    +S N   +  +++ +GVL +A  +D E   ++ LR+   D   +  T    + + V D NDN P+   D +   V+EN +     ++    +D DS++        QS+  D+   F +D +   +  +  LD E    +   ++  +     + +  + A V +++   N+  P+F+   S  +   VS   P G +VG+V A D DLG++G V Y    I        F +++ TG+I++  P   E+  + +  ++
Sbjct: 2816 LNREDTDHYIAKVSAHD-SGWTVSTDVTIFVTDINDNAPRFS---KPSYYLEYPELTDVGSLVTKVSATDLDEGFNGKIFYFIRS-----QSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLM----SETTVIVNIVDSNDNPP--TFESSSYFTPVTKSVKVGT--NLIKVTAHDKKDFG------VNSEIEYVISGGNSSSKFRLDKQTGWVTVASSLTSDINKV--YLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGT-------AIRTLSARDKDKDKQMNGLITYNISSGNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQEN-VPSGTIVVKLNATDKDSSSNSVMAYVIQSSDSDL---FIIDPNTGVITTQGFLDYEAKQVYHLTVKAFNVP---DEERCSFANVNIQLKGANEYVPRFV---SKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYY---LIFGRSRRKGFGINKKTGQIYVTGPLDREKEEKISLKVL 3359          

HSP 16 Score: 98.5969 bits (244), Expect = 3.859e-20
Identity = 134/553 (24.23%), Postives = 227/553 (41.05%), Query Frame = 3
Query:  870 SRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNG--EVTCRFLKS--ENRFFLNGLLD-----KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRV-CCNDSIHVVC--TDIYVDVEDENDNTPILYTDLFQLT-----VEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK---SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQ 2459
            S +++  F V E    GT +  +Q            T++      +ET   FA+N   G +     +D E      I ++   S P    +     + I ++D+NDN P   F   +   + +E+      V     TD D   NG    T R ++   + +F L+  ++      F  + +    DRE    Y + I   D G+P     + + V I+D ND  P F  + ++ SV E++   +++        +I   D D     ++ +F+D         +  QID  +G + +  A+D E+  EY L +   ++ +  +   T+  + + D NDN P++    F  T     V+EN  I    ALLT   SD  S N    VS      +   +        L L K    LDRE ISS+   + +SD     +   F +  +F  V+D ND+ P F       + +++S   P G  +  V A D D G N  + Y    ++    L  F +  ++G   + S  L ++      ++ ISA+D G Q
Sbjct:   30 STQVRQEFQVLEEQPVGTYVGTVQT-------RPGFTYRF-----SETHRLFAINATTGVVYTSSVIDRESLASSVINVVVLSSQPTYPTE-----VRIVVLDINDNSP--VFPDTSIVVSFKEDATSGRQVILDTATDADIGSNGVDHTTYRIVQGNEQRKFRLDITVNPSGEGAFLHLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVL-------QITATDQDEGANSDIRYFLDEG-------TPFQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIF--VNDINDHPPIF---QEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRY---SLVSGNSLGWFAISENSG--LVTSAALLDRETASVVVLNISAKDQGLQ 539          
BLAST of Protocadherin delta 1 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 198.364 bits (503), Expect = 2.555e-51
Identity = 192/699 (27.47%), Postives = 305/699 (43.63%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A D D    +    Y+    NG Q+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + ES+  GT +  LQATD D   N  I +   +  +  T   FA+N   G + V   LD E+   + ++++A D +  S R +    +TI++ DVNDN P +         N    + E  P+++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    + TT+T ++    +   I + +    +FF               +D+ +GVL  +   DRE    +   V   D+          + V + D+NDN+P    + FQ  V EN   Y    ++T   +D      G       S   D  + F LD     ++   S DRE+ SS+ F ++  D    G+    + AKV + V D NDN P  I+P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDSECSFEIEVVILPNDYFRL-IKIKIVVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPDMGPNS---VYKYELVNG-QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF-KESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARAT----VTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD-----AGENAVVSLSILNDN-ENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDS---GHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKL-VPLSAIPGSVVAEVFAVDGDTGMNAELKY---TIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 116.316 bits (290), Expect = 9.447e-26
Identity = 123/454 (27.09%), Postives = 199/454 (43.83%), Query Frame = 3
Query: 1158 LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTP-------ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            + I + D NDN P   F +     +I EN  I+S       TD D   N       +  ++ F L+ +     +K+ Q+   +  DRE+ D Y + I   D G P  S++  L V + D ND  P F  +     + E+SP  T++        ++Q  D D+       ++     S     +  ++  +G++ V   +DRE T  ++L V  +D S       + ++V D NDN P       I  T+   L  E++ +N   AL+T   SD D+   G  + F +   +DV  + K  +D  YL ++   LD E    + F I  SD    G   L  TA V V++ D+NDN P F  P      L VS +      +  + A D D G N  ++Y++       + + F LDR TG +  +  F  E   RF F   ++A D G + +++
Sbjct:  127 IKIVVKDTNDNAP--MFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVV-------QLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITV--SDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDS---GKPSLNQTALVRVRLEDENDNPPIFTQP---VIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQERFLF--TVTARDNGTRALQS 553          

HSP 3 Score: 60.077 bits (144), Expect = 1.485e-8
Identity = 103/395 (26.08%), Postives = 161/395 (40.76%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGFNQY---FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPI-SSPVTFLKITDRDSNQNGEVTCRFLKSENR 1343
            L  ++S    T+ L E  P+NT I +   +DK    N KVI   F +    FHL     K V   Q  LE S L        D     +++F I   +     L  T  + + +ED ND  P F Q    +   E  K      L  I    + S +N  I YQ+     G N     +D   +   L      D E +  ++  + A D   +  + +  + V ++D N+ +P+F+      F V E+  K + +  +  TD DA    N    L  LN+ E    F ++ + G +K     D E+Q  Y+  + A DS       SS+  +TI++IDVNDN P + +   N    +     I  S V  +   D D+  N E+    +   N+
Sbjct:  359 LRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSAL-------LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKR--DLYLTTITATDEDSGRNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADA--GENAVVSLSILNDNE---NFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSG--HPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNK 722          
BLAST of Protocadherin delta 1 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 197.978 bits (502), Expect = 3.324e-51
Identity = 192/699 (27.47%), Postives = 305/699 (43.63%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + I       L  K+ I ++D ND  P F      +   E    +  +  +P A D D    +    Y+    NG Q+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F +E +    + ES+  GT +  LQATD D   N  I +   +  +  T   FA+N   G + V   LD E+   + ++++A D +  S R +    +TI++ DVNDN P +         N    + E  P+++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    + TT+T ++    +   I + +    +FF               +D+ +GVL  +   DRE    +   V   D+          + V + D+NDN+P    + FQ  V EN   Y    ++T   +D      G       S   D  + F LD     ++   S DRE+ SS+ F ++  D    G+    + AKV + V D NDN P  I+P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDSECSFEIEVVILPNDYFRL-IKIKIVVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPDMGPNS---VYKYELVNG-QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF-KESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARAT----VTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD-----AGENAVVSLSILNDN-ENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDS---GHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKL-VPLSAIPGSVVAEVFAVDGDTGMNAELKY---TIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 115.546 bits (288), Expect = 1.348e-25
Identity = 123/454 (27.09%), Postives = 198/454 (43.61%), Query Frame = 3
Query: 1158 LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTP-------ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            + I + D NDN P   F +     +I EN  I+S       TD D   N       +  ++ F L+ +     +K+ Q+   +  DRE+ D Y + I   D G P  S++  L V + D ND  P F  +     + E+SP  T++        ++Q  D D+       ++     S     +  ++  +G++ V   +DRE T  ++L V  +D S       + ++V D NDN P       I  T+   L  E++ +N   AL+T   SD D+   G  + F     +DV  + K  +D  YL ++   LD E    + F I  SD    G   L  TA V V++ D+NDN P F  P      L VS +      +  + A D D G N  ++Y++       + + F LDR TG +  +  F  E   RF F   ++A D G + +++
Sbjct:  127 IKIVVKDTNDNAP--MFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVV-------QLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITV--SDKDTDVNGKVICF---IEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDS---GKPSLNQTALVRVRLEDENDNPPIFTQP---VIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLG-----PNASFFDLDRKTGVLTASRVFDREDQERFLF--TVTARDNGTRALQS 553          

HSP 3 Score: 59.6918 bits (143), Expect = 1.714e-8
Identity = 103/395 (26.08%), Postives = 161/395 (40.76%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGFNQY---FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPI-SSPVTFLKITDRDSNQNGEVTCRFLKSENR 1343
            L  ++S    T+ L E  P+NT I +   +DK    N KVI   F +    FHL     K V   Q  LE S L        D     +++F I   +     L  T  + + +ED ND  P F Q    +   E  K      L  I    + S +N  I YQ+     G N     +D   +   L      D E +  ++  + A D   +  + +  + V ++D N+ +P+F+      F V E+  K + +  +  TD DA    N    L  LN+ E    F ++ + G +K     D E+Q  Y+  + A DS       SS+  +TI++IDVNDN P + +   N    +     I  S V  +   D D+  N E+    +   N+
Sbjct:  359 LRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSAL-------LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKR--DLYLTTITATDEDSGRNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHN-HFQFFVSENLPKYSTVGVITVTDADA--GENAVVSLSILNDNE---NFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSG--HPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNK 722          
BLAST of Protocadherin delta 1 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 196.438 bits (498), Expect = 9.384e-51
Identity = 179/640 (27.97%), Postives = 290/640 (45.31%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK----FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVD--VEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            K+   IEDIND  P F+     +   E   ++  +  +P A D D    N +  Y++  S     L  +      + P L++   LD ETK  +++ +   DG    K    ++ V V D+N+  P F ++ +   +V E+   GT +  L ATD D   N  I F   +  +  T   FA++   G + V   LD E   ++ + ++A D +    R +    + +++ DVNDN P +      +  N    + EN P+++ +  + +TDRD++ NG+VTC +   +  F L  + +  + +E+    D E    Y + I+  D G P L+TS  + + I+DEND  P F     + S+ EN+       +    L KI   D D  G     I       +A     ID  SG+L V+  +DRE   +Y   V   D   + + +++ V   V+D+NDN+P      +   V EN   Y    L+T   +D D+ +    V+      +D    F +D     ++ ++  DRE+ SS+ FV++  D    G  Q  + AKV + V D NDN P F+ P+S +    V      G VV +V A D D G N  + Y I    P     LF +D+ TG I
Sbjct:  164 KIRFLIEDINDNAPLFQSTVINISIPEN-TAINNRYPVPSAFDPDVGI-NGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVF-KDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRAT----VIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTC-YTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENN-------DPGTQLIKITATDADS-GSNALII--YSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITV--TDADAGDNAI-VTLSIINGKD---NFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDS---GLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPR---GLFAIDKTTGNI 773          

HSP 2 Score: 112.079 bits (279), Expect = 1.872e-24
Identity = 146/567 (25.75%), Postives = 236/567 (41.62%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVL--VKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEK--QASILTYKLNIFIEDINDWTPAFKQRQYYVEFYE-GPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQ--NLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRE-----LKSSFSVHESTVKGTVIAHLQATDNDA--------YPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPI 1856
            + EN+ IN    +P   D   P++ + G    Q++ L KS ++  L  ++  + +     +  QN   E  D  FV  I++ +        T  L + + D+ND  P FK  +  V   E  P      QL   A D D          QIHFS   Q     +  +   S    + +   LD E+   + L +LA+DG+    R  + V V D+N+  P          +  +  + E+    T IA +  TD DA        Y ++++ F+L+ + N +             L+    LDYE  + Y+I I+A DS       ++S  + I I D NDN P   F     + +I EN    + +  +  TD DS  N  +           F   +  +   +  +K  DRE+ ++Y   +I  D+G   L ++VT+ ++++D+ND  P F    + F V EN P + T+     GL  I V D D        +   +  DN      ID  +GV+      DRE  + Y   V   DS  +  T    + ++V D NDN P+
Sbjct:  188 IPENTAINNRYPVPSAFD---PDVGINGI---QHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDT-FVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLH--ATDADLGSN-----AQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFL-----------LETAAPLDYETTREYAIKIVASDSG--KPPLNTSAMVLIKIKDENDNAP--VFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGF--NIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTV-----GL--ITVTDADAGDNAIVTLSIINGKDN----FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPV 712          

HSP 3 Score: 108.997 bits (271), Expect = 1.703e-23
Identity = 127/455 (27.91%), Postives = 198/455 (43.52%), Query Frame = 3
Query: 1170 IIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGL----LDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTPILYTDLFQ-------LTVEENTINYDRALLTF--RPSDLDSTNTGFRVSFDQSTSEDV---LKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPL 2477
            I D+NDN P  +    N   +I EN  I++        D D   NG      +KS + F L+ +     DK+ Q+   +  DRE  D + + I   D G+P  S++  L V + D ND  P F  +    +V EN+P  T++T       ++   D D+    ++ F   N+  S        ID  +G++ V   +DRE    ++L V  +D S       + V+V D NDN P + T           L  E   +N   AL+T   R +DL+   T +       T  DV   LK    D   L     LD E    +   I  SD    G   L T+A V +K+ D+NDN+P F  P      L++  +   G  + K+ A D D G+N  +IY +    PD     F++D  +G + ++     E+  +++F ++  A D G+    NPL
Sbjct:  169 IEDINDNAPLFQSTVIN--ISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVT-------QLHATDADLGSNAQIHFSFSNQ-ISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY-------TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDS---GKPPLNTSAMVLIKIKDENDNAPVFPQP---EIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDG----FNIDPRSGILSVSKRLDREKQEKYSFTVI--ARDNGS----NPL 590          

HSP 4 Score: 56.225 bits (134), Expect = 2.009e-7
Identity = 73/292 (25.00%), Postives = 118/292 (40.41%), Query Frame = 3
Query: 1476 VTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDI-IGELTFFIDNKHTSDNATSVIQI---DKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLN-------VSCHEPIGHVVGKVQAFDPDLGNNGTV 2300
            V +  LIED ND  P F S     S+ EN       T  NN        D D+ I  +  +   K  S+    +I+    DK+   L V   +DRE  + + +++   D  +   +    + V V D NDN P+      ++ V EN      ++     +D D  +N     SF    S    ++F +D     + +++ LDRE     + ++  SD      S   + A V V V+D NDN P       T +++N       +S + P+   +  +   D D   NG V
Sbjct:  163 VKIRFLIEDINDNAPLFQSTVINISIPEN-------TAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQ-LIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENA-PMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASD-----GSATPSRATVIVNVTDVNDNVPSI----DTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKV 436          
BLAST of Protocadherin delta 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 2.360e-47
Identity = 190/712 (26.69%), Postives = 299/712 (41.99%), Query Frame = 3
Query:  378 LEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS--ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNG-GQNL--FQLLYDGTSQAPN---------------LLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITF----KLESLNNAET----ANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDT------ENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-------LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNN--------FRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRV--CCNDSIHVVCTDIY-VDVEDENDNTPILYTD------LFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFD--QSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVG-KVQAFDPDLGNNGTVIYEI 2312
            L+   LC+   + C        V +  + + Q S  +    + + + DIND  PAF+     V   E  ++VG++  LP AID D +  N +  Y+I  ++G G  L  F L+                        L L   LD E    Y L L   DG   +  G VL+ + V+D N+ AP F         + E +  GT +  L+A D DA PN  I +    KL SL           T  + + N +     +LD E   ++ + ++A D   +S  +S+S ++T+ + D NDN P  +          +    I EN P  +PV  + ++D D   +G V  R        L S N+          + +++ ++ D EE  +Y V+++  D G P LS  + L + + D ND  P F++          +  S++EN P  T + N       +   D D    G +TF +      ++   +  ++  +G L +A  +DRE    Y L V  C   S       I  V V DENDN P           ++Q  VEE T +    + T   SDLD  +   RV+ +  +    D +     D     +R    LDRE+   ++  ++  D    G   L  + +V + VSD NDN+P    PN+     +V    P G +VG  V A D D G+NG  +YEI
Sbjct:   89 LDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISES-EAVGRRVPLPRAIDPD-AGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAE-----KLDRETMPVHRLVVVARDGGQLS--RSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ--------FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLN-------LLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEET-SVGTYVGTVSTSDLDEGDNA-RVALNLVREAGPDWIGGAG-DTPGGVVRTLVVLDREDRVQYELSVRAVDS---GRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEI 770          

HSP 2 Score: 102.449 bits (254), Expect = 2.504e-22
Identity = 101/386 (26.17%), Postives = 170/386 (44.04%), Query Frame = 3
Query: 1380 IESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFR-FSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGA--IDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQL---------TVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTH---FVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL-NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVK 2468
            +E  +  DRE +  Y + +   D G+P LS SV LT+++ D ND  P F+    R   + E+S   T++        +++  D D    G + +    K TS    + + +D  +G++ V  A  +DRE    +RL V   D   +       + V++ D+NDN P+      Q           VE         L++    DL S+ T   V  +  T  ++    K+    L   + LD EE   +   +  +D+   G  +L     + + V D NDN+P F+ P S      V  VS  E  P G VV  + A D D G NG + + +S++   + +  LF L+  TG++ + +P   E+  R  + + + A D G+ + K
Sbjct:  224 LELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVV-------QLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGT-VDVRLEFPTGAELASPNKVQF-LLKTTRLLDYEEAQQYNVSVLAADR---GTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREK--RMRYELSVEACDGGSPQRK 595          
BLAST of Protocadherin delta 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 3.855e-44
Identity = 195/743 (26.24%), Postives = 322/743 (43.34%), Query Frame = 3
Query:  315 FNQYFHLDKSRNKIVLVKQID---LEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR--VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR----FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD------------IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEP--IGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINS--PFLSEQFCRFNFIIMISAEDLG 2453
            + + F LD    K+  +K +D   LE+  L V  Q+     L                  T K+ + + D+ND  P F   QY+    E  +  G       A D D    N  + YQ+  + G    FQ+  +  + A +  +  +LD E +  Y L + A DG     R   ++ + V D  +  P F+R+   SF V E+   GT++  + A+  D   N N+T+ + S    +   +F++    G +     +D E+Q  Y + ++A       E      S+++ + DVN++ P   FD  + + +I E++P++S    ++ TD+DS +NGEV     +         F +G L   Y++      DRE  + Y + +   D G   LS+SVT+ V + D ND  P F S+++ F   E     +        +  +Q  D D    G +T+  +    +       ++D  +G +      DRE     R     + S  VV TD            + V V+D NDN P     ++Q +V E+  N  + LL    SD+D   N   R + ++         F +D    ++ L  SLDREE +S+  V+  +D    G S L  +  V V+V D+NDN P+F     T  +L+V   E   +G ++  + A D D G +G V Y    I+       F +DR TG +F+     F +++  R N    +SAED G
Sbjct:  493 YREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGS----------------TAKVTVVVGDLNDNHPVFYPVQYFASILEN-EPGGTAVTTVTATDPD-RGANGTVRYQL--TAGDAARFQV--NAVTGAVSTRV--SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARD-DYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVS---GDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGE-----ASVSVLVHDVNNHAP--VFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYEL------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSL-------VGAVQATDADAGSNGGVTYSFEKPQVN------FELDSETGRIASLRVFDREAL--IRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQ-LLRVTASDVDEGVNGALRYAINEGNEG---GKFTVDASTGQITLLGSLDREETASYTLVVSATDS---GTSPLAASCTVAVQVLDENDNPPRF-----TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRY---AIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLN----VSAEDGG 1158          

HSP 2 Score: 166.392 bits (420), Expect = 9.959e-42
Identity = 173/687 (25.18%), Postives = 297/687 (43.23%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKN-RMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKF---DTENQKSTIRENQPISSPVTFLKITDRDS-NQNGEVTCRFLKSENR--FFLNGL-LDKFYQIESNKVFDREEIDRYFVNIICHDHGDP-SLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT-----TLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDS---TNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNP 2474
            ++ + + D+ND  P+F +       ++   +VG++ LL  A+D+D          Y+I   N    L            +L     LD E    Y L + A DG    + GR+ ++V V D N+  P F +    + SV E +  G  +  L                   L+          +   G +     LD+E ++ Y++++ A D    P+S R ++     I ++DVNDN P ++F       + +++ E+    +    + +TD DS   NGE++   +    R  F L+   +     ++     DRE I  Y + I+  D+G P + S + +L V + D ND  P+F  + +  ++ E +P  +     T  ++++GL+           +L + I     S N      +D+ +G++   G +DRE+ +   L +   D         T + V + D ND  P+     +  T  EN++     L     S  DS    N   R +FD        + F+LD    K+   KSLDREE+  +  V+Q  D+   G+  L +TAKV V V D NDN P F +P    +  ++  +EP G  V  V A DPD G NGTV Y+++      D   F ++  TG +        E+  R  + + ++A D G+ + ++P
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRA-SVAEDSPVGAALRDL-------------------LHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATA----VIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNA----------KLRYSI----VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLP---GLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDR---GSPPLGSTAKVTVVVGDLNDNHPVF-YP--VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTA----GDAARFQVNAVTGAVSTRVSLDREE--RAVYQLQVTALDGGHLRARSP 641          

HSP 3 Score: 160.229 bits (404), Expect = 8.504e-40
Identity = 177/672 (26.34%), Postives = 293/672 (43.60%), Query Frame = 3
Query:  447 FLIRIFEKQASILT-YKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE---GRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEK------QKIYSITIIAYDSA---PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSEN----RFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT---TLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPI-LYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHD--KLYLRKSLDREEISS-FQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            + +R+      +     +++ + D+N+  P F +  Y V   E  + V  +     A DKD S KN  + Y+I   NGG+  F +  DG      L +   LD ET+  Y L + A D  G E     V ++V V+D+N+  P F+    SS+  H  E    G+++  +QATD DA  N  +T+  E     +    F ++   G +  +   D E          +S +++A D     P+ +R +    + + + DVNDN P+  F     ++++ E+   S+    L++T  D ++      R+  +E     +F ++    +   + S    DREE   Y + +   D G   L+ S T+ V + DEND  P+F  +       E++       TLT S+         D    G++ + I     + N  +   ID+ +G +++A  +D E    YRL V   D         T + V V D NDN P  L  D+F   +E   I      +T R  D D  N     S  +        +F +D +  ++     +DRE     F+  ++ +DK    +++      V V V+D+NDN+P+F+ P +   +L        G VVG +QA DPD   N  V Y ++    D  + LF LDR TG I
Sbjct:  727 YQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAED-EPVNSRFFSVRATDKD-SGKNGEVKYEIGEGNGGEK-FGIFPDG-----QLYVRYELDRETREEYSLTVSAMD-TGVEPLSSSVTVNVTVLDVNDNKPLFN---SSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE-----KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRAT----VQVFVQDVNDNPPQ--FAKSVYQASVSESA--SNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGS---LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDE--------DTGPSGDVRYAI----VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDAD-VNGELHYSIARQFPPGA--HFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA---ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTG--GDAAI-LFRLDRRTGII 1349          

HSP 4 Score: 160.229 bits (404), Expect = 9.912e-40
Identity = 173/672 (25.74%), Postives = 282/672 (41.96%), Query Frame = 3
Query:  474 ASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEG-PKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNA-LDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSE-NRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCR----FNFIIMISAEDLGNQK 2462
            A   T  L +++ D+ND  P F    Y     EG P     K +   A+D D S  N  + Y I   N       L +    ++  L+  +  +D E     +L++ A D     K     + V ++D+N+  P F+ + K   +  E+++ G  +  + A D+D   N  + +  +    A+    F ++   G +  +  LD E+ + Y + + A D    S    S+  +T+ + D+NDN+P   F      ++I EN+P  + VT +  TD D   NG V  +    +  RF +N +      + +    DREE   Y + +   D G     +   +T+ + D  D  P F  +++ F V EN    T        +  +     D+   +T+ I     S +      I+   G ++ A AIDRE    Y+LRV  N         + V V D N++ P+     +++++ E+     R   + R +D DS   G  V ++        K+      +LY+R  LDRE    +   +   D    G   L ++  V V V D NDN P F   NS+ +V +    + +G +VG VQA D D G+NG V Y   K      +N F LD  TG I     F  E   R     +F   + A D G  K
Sbjct:  320 ARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDV--TAMDAD-SGLNAKLRYSIVSGN------DLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFT-QTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRG--SPPLGSTAKVTVVVGDLNDNHP--VFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGA---VSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTL-------VGSVSASTLDLNANVTYLI----VSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSR-FFSVRATDKDSGKNG-EVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDT---GVEPLSSSVTVNVTVLDVNDNKPLF---NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEK----PQVN-FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPK 950          

HSP 5 Score: 141.354 bits (355), Expect = 5.705e-34
Identity = 114/393 (29.01%), Postives = 177/393 (45.04%), Query Frame = 3
Query: 1146 SSFS-LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD-IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS 2315
            SSF+ + IS+ DVNDN P   F     +  + EN      +  L  TD D  QN  VT   L  SE  F ++        + +++  DREE   Y + +   D    + +T   L+V + D ND  P+F  + + F V E++      T +  G       D    GE+T+ +     SD A     +   +G L V   +DRE    Y LR    D   +  T  +YV+V D NDN P +  D     V E+      +LL    +D D       + F  S+ +   ++   +  +L + ++LDRE  S +  V+++SD+  H  ++L +  +V + ++D NDN+P F  P S           P+G VV  VQA DPD G N  V Y ++
Sbjct: 1497 SSFNQVEISVEDVNDNPP--VFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDA---ASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPP-GTSLLRISATD-DDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL----APEDSPVGAVVATVQAVDPDSGRNSYVEYALA 1875          

HSP 6 Score: 140.584 bits (353), Expect = 9.495e-34
Identity = 139/563 (24.69%), Postives = 239/563 (42.45%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYE--GPKSVGQKQLLPIAIDKDF-SKKNRMITYQIH------FSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-----------SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISD 2099
            +L++ + D ND +P F +  Y  +  E   P     + ++   +  D  S     +TY +       +++G   L  +          L +   LD E++  Y+L   A DG G      ++V V+D N+ AP    +  ++  V E    GT +  + ATD+D   N  + F   S+++ +    FA+  ++G L V   LD E+Q  Y++ +   D A  P + R SS+  +++ + DVNDN P     T  + +   E+ P+ + V  ++  D DS +N  V                     F LN +  +   +   +  DRE    Y + ++  D G P L+++ TL V + D ND  P+F    +  ++ E+ P  T +        ++   D D    GEL + I     S + T   ++D   G L VA  +DRE T  Y L V   D      +D   + V + D ND +P      + +   ENT      +L     D D  ++G +V++  +   D   +       ++L +SLDRE       +I  +D
Sbjct: 1602 RLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTG-------ALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAA-EVPEDAPPGTSLLRISATDDDEGVNAELEF---SISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPA-RLSSAVRVSLILTDVNDNAPAF---TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLV---RELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVL-------RLSAWDPDEGANGELRYDI----ASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSG-QVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 7 Score: 134.035 bits (336), Expect = 1.002e-31
Identity = 172/678 (25.37%), Postives = 283/678 (41.74%), Query Frame = 3
Query:  567 YEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHY-------------ILDLLANDGAGKEGRV------LIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK-----FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNG---LLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQST--------SEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            YE P ++ Q Q +P+     F      + + + +   GQ +F  L  G ++   ++  N LD   +  +             +L  L ++GAG   R        + + V D+N+  P F+   +    V E+T +G VI  L ATD D   N  +T+ +  L+ +E A  F ++  +G L+    LD E++  Y +T+ A D    ++ +     L++++ D NDN P        FD     +   + +   + +  +   D DS   GEVT     SE+  + +G   L      +   +  DRE    Y +     D G   L+ +  L V + D ND  P   +++    V E++P  T+L        +I   D D  +  EL F I    +S +      +    G L VA A+DRE  + Y L V  +D         S  V  + I  DV   NDN P   +    L  E++ +     + T +  D DS    + V +  +T        +      F L+    ++ L + LDRE   S+   +   DK   G   L +TA + V V D NDN+P+F       +   ++  EP G  V ++ A+DPD G NG + Y+I+   P  D   F LD   G + +  P   E+   +   + + A D G 
Sbjct: 1405 YESPINLLQGQTIPMPSSYLF------LRHHLDWEPEGQLVFFTLLLGVTRGHGVI--NPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVP-EMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV--LSGSEGA--FVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDAR-----LSVAVRDANDNSPRFSRHAYSFDVAEDAAP--DGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLL-------RISATDDDEGVNAELEFSI----SSGDPEGRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDV---NDNAPAFTSPRSALAPEDSPVGA--VVATVQAVDPDSGRNSY-VEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDK---GRPPLTSTATLAVTVGDANDNAPRF---PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD---FRLDPVLGTLAVARPLDRERTASYE--LAVRARDGGG 2031          

HSP 8 Score: 132.88 bits (333), Expect = 2.009e-31
Identity = 165/663 (24.89%), Postives = 281/663 (42.38%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI--AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA-GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKG-----TVIAHLQATDNDAYPNNNITFKLESLNNAETAN-TFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS--ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHD---HGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSD---------NATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKF-IFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS--------KILPDKDLNLFH-LDRHT 2366
            ++ I +ED+ND  P F   +  +E  E   + G+ +++    A D D   +N ++TY +   +G +  F  + D  S    L     LD E +  Y+L + A+DG    + R+ + V+  D N+ +P FSR    SF V E           VI  + A D D+ P   +T+ L    +++ A+  F ++   G L V   LD E +  Y +   A D   +    +++  L ++++D NDN P ++ D+    + + E+ P  + +  +  TD D   N E+         E RF +        Q+   +  DRE    Y + +   D   H    LS++V +++++ D ND  P F S     +  E+SP           ++ +Q +D D       +++    +D                ++  +G + +   +DRE    Y L V   D      T    + V V D NDN P      ++  + E+       +L     D D    G  + +D + S D    F+LD     L + + LDRE  +S++  ++  D    G      TA V V +SD ND SP F + P + H   N     P+  ++ +V A D DLG++G V Y  +         + PD  ++L   LDR  
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEE---NTGEGEVIFTLSATDAD-QGQNALVTYSVL--SGSEGAF--VVDAASGV--LRASRRLDREERASYLLTVRASDGTHATDARLSVAVR--DANDNSPRFSRH-AYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGL----AATARLYVNVLDANDNAPSVQNDS--LAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG----NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAV-------VATVQAVDPD--SGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTE-VLRLSAWDPDEGANG-ELRYDIA-SGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDG---GGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQG-PPV--LILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREA 2121          

HSP 9 Score: 130.954 bits (328), Expect = 8.569e-31
Identity = 169/688 (24.56%), Postives = 285/688 (41.42%), Query Frame = 3
Query:  438 KFVFLIRIFEKQASILTYKLNIFIE--DINDWTPAFK-------QRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA---GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF---LKSENR--FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT--------NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEEN----TINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISK--------ILPDKDLNL-FHLDRHTGEIF 2378
            ++   +R  +     L+ +    I+  D+ND  PA +        R   V+    P +V     L    D D    N  ++  I   N  +  F L   G      L + + LD E    Y L +LA+D      +     + V V D+N++AP F+     + ++ E    G+ +  + A D D+  N  + + + S N+      F+++   G +   G++D E      + I A D    ++ K++  SLT++++DVND  P   F      +T  EN      V  +   D D  +NG V   F   + ++ R  F L+ L  K   ++S    DREE++ Y + +   D G P L ++  +TV++ D ND  P F    +  S+ EN P  T +T           NG  + Q+   D                   +  Q++  +G +    ++DRE    Y+L+V   D  H+       + + V D  D  P    D +   V EN    T+    +  T    DL++  T   VS DQ  S  +    +    +++   ++DREE + +Q  +  +     G       A V V V D N+++P F   +   + ++++  EP+      V+A D D G NG V YEI +        I PD  L + + LDR T E +
Sbjct:  190 QYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAA---LVTVTDADSPTANGELSVSIVGGNE-RGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFA-LSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL---GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQG--AQPKTAYTSLTVTLLDVNDEPP--LFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKS---LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGD------------------AARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTL---DLNANVTYLIVSGDQRGSFSI----EWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGE------ASVSVLVHDVNNHAPVF---DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEY 828          

HSP 10 Score: 108.612 bits (270), Expect = 5.627e-24
Identity = 142/556 (25.54%), Postives = 228/556 (41.01%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCET------KHHYILDLLANDGAGK---EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKST-IRENQPISSPVTFLKITDRDSNQNGEV-----------TCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT---TLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNE-YRLRVCCNDSIHVVCT------DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDRE 2060
            +N+ + D+ND  P F    Y   F E  + VG       A D D +  N  +TY            Q+ ++  S+   +  L   D E          +   ++A DG      + R  + V V D+N+  P+F++ +  + SV ES    T +  + A+D D   N  + +   ++N       F ++   G + ++G LD E+   Y++ + A DS   +   ++S ++ + ++D NDN P     TE+  S    E+  +   +  L  +D D+  +G+V           T    +S    FL   LD          F+ + +  Y +N+   D G P  S++  L V + D ND  P FL  +   S+ EN P  T   T+T  +         D D+ GEL + I  +       +   ID  SG +  A  IDRE+T   + + V   D    V T      ++ V V DENDN P   T    L V+         + T + SD D + N   R +    T  D    F+LD     +  S  LDRE
Sbjct:  848 VNVTVLDVNDNKPLFNSSSYVFHFCE-EQEVGSLVGAVQATDAD-AGSNGGVTYSFEKP-------QVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQA-SVSESASNLTQLLRVTASDVDEGVNGALRY---AINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSG--TSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLD----------FETQRL--YRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDP--------DADVNGELHYSIARQFPPG---AHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAIL-VDGLRAAAGSVVGTLQASDPDEAENAAVRYAV---TGGDAAILFRLDRRTGIIETSTELDRE 1358          
BLAST of Protocadherin delta 1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 164.851 bits (416), Expect = 1.199e-41
Identity = 190/741 (25.64%), Postives = 313/741 (42.24%), Query Frame = 3
Query:  384 DSELCVHNQNCCDENLDCKFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQ-NLFQLLYDGTS---QAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-----FAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAP----------ISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLL-DKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFE 2507
            D E     Q+  DE   C     + +   Q        ++ I +EDIND  PAF      V   E   + G++  +  A D D S+ N +  Y++  S+    + F+L    T+   + P L++  +LD E +  Y ++L A DG      G  ++ + V D N+ +P F  + + +  + E++  GT +  L A+D DA  N  + ++L +      +       F ++ ++G + V G L+ E+  +Y I I+A D  P          ++    +  S TI I D+            N    I E   ++ PV  + ++D D   NG VTC     E  F L  L     Y +E+ +  D E  + Y V I   D G  SLS ++++T+ + D ND  P F    ++ SV EN+     L         +   D D+    E+ +F+       +A ++  +D  +G++ +   +DRE    Y   +   D  I V+  +  + V+V D NDN P      F   V EN   +    ++T   SD +  N   R+S       D  + F +D +   +R ++  DRE+   +   +Q +D    G     +T KV + V D NDNSP  + P S T +   V    P G +V +V A D D   N  + Y I    P    NLFH+D   G I +  P           ++ +S   +  Q     L   + + T E
Sbjct:  103 DREALCGGQDPGDE---CHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPA-GKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFD-QAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDI--------VAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLIT-------VSATDRDMDKNAEMVYFL-----GPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSD-EGENGRVRLSI---LGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDG---GEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLP-GTIVTEVSAVDNDAEINAELRYHIVGGNPH---NLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLE 806          
BLAST of Protocadherin delta 1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 161.77 bits (408), Expect = 9.119e-41
Identity = 154/581 (26.51%), Postives = 257/581 (44.23%), Query Frame = 3
Query:  513 DINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFS-KKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFD--TENQKST--IRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKE-NSP--FHTTLT-----NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCC-NDSIHVVCTDIYVDVE--DENDNTPILYTDLFQLTVEENTINYDRAL----LTFRPSDLDSTNTG---FRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQ--FVIQISDKHPHGNSQLFTTAKVFVKVSDQNDN 2174
            DIND  P F + + +VE  E   SV     +P+   +D     N +  Y +  +       +   DG   A  L++ + LD E +  Y L L A DG    + G  L+ + V+D N+ +P F+ +   + +V E    GTV+  L ATD D  PN  + +   S  +AE    F ++   G L + G+LD+E    Y I+I A D  P S    +   + + + D+NDN PE+K D   +++  T  + E     S V  + ++D DS +NG V C  L+    F L    D  Y + +N   DRE++  YF+ +   D G P    +   TV + DEND +P+F  + +  S+ E NSP  + TT+T       +NG+    V++ ++ G             + ++ + I+  SG +Y    +D E       +V   +D +  + T+  V V   DENDN P++     +       +  D  L       R  D DS   G   +R+   Q    ++ +  +L  +      S+     S+ +   V+ + D+   G+  L  TA + ++V    D 
Sbjct:  128 DINDHAPDFARSEMHVEISE---SVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYA-ELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFA-QTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSS--IPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVAC-HLRGHPHFKLLPYRDD-YVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGA------------SVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIV--QGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDR---GSPALSATAAIEIRVGAHGDG 682          

HSP 2 Score: 123.25 bits (308), Expect = 1.079e-28
Identity = 147/575 (25.57%), Postives = 244/575 (42.43%), Query Frame = 3
Query:  822 LIH--VKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL---ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF---LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQ------FLSNNFRFSVKENSPFH--------TTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRA-LLTFRPSDLDSTNTG---FRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP---NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFC---RFNFIIMI 2435
            L+H  V+++DIN++AP+F+R  +    + ES   GT +    A D D   N    + L   E    A  A T        +L V   LD E++  Y++ + A+D       +S +  + I+++D NDN P   F   +   T+RE+    + +  L  TD D   NGEV   F   + +E R     L  K  ++      D E    Y ++I   D G  S+     + V +ED ND  P+        S      V E + +         + + ++ NGL    +  H     L +                 D Y  V+    ++DRE   +Y L +  +D      V      V + DENDN P  +   ++ ++ EN  N   A + T    D D+ + G   + V   +     V  Y  ++     +Y  + LD E ++S  F +Q  D    G   L T A V V++ D+NDN+P    P   N T  V+ +     +G++V  V+A D D   NG + Y   +I+   + NLF ++R  GE+F N+  +++      R + ++M+
Sbjct:  119 LVHAEVELLDINDHAPDFARS-EMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKY--AELVVKSRLDREQEGEYTLQLTAWDGG--DPPRSGTTLVRITVLDSNDNSP--VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQ-LDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYR----------------DDY--VVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLEN--NSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDD---GVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTG-VVRLPRDAGLGYLVTVVRARDSDSEANGELSY---RIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMV 658          

HSP 3 Score: 73.9442 bits (180), Expect = 1.624e-13
Identity = 99/421 (23.52%), Postives = 177/421 (42.04%), Query Frame = 3
Query:  321 QYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTY--KLNIFIEDINDWTPAFK------QRQYYVEFYEGPKSVGQKQLLPIA-IDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNA-LDCETKHHYILDLLANDGAGKEGRVLIH---VKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL--ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDT-ENQKSTIR--ENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQD 1517
            + F LD    K+ L  Q+D E               L+ ++   I+  +   S +    K+ + +EDIND  P  K       R   V   EG        L+ ++ ID   S +N ++   +     G   F+LL     +   +++ N+ LD E    Y L L A+DG G   RV      V+++D N+  P F R    + S+ E+   G  +  + A D DA  N  I + +    +  A  +   ++N  +G +  +  LDYE     +  + A D    P+     ++ ++++ I+D NDN P +      N    +R   +  +   VT ++  D DS  NGE++ R ++   R  F +N L  + +   ++         R+ + ++  D G P+LS +  + + +    D D
Sbjct:  294 RLFQLDPKTGKLSLKGQLDHE---------------LNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDID---SAENGLVACHLR----GHPHFKLL---PYRDDYVVVTNSSLDREQMADYFLVLEASDG-GTPPRVAARQFTVRLLDENDNEPRFHRSTYEA-SLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLV----TNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGD 683          

HSP 4 Score: 52.7582 bits (125), Expect = 4.657e-7
Identity = 69/274 (25.18%), Postives = 107/274 (39.05%), Query Frame = 3
Query: 1689 SVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD-------IYVDVE--DENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRV-SFDQSTSEDVLKYFKLDHDK---LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPI--GHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKV 2465
            S++ +++  G +     IDRE   +      C     V+CT        ++ +VE  D ND+ P        + + E+     R  L     DLD      R    D++    +    + D  K   L ++  LDRE+   +   +   D    G+     T  V + V D NDNSP F          NV+  E    G V+  + A D D G NG V+Y  S  +  +   LF LD  TG++ +      E    +   I I A D+G   +
Sbjct:   73 SLVHVEEADGTVSAREVIDRE--QQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEG-ARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDG---GDPPRSGTTLVRITVLDSNDNSPVF-----AQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYE--ISIQARDMGPSSI 333          
BLAST of Protocadherin delta 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 4.758e-36
Identity = 150/567 (26.46%), Postives = 246/567 (43.39%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYE-KQKIYSITIIAYDSAPISERK-SSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR-FFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPF-----HTTLTNSNNGLSKIQVIDHDII----GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-----SIHVVCTDIY-VDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK----LYLRKSLDREEISS--FQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLG--NNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAED 2447
            + +++ D N+ AP F             +  G  +A++ A+D D   N  + + + S N   TA TF ++   G L  +  LD+E    +Y + + A D      R+ +S+ ++++ + DVND  P      E     + E QP     TF+  +D+DS  NGE+    +  + R  F+    D   ++      DRE    Y + I+  D G P L++++T+ V + D +D DP FL+     S+ E +           +++N G +   ++ H       GE  F+ D++               +G++YV   +DRE   EYRL +   D     S     +DI  V + DENDN+P+     ++  + EN+ N     +   P      + G   +   S       YF +D D+    + L + LDRE I     +  I + D       +   T ++ V V D NDN+P F   + T  VL  S    +G  V  V+A D DLG  + GTV Y I+    D     F +D  TG I   +P   E   R  +++M+ A D
Sbjct: 1158 VLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGN---TAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPID-VSEGQPGPRIATFMA-SDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQ---------------TGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQD-----GGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENS--PAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT----FGIDESTGLIVTVAPIDYE--TRPEYLLMVVATD 1691          

HSP 2 Score: 139.428 bits (350), Expect = 2.193e-33
Identity = 149/556 (26.80%), Postives = 254/556 (45.68%), Query Frame = 3
Query:  783 LLANDGAGKE-GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSE--NRFFLNGLLDKFYQIESNKVFDREEIDRYFVN--IICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTL--TNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCC------NDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRV-SFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQF------VIQISDKHPHGNSQLFTTAKVFVKV--SDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            L AN+ +G+  G   +H+ +I+ N+  P FS  L +  SV E+   GT +  + ATD DA       F   S + ++ ++ F+++  +G + V   LD+E    +++T++A D       + ++  + I+++DVNDN P   F  ++   T REN    +PV  ++ TD DS  N ++T   L +   + +F   +   +  +   +  D E+I    ++  I+  D G P L+++VT  V + DEND  P F  N++  ++ EN     T+   N+ +G    +       G+L+        S   ++  +I+  SG +     +DRE  ++Y L V        ND    + T + + + D NDN P      + +T+ ENT      + T   +D D    G  V + D         +++++     +R +   LDRE+++   F      V+  +D+   G+     TA   V V   D NDN P F+      + L V    P    + +V A DPD G NG V Y ++  LP  D   F LD  TG I
Sbjct:    1 LFANETSGEHWGSARVHITLINENDNRPIFSLPLYN-VSVWENATLGTSVVQVLATDLDAG-----VFGQVSYHFSDDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGG----GQETAGRVRINLLDVNDNTP--VFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPE------YGQLSLIY-----SLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIAT-VNITLLDVNDNDPAWRDLPYAVTIVENTPG-GTDIFTVSAADPDLNENGTLVYAIDPPN-----PFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADR---GSPPRRATASATVTVLLQDVNDNEPSFV---GLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD---FQLDAATGLI 517          

HSP 3 Score: 129.028 bits (323), Expect = 3.124e-30
Identity = 189/798 (23.68%), Postives = 307/798 (38.47%), Query Frame = 3
Query:  303 IGDGFNQYFHLDKSRNKIVLVKQIDLE------------DSELCVHNQNC-----CDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVL--------IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSIT-------IIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN---SPFHTTLTNSNNGLSKIQVIDHDI--IGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRAL-LTFRPSDL------DSTNTGFRVSFDQSTSEDVLKY--FKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLF-TTAKVFVKVSDQNDNSPKFI-FPN--STHFVLNVSCHEPIGHVVGKVQ-AFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKV-KNPLYRKYFSRTFEKLHITLLDI 2534
            I  G N  F +D+S   IV V  ID E            D     H  +C         LD K  F +  ++   S       + +            R    +    PK       LP+ +     K +    ++   S+  + +  L  + T+QA       ALD E    Y+L +L+ DG  +E   +        ++V V D N+ +PEF     +   V ES   GT++  L ATD DA  N  ++ +  +         + + + N     I  +D  K      T       I+A D    S  +S++F+L++ ++DVNDN P          S +    P  + V  +  TD D+  NG+VT R           G  D   ++      DRE    Y + ++  D G+P LS S  + VL++D ND+ P FL+     SV E+     F  T+  + N         + I  IG+  F +    TS   TS   +  Y      A A D      +                +YV+V D ND+ P+     F L      +N    + +  R  ++      +  N   R SF  +       +  F+++     +   ++LDRE  + +  ++  SD+   G    + +T  + V + D +DN P FI  P+  + +   ++  H P G  VG V  A D D+G N  V Y I+      + N F+L R  G + + S    E    +  I+  S+       V   P +     RT  ++ + L DI
Sbjct: 1652 IASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVV------------RVAAPQMKAPPK-------LPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQA-------ALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTI--VDVAKADFVEKTSQFILFRIVALDGG--SPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAP-GTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTV--HATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWG------------QAGLYVEVLDVNDHRPV-----FVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQ---GQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAA---GNEGNKFNLSRW-GLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDI 2392          

HSP 4 Score: 127.102 bits (318), Expect = 1.352e-29
Identity = 185/788 (23.48%), Postives = 322/788 (40.86%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFPNIKVIG----------DGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNA-LDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKS-SFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL--------ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAP-----ISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCR-FLKSENRFFLNGLLDKFYQIESN-KVFDREEIDRYFV---------NIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLS-NNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVA-GA-IDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSD---LDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIF-PNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEI--SKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMIS 2438
            + ENSP  T +   V N  ++ +    G           G + YF +D+ R  + +     L+   +              +    I + +      T +L + + D+ND TP F          E   +VG   ++  A+D+D    +   T +   ++GG + F     G  ++  L++  A +D ET+  Y+L ++A D A         ++V   NE   + S  L +   ++ E+ V GTV+  + A    A P   +   +        +     E+ N   +    G++     LD E    Y +T+++ D  P     +   K  ++ + +++ D NDN PE +  +      +RE+    + +T L  TDRD+  NG V+ R    +  R     +L    Q ES   + D  + D  FV          I+  D G P  ST+  L+V++ D ND  P FLS   +  SV E       L      ++ +   D D    G++TF I++          + I    G++ VA GA IDRE    Y L V   D  +   +    + V V+D ND  P     +  ++V E +++    + T + ++     +T   ++++     +  V     L      L KS +R     F      +D   HG   L+  A ++V+V D ND+ P F+  PN T  V+N++   P+   + +V A D D G NG V Y    +  +  +D   F ++  +G I        E    ++ I++ S
Sbjct: 1509 IPENSPNGTVLT--VLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIP-----------GGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAG-TVRYSIASGGNDTF-----GIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAY-VYVNVTDENDNSPEFEAGSATLVE-VRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYIL--IIQNESGVTIVDVAKAD--FVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVE-------LGAPGTLVASVWATDADAGPNGQVTFRIES-----GGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLE-SLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL-KSYER-----FNLTAVATD---HGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGT--VVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLAS 2247          

HSP 5 Score: 115.546 bits (288), Expect = 4.965e-26
Identity = 146/588 (24.83%), Postives = 270/588 (45.92%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLL-LLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNG--DLKVIGELDYEK--QKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRD-SNQNGEVTCRF-LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTS--VTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT---TLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDK-------YSGV--LYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKF 2186
            +++I + + ND  P F    Y V  +E   ++G   +  +A D D     + ++Y  HFS+   + F L       A  L+ +  ALD E    + + ++A DG G+E    + + ++D+N+  P F R+     +  E+    T +  ++ATD D+ PNN IT+ +  L  +  ++ F++ +  G   + +   LDYEK      S+TI+A D    S   +S+ +  + + D NDN P   FD  +    I EN    + V ++  TD D S + G+++  + L+   +F +N    +   I S  + DRE + +Y + +   D GD +   +   T+ + + D ND DP +    +  ++ EN+P  T   T++ ++  L++   + + I     F+  N  +    T+ +Q+D+       ++ +  + V+GA DR        R   + ++ V+  D+       NDN P      + L V E  +  +  L     +D D    G  V++   T+      F+LD     +     LDRE ++++Q  +  +D+   G   L +T  + + V D NDN+P F
Sbjct:   15 RVHITLINENDNRPIFSLPLYNVSVWEN-ATLGTSVVQVLATDLDAGVFGQ-VSY--HFSDD-SDKFSL-----DPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRD-SYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSI--LPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGG--SPPLNSTVTAIVEVFDENDNSP--IFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINA---RSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGA-DR---GSPPRRATASATVTVLLQDV-------NDNEPSFVGLPYALQVLEG-LPANSTLFQVTATDPDEGANG-NVTYSM-TAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDR---GTPALSSTTTLSLVVLDVNDNAPTF 565          

HSP 6 Score: 113.235 bits (282), Expect = 2.275e-25
Identity = 130/516 (25.19%), Postives = 228/516 (44.19%), Query Frame = 3
Query:  477 SILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG----KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIG-ELDYEK------QKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTL-----TNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD 1946
            S +T  + +F  D ND +P F +  Y +   E   + G   L   A D D S +   ++  + +S  G   F++     +++ ++     LD E    YIL + A DG      K G   +++ ++D+N+  P + R+L  + ++ E+T  GT I  + A D D   N  + + ++  N       + +N  +G ++  G +LD E         + SI +   D      R ++S ++T+ + DVNDN P   F        + E  P +S +  +  TD D   NG VT     +  R  F L+   GL+    Q+      DRE +  Y + ++  D G P+LS++ TL++++ D ND  P F       S+ E+    + +     T++++GL+           EL+FFI    T  N      +    G++    ++DRE    Y L +   D     S     T + V V D NDN P+     ++++V EN +     +L  + +D+D
Sbjct:  223 STVTAIVEVF--DENDNSPIFDRNSYSIAIPENILA-GATVLYVNATDGDQSPEYGQLS--LIYSLEGSTQFRI----NARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAW-RDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNP-----FYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEP--SFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQL------DREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNA----------ELSFFI----TGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPEN-VTRGAIILQVQATDID 700          

HSP 7 Score: 110.153 bits (274), Expect = 1.932e-24
Identity = 156/618 (25.24%), Postives = 251/618 (40.61%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHH-YILDLLANDGAGKEGRVL-----IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKV--IGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCR-----FLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGD-PSLST--SVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCC---NDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRP--SDLDSTNTG-FRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQA 2267
            T  + I I D ND  PAF    Y V   EGP + G       A D D     R++ Y I   N        + +GT     L  + ALD E     Y+L + A D      R L     + V V D+N+  P F R  +    V E    G  IA   A+D D+  N  + +   S+ + +  N F ++  +GDL+V    ELD E Q  Y++TI+A D    +   +S+ ++ + ++DV+DN P   F      +++ E   + + V+ ++ +D +  +N     +     F   E  F+ +      Y    N+  DRE +  Y + +   D+ D PS +   S  + V I DEND  P F    +   + ENSP  T LT  N  +      D  +   L + +       +A  +I  D+ +  + +   +DRE     RL +     +         + V V D NDNTP          V EN+     +++  +    DL   + G  R S     ++     F +D     +     +D E    +  ++  +D+ P      F TA   ++VS QN+   K  F  + +         P G VV +V A
Sbjct: 1155 TTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVV-YAIVSGNTAATFG--IDNGTGV---LTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQ-PGPRIATFMASDQDSGLNGELEY---SIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMG--TPPLNSTLTVGVRVLDVHDNDP--VFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYV---NRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDA-DFGVNATLAYSLLG---GSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT----FGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPP-----FHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVP-GTVVVRVAA 1741          

HSP 8 Score: 85.5001 bits (210), Expect = 6.356e-17
Identity = 84/323 (26.01%), Postives = 148/323 (45.82%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEG-PKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLL-LNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS--ENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNI 1436
            + + ++D+ND  P+F    Y ++  EG P +    Q+   A D D    N  +TY +  +    + FQL       A  L+  L  LD E    Y L L+A D           + + V+D+N+ AP F    +S+ S+ ES  + +V+  L  TD D+  N  ++F +   N       F++   +G ++ +  LD E +  YS+ I A D+ P   R++ + +L + ++DVNDN P   F   + + ++ EN    + +  ++ TD D   NG V  R +    +  F +N   GL+ +          DRE +  + + +
Sbjct:  446 VTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQV--TATDPD-EGANGNVTYSMTAALPRPD-FQL-----DAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-HPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQD---GQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRP--LFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISR-----GATPLDRETVALHALQV 748          

HSP 9 Score: 55.4546 bits (132), Expect = 8.904e-8
Identity = 92/412 (22.33%), Postives = 173/412 (41.99%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVI--AHLQATDNDAYPNNNITFKLESLNNAETAN--TFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTEN----QKSTIRENQPISSPVTFLK-ITDRDSNQNGEVTCRFLKSEN---RFFLN--GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVT---------------LTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDI 1634
            + + ++D+ND  PAF      V   E   SVG   +  +   +++   N   TY+I  +  G+N F      T  A + L+ +    ++   + L  +A D       G+  ++V+V+D+N++ P F      +  V+ + V   VI    + A D D   N  + +         + +  +F +N  +G +     LD E Q +YS+ ++A D   P+S    S+  L + + D++DN P      +     Q  +I E+ P  + V  +    D D   N  +   F+ + N   +F L+  GLL     ++        E+  Y+  II     +P+ + +VT               + V +ED NDQ P F ++ +   V  ++   + L        +++ +D D+
Sbjct: 2046 VRVLVDDVNDERPAFLAPVQTVSVLES-LSVGSF-VATVKATENYKGHNTKYTYKI--AGIGKNAF------TVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTV-VNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVS--YESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANA-IVYYFIAAGNEGNKFNLSRWGLLVVLSDLD-------REVSPYYA-IIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELL-------QLEAVDRDV 2428          

HSP 10 Score: 51.6026 bits (122), Expect = 1.277e-6
Identity = 64/249 (25.70%), Postives = 102/249 (40.96%), Query Frame = 3
Query: 1776 VCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNS-QLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILP---------DKDLNL---FHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPL 2477
            +C   +     T + + + DENDN P      +++ + E       A+     SD D  +   RV +    S +    F +D+    L   K+LD E  +    ++  +   P   + +L +TA V V V+D ND +P F+   S    ++VS  +P G  +    A D D G NG + Y I    P         D DL +     LDR T           + F  +N  IM  A+D+G   + + L
Sbjct: 1145 ICLTATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNA-RVVY-AIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFL--RSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRET-----------QAF--YNLTIM--AKDMGTPPLNSTL 1373          
BLAST of Protocadherin delta 1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 178.718 bits (452), Expect = 2.661e-45
Identity = 174/661 (26.32%), Postives = 297/661 (44.93%), Query Frame = 3
Query:  483 LTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVI----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEEN-TINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNF 2423
            +T  +++ + D+ND  P F++  +  E  E   SV    +L + ++      N  IT  +  S  G + F +   G      +L    LD ET   Y L + A DG    K     + + +I++N+  P F    + + S+ E     T +  L ATD+D  P   +TF +   N     ++F ++  +G + V   LD E    Y++ + A ++   S+ +S   + TI ++DVNDN P   F+  +   ++ EN PI   V  +  TDRD  +N +VT    +   ++F +N   GL      + + +  DRE+   Y + +   DHG PS S    +T+ I D ND  PQF  + +  +V EN+          NG + ++V+    D    G +T+ I     S N  +  +ID  +G + V G +DRE    Y L +   DS     V    + + V DENDN+PI  ++     ++E  +I    A++T    D  S    F       TS   +      +  L ++K ++RE + ++   I+ SD+   G+  + +  ++ V V+D NDN P F   NS  ++ +V  +      V  V A D D+G N  + Y    I+   D   F ++  +G I   +P   E+  ++  
Sbjct:  876 ITASIHVSVLDVNDNAPRFEKSLFSGEIRE-DASV-HSTVLQVKVEDKDEGSNGAIT--LSLSGEGSDNFTIDSTGF-----VLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVT-SIPEDVAINTHVVKLNATDSDGTP---LTFDIVEGN---AGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETG--SQGESVYNNATIRVLDVNDNAP--VFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGL------VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTA---------NGSNILRVLASDPDAGANGRVTYSI----ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAM---NGVLTVKKEINRETVPTYTLTIRASDR---GSPMMTSDKELTVVVNDVNDNPPVF---NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRY---SIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGL 1485          

HSP 2 Score: 160.999 bits (406), Expect = 9.734e-40
Identity = 175/677 (25.85%), Postives = 289/677 (42.69%), Query Frame = 3
Query:  432 DCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQ--KQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD--SAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS--ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFII 2429
            + K  + +RI        T+   I ++D+ND  P F    Y    YE   +VG   +QL  + +D      N  ++Y +   +G  + F +   G      +    A D ETK  Y + L A DG    + G+  + ++++D+N+  P FS   + + SV E    G  +  + A+D D   N ++ +   S N   T + F ++   G + V   LD+E++  Y++ +   D  S P+++    +  L I++ D+NDN P   F     +S ++EN P  + V+    TDRDS+ NG +    +K   +  F ++G       I   K  D E   RY + +   D G P    +  +T+ IED ND  P F  +N+   + E++   +T+         + V   D+       ++ +  S N      ID  SG + V+  +DRE T  Y L+V   D      +    + + ++D NDN+PI          E ++  +    +    +D DS+N   R +   +T  DV          + L+  LD E+ + +   +   D      S L T  KV V   D NDN P+F     + +   V  +   G  V  V A D D G NG + Y    IL   +   F +DR TGEI    P   E    ++  I
Sbjct:  133 ETKDSYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYE-DVAVGSIVRQLTAVDLDVGI---NARLSYSL--VSGDTSYFTVDSQGV-----IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFS-SAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGN---TNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTD----TSHLLINVNDINDNPP--VFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDG---STGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTV---------VTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDAD-DSSNGDVRYALSDNT--DVFS-INTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSL-TVVKVMVD--DVNDNPPQFA---KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISY---SILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTI 760          

HSP 3 Score: 153.295 bits (386), Expect = 2.085e-37
Identity = 193/740 (26.08%), Postives = 325/740 (43.92%), Query Frame = 3
Query:  318 NQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILT--YKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFS--VHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSP---VTFLKITDRDSNQNGEVTCRFLKSENR--FFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN-----SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTN--TGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            N  F LD     + + + +D E                   +   + + ++ +  LT    L I + DIND  P F    Y     E   +  Q      A D+D S    ++   I  ++ G  +F +  DG++    + +  + D E K  Y L + A D     K     + + + D+N+++P FS    S++S  + ESTV G+ +  + ATD D+ P   + ++L S N       F ++ ++G ++V  ELD E    YS+ + A D    S  +SSS  +TI++ D+NDN P        Q   +      SSP   +  +  TD D + NG+V  R+  S+N   F +N   GL+    Q+      D E+  +Y V +   D G PS S+   + V+++D ND  PQF  + +  +V EN     +  + T T++++G +          G++++ I     S N      +D+++G +     +DRE    Y L +  +D   V     T + + + DENDN P  +T   +  + E++    R   LT    D+      T   +S +Q  S      F+LD     L +R +LDRE I S+  V++ SD    G+ Q   TA + V V D NDN+P+F     + F   +     +   V +V+  D D G+NG +   +S    D     F +D  TG +   +P   E    +   + ++A D G+
Sbjct:  316 NHAFTLDAVTGVVTVSRSLDFEQR---------------SSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS----ATDRDSSTNGALVFGIIKGNDDG--VFTI--DGSTGI--ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS---PSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN---VKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGG--STSRSSSTRVTIALQDINDNSPIF------QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDV--RYALSDNTDVFSINTSTGLITLKTQL------DYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGAN----------GKISYSI----LSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPT-FTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNS------FQLDPRSGILSVRSTLDRETIPSYTLVVKASDA---GSPQQSITASIHVSVLDVNDNAPRF---EKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN----FTID-STGFVLSKTPLDYETTAAYQ--LTVTARDGGS 974          

HSP 4 Score: 152.14 bits (383), Expect = 4.155e-37
Identity = 155/555 (27.93%), Postives = 246/555 (44.32%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKS-SFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINS 2387
             D E++  Y L +LA D A +  +GR ++ + V D N+ APEF   L S  F++ E+T    V A + ATD D+  N  IT+ L S  N      F MN   G+++ +  LD+E +  Y++ I A+D       K ++F   I++ DVNDN P         K+ + E+  + S V  L   D D   N  ++   +  +  +F    +D    I +   FDRE    Y V +   D G PS S   T+ + I D ND  P F S  +  SV E+            G + + V   D        +    TS N      +D  +GV+ V+ ++D E  + Y L +   D      TD   + ++V D NDN P+     +Q  V+ENT    +   T R S   STN        +   + V   F +D     + + KS D E  + +   +Q  D+   G    + TA+V + + D ND+SP F   + +++   +     IG  V  V A D D G  G + Y   +++       F++D ++G I ++S
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEF--PLNSYVFNIRENTPAAQV-AIVTATDRDSGTNAAITYSLFSGENK-----FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG------KHTTFVPLITVDDVNDNAPFFALSV--YKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFT---VDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAI---------GAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSATDRDS---STNGALVFGIIKGNDDGV---FTIDGSTGIISIAKSPDYENKTRYDLTVQARDR---GVPVKYDTAQVTIFIEDVNDHSPVF---SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEY---RLISGNVKGAFNIDANSGSIRVSS 539          

HSP 5 Score: 131.724 bits (330), Expect = 8.387e-31
Identity = 170/684 (24.85%), Postives = 298/684 (43.57%), Query Frame = 3
Query:  300 VIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIE----DINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL-LYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG------KEGRVLIHVKVIDINEYAPEFSRELKSSF--SVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP-----FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQS-TSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPD 2279
            +I       F +D +  +I +V  +D E   L  +N               + I  K + +  +    F+     D ND +P F   +      EG  S+G +  +  A D+D    N  + Y I    G  + F +   +G      L +   ++ ET   Y L + A+D         KE  V+++    D+N+  P F+ +   S+  SV E++ + T +  + A D+D   N  + + + S N+ +    F +N  +G +     LD+E++  Y + + A DS     + ++  ++TI +I++ND  P   F  +N  +++REN P S+ V  +  +DRDS  +   +    K  ++F ++    +   I +  V DRE +  Y + +   D G+P LS    +T+ I DEND  P+F S+++  S+ ENS      F    T+++ G +            +T+ +              I   SGV+ +A  +DRE  + Y L +   D           I V V D ND+ P++ +   + +V EN    +  ++    SD D   TG       S  S +    F LD+    +  +  LDRE+ + +   I ++DK   GN  L + A V + V D++DN P+F     T + + +S   P G  + +V A D D
Sbjct: 1242 IISGNHGNAFRIDSTTGRITVVGVVDRE--ALASYN---------------LTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEG-VSIGSRVAVVTATDRD-EGSNAQVFYSI--VRGDTSAFAINAMNGV-----LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVN----DVNDNPPVFNSQ---SYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR---FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-----KYTAKTNVTIRVINLNDITP--AFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSID---QRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTN----------ARITYNLSRND-------AFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPK-ETHVMRILASDAD---TGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADK---GNPSLSSVADVIIDVIDEDDNCPRF---QPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 6 Score: 89.7373 bits (221), Expect = 6.277e-18
Identity = 88/363 (24.24%), Postives = 155/363 (42.70%), Query Frame = 3
Query: 1386 SNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFH----TTLTNSNNGLSKIQVIDHDII-GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK-SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            + + FDRE   RY + ++  D  +        + + ++DEND  P+F  N++ F+++EN+P       T T+ ++G +    I + +  GE  F +++K               +G +     +D E  + Y +R+   D  H     + + V+D NDN P     +++  V E+ +     +      DLD    G       S       YF +D   +   K + DRE  +S+Q  ++  D    G+      A V +++ D NDN P F   +S  +  +V     IG  +  V A D D GNN  + Y  +        + F LD  TG + ++     EQ  R ++ + +S  D G+
Sbjct:   24 TGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNA--AITYSLFSGENKFMMNSK---------------TGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYED-VAVGSIVRQLTAVDLD---VGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQD---GGSPSRSGQATVEIEILDVNDNRPVF---SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS---GNTNHAFTLDAVTGVVTVSRSLDFEQ--RSSYALGLSVTDRGS 353          
BLAST of Protocadherin delta 1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 172.94 bits (437), Expect = 1.899e-43
Identity = 157/612 (25.65%), Postives = 298/612 (48.69%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS 2315
            L I + D+ND  P F++  Y  +  E  KS+G   L   A D D S  N  + Y I  S+G  + F +       +  + ++  LD E    Y L + A D     +   V + + ++D+N+  P+FS+++ S+ ++ E      ++  ++ATD D   N  + F++ S N+    N F++N  NG+++V  +LDYE   ++++ + A D   P    ++   ++ I++IDVNDN P+  F + + ++ I EN  +      ++  D+D   NGE+T  F++++  F +N   +    I   +  DRE++ ++   I   D G P    +  +T+ + D ND  P+F    +  S+ ENS + T++        +++ ID D     T  + +  +S       +I+   G++ ++  ++    + Y   V  +D +      +YV+V D N + P      +   V+E+  +   ++LT   +D D T +  ++S+  +T   ++  F +D     ++   SLDRE++ +++F +  +D   HG  QL   + V++ ++D NDN P F+ P+    V       P G V+ +V A D D+G N  +IY  +
Sbjct:  114 LTINVLDVNDNGPIFERNIYAADIPED-KSIGDFVLAVRASDAD-SGSNGEVKYCILNSDGDNSAFSI----GEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSA-TIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND---MNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQT---TVDIALIDVNDNAPQ--FVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSIN---ENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVL-------QVKAIDPD--SGPTNVVYSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDA-SLGTSVLTVLATDRD-TGSNAKISYSIAT---LVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATD---HGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDI--RPGGRVI-EVSASDADIGKNAQIIYSFA 686          

HSP 2 Score: 148.288 bits (373), Expect = 8.473e-36
Identity = 142/500 (28.40%), Postives = 218/500 (43.60%), Query Frame = 3
Query:  438 KFVFLIRIFEKQASIL--TYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESN-------KVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHT---TLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTI 1901
            KF F I+  +K       T ++ I + DIND  P F Q +Y+    E  +  G   L   AID D    N  + Y I  S+G    F++   G      + L   L+  TKH Y+  + A+DG       L++V V D N +APEF R   S+  V E    GT +  + ATD D   N  I++ + +L        F+++   G +K  G LD EK   Y   + A D   I + K+ SF + I I DVNDN P   F   + ++ +RE+      V  +  +D D  +N ++   F         NG     + I+S        K  DRE I  Y + ++  D G P    SV + V++ED  D  P F    +  +V E++P  +   T+   +  LS    + + I+              N+  V  I+  +G +     +D E  +EYRL V    S     T + V ++D NDNTP+L      + V+E  +
Sbjct:  407 KFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSR-WGTSVLQVKAIDPDSGPTN--VVYSIVSSSGHDRCFRINPQGL-----ITLSCTLNYNTKHVYVFSVSASDGM-LSSTALVYVNVTDSNTHAPEFKRRSYSA-EVKEDASLGTSVLTVLATDRDTGSNAKISYSIATL-----VPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHG-IPQLKAKSF-VYIHIADVNDNDP--VFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFAS-------NGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIV------------RGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKV 868          

HSP 3 Score: 134.806 bits (338), Expect = 1.025e-31
Identity = 137/492 (27.85%), Postives = 220/492 (44.72%), Query Frame = 3
Query:  861 PEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSE--NRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD---STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEI 2312
            P+FSR L+   SV E    GTV+A + A+D D+  N  I + +    N  +A  F+++   G +     LD E    +   + A D    S        LTI+++DVNDN P   F+     + I E++ I   V  ++ +D DS  NGEV    L S+  N  F  G +     +   K  DRE++  Y + +   D G+P  S +VT+ + + D ND  PQF    +  +++E+ P +  +T       +    D    GE+ F I     S N  +   I++ +G + V   +D E+   + L V   D         T + + + D NDN P   +  FQ  + E   NY      +R    D    TN     SF Q+   D+      +   + +++ LDRE++  F F I+  DK   G      TA++ + + D NDN PKF   +   +  +++ +   G  V +V+A DPD G    V+Y I
Sbjct:   18 PQFSR-LQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLE--GYMDLTINVLDVNDNGP--IFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSG--AVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTT-----VRATDCDQGSNGEVFFEI----VSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPE---NYAVGQEFYRVQAYDKDHGTNGEITFSFMQN---DLPFSINENTGGISIKEELDREKVPKFTFGIKARDK---GVPFKEGTAQITITLLDINDNPPKF---SQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSI 480          

HSP 4 Score: 129.798 bits (325), Expect = 3.199e-30
Identity = 153/645 (23.72%), Postives = 269/645 (41.71%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKV------FDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFL 2396
            ++I + D+ND  P F    +     E   +VGQ+     A DKD    N  IT+        QN   L +        + +   LD E    +   + A D     KEG   I + ++DIN+  P+FS+E +   S+ E++  GT +  ++A D D+ P N + + + S +  +    F +N   G + +   L+Y  + +Y  ++ A D        SS+  + +++ D N + PE  F   +  + ++E+  + + V  +  TDRD+  N +++         + +  L+ +F   E+  V       DRE++D Y   +   DHG P L     + + I D ND DP FL  ++   V+E+             + ++   D D IG+    I +  ++ +      ID   G++     +DRE   EY L V   D           + V +ED  D+ P+    L+++TV E+T      +     S   S  TG   S  +  S  V      +   +     LD E  S ++  ++ +       S  FT   V V + D NDN+P      + H  +NV   +       K+ A+DPD+ +  T      K++         L+  +GE+ +N   +
Sbjct:  325 VDIALIDVNDNAPQFVSSHFQTMIPEN-YAVGQEFYRVQAYDKDHGT-NGEITFSFM-----QN--DLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQE-EYHTSIAENSRWGTSVLQVKAIDPDSGPTN-VVYSIVSSSGHD--RCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASDGM-----LSSTALVYVNVTDSNTHAPE--FKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKIS---------YSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVRED-------IRPGGRVIEVSASDAD-IGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFD-INPNTGAIQTLMKLDYETQSEYRLTVRAT------LSPFFTETTVMVYLKDINDNTPVL---EAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTF-----KVMEGNAKEWVTLNATSGELSVNKKLI 916          

HSP 5 Score: 111.694 bits (278), Expect = 1.230e-24
Identity = 162/724 (22.38%), Postives = 287/724 (39.64%), Query Frame = 3
Query:  309 DGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILD---------LLANDGAGKE---GRVLIHVKVIDINEYAPEFSRELKSSFS--VHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRY---FVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNA---------TSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC-----TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKH-PHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            DG N  F + +    + ++K++D E            D+               +++ +T K+ +   D+ND TP F ++ Y     E    V   QL+      D  +            + G+  F+++   +    N   +N ++ E +    LD         L+     G+     +  + + +ID+N+ AP+F   + S F   + E+   G     +QA D D   N  ITF        +    F++N + G + +  ELD EK   ++  I A D   P  E    +  +TI+++D+NDN P  KF  E   ++I EN    + V  +K  D DS     V      S +        D+ ++I    +        Y    V +      D  LS++  + V + D N   P+F   ++   VKE++   T++                    LT    ++ T  NA              +D+ +GV+  AG++DRE  + YR  V   D  H +      + +Y+ + D NDN P+     ++  V E+ I     ++    SD D      ++ +  +++ D    F +D  +  +R  K LDRE I  ++  +  +D+  P G + +    KV V + D  D+ P F  P    + + V    P    V  V+A   DL     ++Y I +        +F ++ +TG I
Sbjct:  171 DGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQG-----------NPPRSATVTVKITLL--DVNDCTPQFSKKVYSATIRE---DVPVNQLVTTVRATDCDQ-----------GSNGEVFFEIV---SGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF---VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF-----MQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKE---GTAQITITLLDINDNPP--KFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGH--------DRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSV--------------------LTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATD--HGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVRED-IRPGGRVIEVSASDAD-IGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASV----KVKVILEDVKDSPPLFEKP---LYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVR---GNSPQVFDINPNTGAI 809          

HSP 6 Score: 84.3445 bits (207), Expect = 2.993e-16
Identity = 72/258 (27.91%), Postives = 122/258 (47.29%), Query Frame = 3
Query: 1701 IDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC---TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            ID+ +GV+     +DRE  + +  RV   D          D+ ++V D NDN PI   +++   + E+    D  +L  R SD DS + G  V +    S+     F +      + + K LDRE++ ++   +Q  D+   GN     T  V + + D ND +P+F     +  V + +  E  P+  +V  V+A D D G+NG V +EI   +   D+N F ++R  GE+ +      E    FN  ++++A+D G
Sbjct:   73 IDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGD-FVLAVRASDADSGSNG-EVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQ---GNPPRSATVTVKITLLDVNDCTPQF-----SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEI---VSGNDMNFFSINRINGEVRVKQKLDYEMIGVFN--LLVTAQDKG 315          
BLAST of Protocadherin delta 1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 159.844 bits (403), Expect = 1.881e-39
Identity = 195/742 (26.28%), Postives = 328/742 (44.20%), Query Frame = 3
Query:  300 VIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEG-PKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNA-LDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEI-----DRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRE------LTNEYRLRVCC--ND-SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDS---TNTGFRVSFDQSTSEDVLKYF-KLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSP--FLSEQFCRFNFIIMISAEDLG 2453
            +IG   N  F +D S   I  +  +D E  E                 +   +    + +  T  +N+ + +  D  P F    Y    YE  PK     ++   A  KD   KN  I+Y I  S    NLF  L D T     ++ +N  +D E K  Y+L ++A  G  K    +  ++++V+D N+ AP+FS        +  + + G V+ +  A D DA  N  + ++L S  NAE      +N  +G +K+  +L    +  Y++ ++A DS    +  + +  +T+SI     N+P  KF   +  + +  +QP+S    ++   D+DS +NG++     +        GL   F      K++ R+ +       Y + +   D G PS S SV +T+ I+D ND    F++N FRF+V ENS   T +     G      +DH    ++ + + +        S   +D  SG +     +DRE       +N Y ++     ND +I      + V V D NDN P+    ++ +TV E ++        FR   +D+    N  F  S    T  D  K+F      +L+L K+LDRE  SS+  V++ +D     N+ L++TAK+ + V D ND  P  +FP S  + +N++    IG +V  + A D D+G NG + Y IS         +F ++  TG + +     F + Q     + + I+A+D G
Sbjct:  675 IIGGNNNGNFSIDSSTGVISTLASLDHEVEEFF-------------SLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVY--ATTKD---KNGSISYAI-VSGDPTNLF--LVDSTG---GIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTS-SVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS--NAE--GLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI-----NHPP-KFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEE----GLFGIF---PGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLV-----GTLVAHALDHSRTKDIVYSLISSE------SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSL---PGSPVFRIKAMDADEGDNAKFFYSLVSGTGMD--KFFINSSTGELHLSKTLDRETTSSYNLVVKATDAS---NANLYSTAKIEITVGDSNDQRP--VFPES-DYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN---GNLAAMFDVESATGRLIVAKSLDFETTQL----YELTITAQDHG 1345          

HSP 2 Score: 137.887 bits (346), Expect = 1.030e-32
Identity = 185/713 (25.95%), Postives = 296/713 (41.51%), Query Frame = 3
Query:  387 SELCVHNQNCCD-ENLDCKFVFLIRIFEKQASILTYKL-NIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFS----------RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMN-LHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRF-----FLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQV----IDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCC---NDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIM 2432
            S LCV  +   D E  D   + +        +++ Y L NI I D ND  P F Q  Y     E  K  G   L   A D+D S  N  I Y I +     N    ++D  S    +     LD E K+ Y  +++A+DG    K     + + V+D N+ +P+            + ++S     E+++  T IA++  TD D+  N+    K+    N +    F +  L    +++   LD E    Y++T+   D   +  R +  F L I + DVNDN P   F +    + I E     S V  L  TD D   NG V+       +       F +GL      + + K  DRE++    + I   DHG    + S T+TV I D ND  P+F+ ++++ ++ E +    T+         +QV    +D    G +T+ I +     N   + +++  +GVL+    +DRE  + Y   V      D   +    + + + D NDN P+ Y   +  ++ EN       LL    +D D   T   +S+D     +    F +D     +    SLD E    F  +I   D    GN     TA V V V ++ DN P F++      + N + +E  P G +VG+V A   D   NG++ Y I    P    NLF +D   G I IN     E+  ++   ++
Sbjct:  154 STLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKP-GVSILRVSAADRD-SGSNGDIKYAIDWDAIQSNS---IFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS-----ENSLINTNIAYILVTDKDSNTNSQTELKI---TNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKG-VPSRSTLGFVL-IDVTDVNDNSP--AFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGL------VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATV---------LQVSATDVDSGDNGRITYEISSSDAQVNG--LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN--EPPGKLLQVTATDADE-GTNAVISYDIIGGNNN-GNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDG---GNKYAAKTAVVNVTVLNKADNLPVFLYE-----MYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDP---TNLFLVDSTGGIIKINGDMDREEKAQYLLAVI 815          

HSP 3 Score: 124.79 bits (312), Expect = 1.046e-28
Identity = 134/496 (27.02%), Postives = 208/496 (41.94%), Query Frame = 3
Query: 1023 FAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENR--FFLNGLL---DKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLF-------QLTVEENTINYDRALLTFRPSDLDS-TNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            F  N + G +     +D E     S+ +   + +      +   S+ + + D+NDN P  +F T      IRE+  +++       TD D+  NG V       +N   F L            + + K  DRE  D Y +NI   D G P+L     + + I DEND  P F  N++  S+ EN       T     + ++   D D    G++ + ID      N  S+  +D  +GV+     +D E+ N Y   V  +D       D   + ++V D NDN+P L             +  E + IN + A +    +D DS TN+   +       E   K   L    + L+K LDRE +  +   + ++DK     S L     V + V+D NDNSP F    S  +  N+S     G  V ++ A DPD G+NGTV Y I+      DL  F +D  +G +    P   EQ    +  I I+A+D G+
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQISLQLRTLNPS------NQPISVQVQVDDINDNEP--RFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAEN-------TKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSN--SIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILV--TDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTL---GFVLIDVTDVNDNSPAF---TSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITG---GNDLGWFQVDFQSGLVTTAKPLDREQVS--SVTITITAQDHGS 507          

HSP 4 Score: 116.316 bits (290), Expect = 4.630e-26
Identity = 152/599 (25.38%), Postives = 258/599 (43.07%), Query Frame = 3
Query:  609 IAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEK--------------QKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSE--NRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT---DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHD--KLYLRKSLDREEIS----SFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP--NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEI 2312
            +A+D+D S KN  + Y I   N  + LF +   G      L +  +L    K  Y L + A DG        V + + + D N++   F       F+V E++  GT++  L A   D     +I + L S     + + FA+++ +G +     LD E+              + +Y+ T I  D A +           +++ D+NDN P   F       T+ E     SPV  +K  D D   N +     +     ++FF+N    + +    +K  DRE    Y + +   D  + +L ++  + + + D NDQ P F  +++  ++ E++   + + N N         D DI   G + + I N     N  ++  ++  +G L VA ++D E T  Y L +   D   +  +   ++ V+V D NDN P+  T    LTV EN +N    +     SD D T T   ++F    S+   K F ++    ++    ++D E +     SFQ V+  +D+   G+ +L T   + V+V+D+NDNSP F+ P   +    LNV            + A DPD  +NG V Y I
Sbjct:  969 VAVDQD-SGKNGQLFYSIPQGNE-EGLFGIFPGG-----KLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNN-TFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLIS-----SESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIV----------IVTVTDLNDNAP--VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHL---SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLN-------ASDKDIGQNGLIKYSISNG----NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVREN-VNTGFPVGRCTASDRD-TGTNAHIAFSMY-SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQ---GSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMT----------ITAEDPDRNSNGKVTYSI 1512          

HSP 5 Score: 110.538 bits (275), Expect = 2.103e-24
Identity = 163/678 (24.04%), Postives = 293/678 (43.22%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR--VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-SENRFFLN---GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP-----FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVL-------KYFKLD--HDKLYLRKSLDREEI----SSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFII 2429
            K+ + I DIND  P F   +Y+    E       K L   A D D    N +I+Y I    GG N      D ++    +  L +LD E +  + L + A DG  K      +++V V++  +  P F  E+  +F+V+E+  KGT++  + AT  D   N +I++ + S    +  N F ++   G +K+ G++D E++  Y + +IA      P+S +     ++ I ++D NDN P+  F T +    I     +   V      D D+ +NG V  +    +E   ++N   G++       + K+ D +E  +Y V ++  D G P   +  T+T+ I    +  P+F  +++   V  + P     F+    + ++G +          G+L + I       N   +  I    G LY+  ++ + L   Y L V   D      S  V  T IY  ++D ND+  +   + F+  V EN+           P  L  T      + D S ++D++        +F +D    ++  R  LDREE+     S  +++Q    + +  +     A V V V+D NDN+P F   +   + + VS     G  V +++A D D G+N    Y    ++    ++ F ++  TGE+ ++     E    +N ++
Sbjct:  622 KVELTISDINDNAPVFYPVEYFASIMENEPP--GKLLQVTATDAD-EGTNAVISYDII---GGNNNGNFSIDSSTGV--ISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMY-NFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVS---GDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQA----TVNIEVLDRNDNAPQ--FSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKL-----ARKLTDGDET-QYTVQVLASDSGSPPQHS--TMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKN----------GQLFYSIPQG----NEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVT-IY--IQDSNDHRSLFVNNTFRFAVAENS----------SPGTLVGTLVAH--ALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMY-NDTTIKRDKAIVIVTVTDLNDNAPVF---SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFY---SLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVV 1234          

HSP 6 Score: 108.612 bits (270), Expect = 8.884e-24
Identity = 140/543 (25.78%), Postives = 220/543 (40.52%), Query Frame = 3
Query:  273 NDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSE---LCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKI----YSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT--DRDSNQNGEVTCRFLKSENRFF----LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRE-LTNEYRLRVCCND----SIHVVCTDIYVDVEDEN 1841
            N K F ++ V G G +++F ++ S  ++ L K +D E +    L V   +  + NL                  T K+ I + D ND  P F +  Y V   E    +G   +   A DKD  + N +I Y I  SNG       ++D  S    L++  +LD ET   Y L + A D         V + V V+D+N+ AP F  +   + +V E+   G  +    A+D D   N +I F + S   ++T   F++N    ++  I  +D E        + + ++A D    S + S+  S+T+ + D NDN P                    S +  + IT  D D N NG+VT   +   N +F      G L   +QI  N          Y + I   D G PS  T   ++V  E      P F S +++ SV EN            G S + V+       L   I+   TSD++    ++ K +GV+     IDRE +   + L V   D    S       + + V+D N
Sbjct: 1191 NAKFFYSL-VSGTGMDKFF-INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYS----------------TAKIEITVGDSNDQRPVFPESDYTVNITE-DALIGSLVINLNASDKDIGQ-NGLIKYSI--SNGN---LAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQ-PVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKT---FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQG--SPKLSTRKSITVQVTDENDNSPGF---------VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTI-------YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVA---------GTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 7 Score: 99.7525 bits (247), Expect = 4.981e-21
Identity = 99/352 (28.12%), Postives = 158/352 (44.89%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI-AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVT-CRFLKSENRFFLNGLLDKFYQIESNKVFDREEI----DRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLS 1532
            + + D+ND  P F +  Y +   E   S+    +  I A+D D    N    Y +    G    F       S    L L   LD ET   Y L + A D +         I + V D N+  P F  E   + ++ E  + G+++ +L A+D D   N  I +   S++N   A  F +    G L V   LD+E  ++Y +TI A D   I    SS+ ++T++++DVNDN P   F T+    T+REN     PV     +DRD+  N  +    + ++ ++ F   +     +I +    D E +    D + + ++  D G P LST  ++TV + DEND  P F+S
Sbjct: 1147 VTVTDLNDNAPVFSRAVYAITVSE--LSLPGSPVFRIKAMDAD-EGDNAKFFYSLVSGTGMDKFFI-----NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFP-ESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKY---SISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIP--LSSTVNVTVNVLDVNDNAP--LFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTF--SVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVS 1480          

HSP 8 Score: 82.0333 bits (201), Expect = 1.372e-15
Identity = 164/708 (23.16%), Postives = 280/708 (39.55%), Query Frame = 3
Query:  444 VFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETK----------HHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIA---------HLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEI-----DRYFVNIICHDHGDPSLSTSVTLTVL-IEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQF--CRFNFIIMISAEDLGNQKV 2465
            V  ++    QA++     NI + D ND  P F      V+  +G   VGQ      A+D D + KN ++ YQ+                TS A  LL +N+     K            Y + +LA+D     +   + IH+  + IN + P+F+    SS+  H       V+A         ++ A D D+  N  + + +   N       F      G L +   L    +  Y + + A D    S   S+S  +TI I D ND+     F     +  + EN    + V  L     D ++  ++    + SE+ F ++    +  QI +    DREE+        ++      + D ++     + ++ + D ND  P F    +  +V E       L+   + + +I+ +D D      FF      S        I+  +G L+++  +DRE T+ Y L V   D+ +        I + V D ND  P+     + + + E+ +     ++    SD D    G  + +  S   ++   F ++    +L + KSLD E    ++  I   D   HG   L +T  V V V D NDN+P  +FP +    L V  +   G  VG+  A D D G N  + + +    P K    F ++  T EI   +    E     R +F +++ A D G+ K+
Sbjct:  818 VGTVKPLSAQATV-----NIEVLDRNDNAPQFSTSSVIVDI-DGTWLVGQVVYNAAAVDLD-AGKNGLVRYQL----------------TSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHI-TLSIN-HPPKFTL---SSYVTH-------VLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP----GGKLYIRKSLLQALKGSYDLIVRATDGGVPS--FSASVPVTIYIQDSNDH--RSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVD---VRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSE-------LSLPGSPVFRIKAMDADEGDNAKFFY--SLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDAL-IGSLVINLNASDKDIGQNGL-IKYSISNG-NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQD---HGLIPLSSTVNVTVNVLDVNDNAP--LFP-TQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSK---TFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKL 1458          
BLAST of Protocadherin delta 1 vs. Ensembl Nematostella
Match: EDO41005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5N5])

HSP 1 Score: 159.458 bits (402), Expect = 2.092e-39
Identity = 187/679 (27.54%), Postives = 297/679 (43.74%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI-HFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG----KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAP--ISERKS--SSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIES-NKVFDREEIDRYF-VNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN--SPFHTTLTNSNNGLSKIQVIDHD-----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH----VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD------------STNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFII 2429
            + + + D ND +P F +  Y    YE  +  G   +   A D D    N M++Y +   + G    F++     ++   +     LD E    + L + A+DGA     +   V + V V+DIN+ +PEF R    +FSV E+ + G ++  + A D D   N NI + +   N      +F +   +G L++   LD E    +S+ + A D     +++  S  ++ ++TI+++D NDN P    D      +I EN  +   +  L  TD+DS +N  +    +   ++F    ++D    I S NK+ D EE    F V I   DHG P LS  V + V +++ ND  P F  +N+ F + E   +  H  +     G+     +D D     + G+L      ++T  N+T    IDK +GVL   G++DRE    Y   V   DSI     V  T + V++ D NDN P+   D++   V E+  +    +L  R  D D            S NTG     D  T E            + L   L+RE+I+S+   +  +D    G     +TA V + V D NDNSP  +    T  +L    + P GH V KV   DPD  +NG V Y ++        + F +D  TG I        E    +N ++
Sbjct:  415 ITVMLRDENDNSPIFSRALYSSPIYEN-EPPGTFVIQVSANDSDIG-SNAMVSYAVLSDAEGHYQYFKI----NAKNGTITTSRRLDRENITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEFVRP-SYNFSVIETALPGAILGIISAVDRDKDLNGNIVYIITEGN---VEGSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVC--DKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGHSKF----VVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIV-----GVVSAHDLDADSSNCPLCGKL------QYTLGNSTGPFAIDKDTGVLRAVGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDA-SPGLTVLKIRAVDNDLASNANVSYSIVSGNTGAAFHVDNVTGE------------IKLVSKLEREKITSYTLTVGSADG---GAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLE---NLPAGHFVVKVVTTDPDEVHNGRVEYNLTS-------DAFRVDPFTGIITTTRALDRESIPAYNLMV 1040          

HSP 2 Score: 137.117 bits (344), Expect = 1.903e-32
Identity = 175/667 (26.24%), Postives = 282/667 (42.28%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNA-LDCETKHHYILDLLAND---GAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETA-NTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRF---FLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHG------DPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN-----SPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPS---DLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFII 2429
            I + D+ND  P F    Y     E   ++G   +   A D D    N    Y+I ++  G       + G      ++++N  LD E K  Y + ++A +    AG    V I V + D N+ +P FSR L SS  ++E+   GT +  + A D+D   N  +++ +  L++AE     F +N  NG +     LD E    + + + A D AP+S  + S   + ++++D+NDN PE    + N  S I    P  + +  +   DRD + NG +   ++ +E      F+ G      Q+  N   DRE + ++ + +   D G        SL+T++ +T+ + D ND  P      +  S+ EN     S  H   T+ ++G     ++ H + G   F +DN     +   ++  ++   V  VA  +         L V  N           V V++ NDN P    D +   + E     D A++    +   D DS+N        Q T  +    F +D D   LR   SLDRE I ++ F +   D  P  N  L     V V + D NDN P F   +   +  NVS     G  V K++A D DL +N  V Y    I+       FH+D  TGEI + S    E+   +   +
Sbjct:  313 ITVTDVNDNIPLFTLPSYNTTVNEN-AAIGTYVIQVQAEDID-QGVNASFIYEIAYA--GHEFVIGEHSG------IIIVNGTLDREKKDLYSITVIARETETSAGFHSNVTITVMLRDENDNSPIFSRALYSS-PIYENEPPGTFVIQVSANDSDIGSNAMVSYAV--LSDAEGHYQYFKINAKNGTITTSRRLDRENITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYN-FSVIETALP-GAILGIISAVDRDKDLNGNIV--YIITEGNVEGSFIIGARSGLLQL--NHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHLNCTDQDSG-ENAHLLYHMVSGHSKFVVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLSLVVFVN-----------VTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKL-QYTLGNSTGPFAIDKDTGVLRAVGSLDREGIKNYTFSVIAQDSIP--NRPLVNVTMVTVNLLDVNDNDPVF---DRDVYTANVSEDASPGLTVLKIRAVDNDLASNANVSY---SIVSGNTGAAFHVDNVTGEIKLVSKLEREKITSYTLTV 939          

HSP 3 Score: 136.346 bits (342), Expect = 2.791e-32
Identity = 162/668 (24.25%), Postives = 290/668 (43.41%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI-AIDKDFSKKNRMITYQIHFSNGGQ-NLFQLLYD-GTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRV---LIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQI-ESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND----SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            +N+ ++++ND  P+F Q  Y     EG  +V    +  + A D D    N  +  ++ ++ G     F +  D G  +A     + +LD E   +Y   ++A D       V   ++ V ++D+N+  P F R++ ++ +V E    G  +  ++A DND   N N+++ + S N   T   F ++   G++K++ +L+ EK   Y++T+ + D   +  R  S+  + I ++DVNDN P    DT+  +  + EN P    V  +  TD D   NG V         R      +D F  I  + +  DRE I  Y + +   +     +  + ++ V++ D ND  P F    +  S  E +P  +TL        +++ +D D  I  E+      ++T     S+ +I+  +G++ +  ++DRE   +Y+L V   D      +   T I + V D NDN P      +   V E  +    A++     D +  N     S     +++    F +++    +Y    LDRE    +   +  SD+   G   + ++  V + V+D NDN P      +   V+    + P G +V  + A D D G+N  V +     +PD   ++    +  GEI +      E   RF F  M  A D G
Sbjct:  739 VNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTLGNSTGPFAIDKDTGVLRA-----VGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTA-NVSEDASPGLTVLKIRAVDNDLASNANVSYSIVSGN---TGAAFHVDNVTGEIKLVSKLEREKITSYTLTVGSADGGAVPRR--STALVIIYVMDVNDNSPVCLHDTQTVR--LLENLPAGHFVVKVVTTDPDEVHNGRVEYNLTSDAFR------VDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYISTPETTPVGSTLF-------RVRAVDGDDGINAEV------RYTLMGEESLFRINYTTGIVTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEGQVGAVAAIVVALDKD-EEINADIVYSIIGGNTDN---SFAINNKSGSIYTLLHLDRETTDRYILTVLASDR---GEPAMNSSTNVTIHVNDVNDNKPNI---TNNPGVVVTRENTPPGSLVYILSASDLDEGSNARVAFS-GYAVPDGKFSI----KPNGEIMVRDSLDREAQNRFVFYAM--ATDSG 1357          

HSP 4 Score: 122.479 bits (306), Expect = 5.603e-28
Identity = 132/550 (24.00%), Postives = 229/550 (41.64%), Query Frame = 3
Query:  744 ALDCETKHHYILDLLANDGAGKEGRV--LIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKL---ESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK--SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYS-----------GVLYVAGAIDRELTNEYRLRVCCNDSIH------VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEIS 2315
            ALD E+   Y L + A +    +  V   +HV V+D N++ P F+   +   S  E+T  G+ +  ++A D D   N  + + L   ESL        F +N   G + ++  LD E +  Y + + A D   I E  ++S ++ I + DVNDN P   F   +    + E Q  +     + + D+D   N ++    +   ++N F +N      Y +      DRE  DRY + ++  D G+P++++S  +T+ + D ND  P   +N      +EN+P                       G L + +      + + + +    Y+           G + V  ++DRE  N +       DS        +V  DI   + DENDN P+     + + + EN  + +  ++    S+ D     F++S     S D   YF + +    +  RK LDRE +S F   I   D+   G         V + V+D+ND +P          +++VS +  IG  V  + A D D  +N  + Y + 
Sbjct: 1027 ALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMA-RYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEESL--------FRINYTTGIVTLVSSLDRENKAQYQLEVEARDRG-IPESNANSTTILIRVGDVNDNRP--TFTHAHYDGNVLEGQVGAVAAIVVAL-DKDEEINADIVYSIIGGNTDNSFAINNKSGSIYTLLH---LDRETTDRYILTVLASDRGEPAMNSSTNVTIHVNDVNDNKPNITNNPGVVVTRENTP----------------------PGSLVYILSASDLDEGSNARVAFSGYAVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDIL--IADENDNNPVFDPVHYSVNISENGPS-EEVIVQVNASERDEGKLLFKIS-----SGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDE---GRPSRMALGYVTIFVNDENDFAPVI---EQCEQLVSVSENAHIGSAVASINAVDKDDPSNTKITYSVG 1524          

HSP 5 Score: 106.686 bits (265), Expect = 3.451e-23
Identity = 124/477 (26.00%), Postives = 200/477 (41.93%), Query Frame = 3
Query:  501 IFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLAND----GAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD---------IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEE 1892
            I + D+ND  P F    Y     EG        ++  A+DKD  + N  I Y I   N   N F +     +++ ++  L  LD ET   YIL +LA+D           V IHV   D+N+  P  +          E+T  G+++  L A+D D   N  + F   ++ + +    F++   NG++ V   LD E Q  +    +A DS       SS  S  I I D NDN P   FD  +    I EN P    +  +  ++RD    G++  +    +   +   + +    I + K  DRE + R+ + I   D G PS      +T+ + DEND  P         SV EN+   +        ++ I  +D D          +G   F I  +    ++ S     +Y G++  AG +DRE  + Y + V  +D  H+   +I V + D NDN+P+       +++ E
Sbjct: 1162 IRVGDVNDNRPTFTHAHYDGNVLEGQVGAVAAIVV--ALDKD-EEINADIVYSIIGGNT-DNSFAI----NNKSGSIYTLLHLDRETTDRYILTVLASDRGEPAMNSSTNVTIHVN--DVNDNKPNITNN-PGVVVTRENTPPGSLVYILSASDLDEGSNARVAFSGYAVPDGK----FSIK-PNGEIMVRDSLDREAQNRFVFYAMATDSGQ-PPFNSSMVSFDILIADENDNNP--VFDPVHYSVNISENGPSEEVIVQVNASERDE---GKLLFKISSGDPGGYFT-IHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPSRMALGYVTIFVNDENDFAPVIEQCEQLVSVSENAHIGS-------AVASINAVDKDDPSNTKITYSVGNSAFNITTQRLPFSSGS-----RYRGIIITAGLLDRERQDNYNITVTASDGNHIATCNIIVRITDVNDNSPVFNQTTMNISLHE 1603          

HSP 6 Score: 75.0998 bits (183), Expect = 1.472e-13
Identity = 90/348 (25.86%), Postives = 158/348 (45.40%), Query Frame = 3
Query: 1338 NRFFLNGLLDKFYQIESNKV-------FDREEIDRYFVNI-----ICHDHGDP--SLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQV----IDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTF----RPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYL-RKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEI 2312
            N   ++G  D  + I+ NK         D E++ +Y +NI     + +D   P   LS    +TV + D +D   +F + ++  S+ EN+   + +         +QV    +D  I   +T+ ID K T  N   +  I   +G + + G++DRE   EYRLR+    +I+   T++ + V D NDN P     LF L     T+N + A+ T+    +  D+D    G   SF    +    ++   +H  + +   +LDRE+   +   I +  +    ++   +   + V + D+NDNSP F   +   +   +  +EP G  V +V A D D+G+N  V Y +
Sbjct:  146 NYAIVSGNEDGIFDIDFNKGVIRLARELDFEQMTQYKLNISASNPLTNDTVIPKNGLSNWTMVTVNVLDADDLPVRFNNYSYSASIPENAAMGSVV---------MQVHAKDLDKSINAPVTYAID-KET--NPLRMFNIANITGEITLNGSLDRETIAEYRLRILAYCTIYQDHTEVLITVTDVNDNIP-----LFTLPSYNTTVNENAAIGTYVIQVQAEDIDQ---GVNASFIYEIAYAGHEFVIGEHSGIIIVNGTLDREKKDLYS--ITVIARETETSAGFHSNVTITVMLRDENDNSPIF---SRALYSSPIYENEPPGTFVIQVSANDSDIGSNAMVSYAV 468          
BLAST of Protocadherin delta 1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 158.688 bits (400), Expect = 4.671e-39
Identity = 198/689 (28.74%), Postives = 295/689 (42.82%), Query Frame = 3
Query:  471 QASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI-----AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDY-EKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVF-----DREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQ--IDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFN-FIIMISAEDLGNQKVK 2468
            Q S+    +NI + D+ND  P F + +Y     E        Q L +     AI +D    N  + Y I   N   N+  +   GT     L L + +D E      L + A D       G   + + VIDIN+ +P+F+    SS  V   E T  G     +   D D+     ++F L  L+N  T   F ++ + G L +   +DY    + Y++ + A D    S  +SS+  L + ++DVND  P   F   +  + + E  P  S +  +  TD DS +NG ++  F    +         KF      K+F     DRE+I+ Y + +I  DHG P  S+S  + V+++D ND +P F   ++ F VKEN P  T L     G       D    G +T+  D        T V Q  +DK +G +  +  +DRE    Y   +   D   S  V  T + V V D ND +P    + + +TV E+ +    +LLT   +D D       +++         K F L+     L L   LDRE        +  SDK   GN  L T   + + V D NDN P FI  N T F   V    PIG VV  V A D D G+NG V Y   KI+       F ++  TG I   S   +  F   N +++ +SA D+G ++ K
Sbjct:  681 QDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQE------HSQALSVIGHVHAISRD-KGTNAEVVYSISKGNT-DNIVLINSTGT-----LYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFN---SSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSL--LSNPGTL--FNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGG--SPPRSSTAMLELKVVDVNDYSP--VFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVD-------TSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYL-----GAVSASDSDEGSNGHVTYRFD--------TQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNED-LPVGSSLLTLIATDDDQQGPNSDITYMIVAGP---KAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDK--GGNQSLETITYIEINVLDVNDNYPVFI--NETTF-KTVPEKLPIGSVVAAVLAVDSDQGDNGKVRY---KIVNGNTDGTFKINETTGVI---STLRALDFEVTNRYVLRVSATDMGKKQQK 1310          

HSP 2 Score: 154.066 bits (388), Expect = 1.399e-37
Identity = 178/675 (26.37%), Postives = 297/675 (44.00%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAFKQRQYYVEFYEG-PKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDS-NQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHG-DPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND--------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDST-NTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            T  L + + D+ND++P F    Y     E  P      +++   +D   S +N  I+Y    S    + F L   G      + + + LD E    Y L ++A D           VKVI  D+N+  P F ++   +F V E+    T +  + A+D+D   N ++T++ ++         F ++   G +     LD E +  Y  +I+A D    S  +     +T+ + DVND  P  KF       T+ E+ P+ S +  L  TD D    N ++T   +     F LN +      +      DRE   R+ ++++  D G + SL T   + + + D ND  P F++     +V E  P  + +       + +  +D D    G++ + I N +T        +I++ +GV+    A+D E+TN Y LRV   D        S  +V   IYV  ED NDN P    +     + EN +  +  + T +  D DS  N+    + D   S+    +FK++ +   ++ +  +DREEIS +   ++ +D+      +L+ TA + + + D NDN+PKF+  N T+    V   EP    V  + A DPD G  G V Y I  + PD     F LD  TG + +      E   ++   + ISA DLG+
Sbjct:  895 TAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVD---SGENGRISYAFD-SKVDTSKFGLRNGG-----KIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF-QQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDT-----QVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGG--SSPRVDKTQVTVIVRDVNDCSP--KFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSP---LDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVV-------AAVLAVDSDQGDNGKVRYKIVNGNTD----GTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVT--IYV--EDANDNRPTFDKNPIITWIYEN-VPINTNVTTIKAHDDDSGLNSRIWYTID---SQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY----VMEDEPFNFQVTSITALDPDTGQGGNVEYRI--VSPDT--GKFSLDLKTGVLKLIGSLDYEDVPQYT--LHISATDLGS 1518          

HSP 3 Score: 152.91 bits (385), Expect = 2.808e-37
Identity = 185/704 (26.28%), Postives = 317/704 (45.03%), Query Frame = 3
Query:  486 TYKLNIFIEDINDWTPAF-KQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLL----YDGTSQAPNLLLLNA----LDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFD-TENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLN-GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRAL-LTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYL--RKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI 2534
            +Y + ++++D+ND +P+F +     +  +E  K   QK    IA+D DF   N   +Y I   N G N+F+L+     DG   A   L++NA    +D E    Y+L++ A+DG      G + + + V D N+  PEFS  +  S ++ E+   GT I  + A+D D   N  I + +E+ ++ +    F ++   G +     LDYE ++ Y I + A D    S + SSS  + I ++DVNDN P +    T      + EN  I + V  + ++D DS +NGEV       +  F +   +L+    I   +  DRE  D +F+  +C D GDP  +T  +  + + D ND  P+F  + +   V EN+  +T        ++ +  +D D     EL + I N   S +      ID  SG++  A  +DRE   +  L V  +D      +D   + V++ D NDN P      +  ++ EN+ +    + L  +  D+   +         +T       F LD  K  +   ++LD E  SS+ F +  +D    G S     A V V ++D NDN P F   + + + +    +  IG  + +++A D D        + I +   D+   +F +D   G   I    L ++  + N+++ + A D G Q   N             ++IT+LD+
Sbjct:   41 SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL---IAVDSDFG-SNSTQSYTIVSGNVG-NVFKLISKRDTDGDLYAD--LVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFS-NVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQA--IFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGS-SHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTL-------VAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP------FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDG--GGRS---CNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADE---VFSVD---GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAI----------VNITVLDV 696          

HSP 4 Score: 151.369 bits (381), Expect = 1.039e-36
Identity = 186/739 (25.17%), Postives = 326/739 (44.11%), Query Frame = 3
Query:  378 LEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEG--RVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDR-YFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEEN--TINYDRALLTFRPSDLDSTNTG-FRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPD-LGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSY 2546
            L+  +  V N    D  +   + F +   +         +++ + D+ND  P F    Y VE++E  + +GQ      AID+D S K  +  + I   N  + +F +  DG+     + L   LD ET+ +Y+L + A DG G++   + ++++ V+D+N+  P FS+  + +F++ E +   +VI H+ A   D   N  + +   S++   T N   +N   G L +  E+D+EK     +T+ A D    +       ++TI++ID+NDN P+  F++ +    + E+ PI      + + D DS   G V+   L +    F   L      +   K+ D     R Y + +   D G P  S++  L + + D ND  P F + ++   V E +P  + +         I+V+  D+     G +++  D+K      TS   + +  G +++   +DRE   EY L+V   D          D+ V V+D NDN P      +   V+EN     Y   L     SD D  + G     FD   ++     F +D    K+   + LDRE  +S+ F I  +D    G+S      +V V V D ND SPKF   +   + + V+   P+G  +  + A D D  G N  + Y I           F L++ TG + + SP L  +    + + +++++  GNQ ++   Y          + I +LD+  +Y
Sbjct:  546 LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTR-IGQSICQLKAIDRD-SPKFAITRFIIEQGNADE-VFSV--DGSGL---ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKA-EYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVY---SISKGNTDNIVLIN-STGTLYLQSEVDHEKIPSLYLTVQAKDKG--TPPLFGYANVTIAVIDINDNSPQ--FNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLF--NLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNI---------IEVVATDVDSGENGRISYAFDSKVD----TSKFGL-RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATY---LGAVSASDSDEGSNGHVTYRFDTQVAQ-----FIVDKQTGKITTSQVLDREAKASYVFSIVATDG---GSSPRVDKTQVTVIVRDVNDCSPKF---SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIV-----AGPKAFSLNQVTGVLTLVSP-LDREVTHRHILHVVASDKGGNQSLETITY----------IEINVLDVNDNY 1221          

HSP 5 Score: 147.902 bits (372), Expect = 9.608e-36
Identity = 176/698 (25.21%), Postives = 295/698 (42.26%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNA-LDCETKHHYILDLLANDGAGK---EGRVLIHVKVIDINEYAP--EFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMN---LHNGDLKVIGE-LDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS-ENRFFLN--GLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDI-IGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVC-TDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGF-RVSFDQSTSEDVLKYFKLDHDKLY-LRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI 2534
            +L+I +ED ND  P F    Y     E    VG   L   A DKD    N  I Y I   +  Q +F     G      +++ N  LD E K  Y++ + A D           ++ ++V+D+N+  P    S  L  S+ V E+   GT +A +  +D D+  N  +   LE  +       F+M    L++  +  +G+ LD E    + +  +  D          SF + +   DVND  P  KFD    ++ + EN  +++ V  +   D+D   N E+      + E+R +L+   +      I +    DRE+I +  + ++ HD G P LS + ++ V + D ND DP F  +++  S+ ENSP         +G   +Q++  D  IGE +  + +  T +       +D   G++  +  +D E+ + Y  +V   D     C   ++V + D NDN P+     + +   ENT    +++   +  D DS      R   +Q  +++V   F +D   L  L K LDRE   ++   ++  D    G       A V + V D ND  P F   +   +   +  H     V+G V A   D G N  V+Y ISK   D       L   TG +++ S    E+    +  + + A+D G      PL+       +  + I ++DI
Sbjct:  157 RLSITVEDTNDNKPEFSNVSYSGTIPEN-IDVGTSILQVSASDKDIGT-NAEIQYSIETHSDPQAIF-----GIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGY-----FSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVG--DVNDCAP--KFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSP---------SGSPVVQLLAQDPDIGENSLILYSILTPNTP---FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENT-RIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV---FSVDGSGLITLAKLLDRETQDNYLLTVKAVDG---GGQDSVNKAIVNITVLDVNDEPPIF---SKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDN----IVLINSTGTLYLQSEVDHEKIP--SLYLTVQAKDKGTP----PLF------GYANVTIAVIDI 800          

HSP 6 Score: 128.257 bits (321), Expect = 9.900e-30
Identity = 184/758 (24.27%), Postives = 310/758 (40.90%), Query Frame = 3
Query:  297 KVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKL-NIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPN-----------LLLLNALDCETKHHYILDLLANDGAGKEGRVLIH---VKVI--DINEYAPEF-SRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYD--SAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFY------QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEIS---SFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFI-FPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKN 2471
            K++    +  F ++++   I  ++ +D E +   V   +  D               K+    +Y+L  I++ED ND  P F +       YE          +PI           + T + H  + G N  ++ Y   SQ+P            +   + +D E    Y L + A D A  E   L +   +K+I  D+N+ AP+F SR L     V E       +  + A D D     N+ +++ S +  +    F+++L  G LK+IG LDYE    Y++ I A D  S P++     S+ L   ++   ++ P  +F  +    T+ EN+P  + V  +   DRDS  N E+T               +DKF        I +N + DRE+ D YF+ +       P   +S ++ + + D ND  P+F+S      V ENSP     T +      +Q +D+    ++ + I     S N      I + +G L     +DRE    Y+L V   D     +    +I + +ED+NDN P+    L+  T+ E T     ++L    SD DS + G  V    + S D    + +D  +  +  S  R E S    + F     D+   G         V +K+ D+N+++P+F   P   H   N S    +  V       D D   NG V Y +         +LF ++ +TG +  ++ F +    R    I+  AED G+  ++ 
Sbjct: 1262 KIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATD-------------MGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYEN---------VPI--------NTNVTTIKAHDDDSGLN-SRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY---VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK----FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLT-----SYQLFNVVVVDVNDNPP-EFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVE-------MDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLT------VQDLDYGNNTKVLYSI----MSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPP-GTSILNLTASDKDSGSNGNIV---YTLSNDTYGVYSIDS-RTGIVYSAARFETSIKQEYNFFCIAKDQ---GQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTAT--DADTDKSTNGKVTYRLDD--SKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYII--AEDHGSPPLRG 1944          

HSP 7 Score: 116.316 bits (290), Expect = 4.982e-26
Identity = 143/524 (27.29%), Postives = 230/524 (43.89%), Query Frame = 3
Query:  747 LDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQ--NGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNN-FRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAG--AIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYD-RALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPD 2279
            LD ETK  Y L + A D          ++ +   D N+  P F + L SS ++ E T  GT I +L A+D D+  N NI + L +    +T   ++++   G +      +   ++ Y+   IA D     + K +   + I I D N++ P+  F     +  I  N   S+ VT +  TD D+++  NG+VT R   S+N   L  +      + ++  F      R+ + II  DHG P L     + ++I +  D  P+FL+    R S+ ENS   + +T      S    + + II            S N      +D ++GV+ VA   A+D E T  +RL +       V       + ++V D NDN+P  +       + E+T  +  R ++    +D+DS   G +V++   T  +    F +D    ++   K LDRE  +SF  VI+ +D    G     T  +V V V+D NDN P F  P S    +N+      G VV  V A D D
Sbjct: 1708 LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSS-TISELTPPGTSILNLTASDKDSGSNGNIVYTLSN----DTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQG--QDPKMAIVPVRIKIEDKNNHAPQ--FTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSII------------SGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNG-KVTYSIWTGNEA-GVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDS---GIPPKSTNCQVKVVVTDLNDNPPLF-DPLSE---VNIREDTRTGAVVTSVVATDTD 2201          

HSP 8 Score: 109.383 bits (272), Expect = 6.287e-24
Identity = 80/280 (28.57%), Postives = 142/280 (50.71%), Query Frame = 3
Query:  747 LDCETKHHYILDLLAND--GAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQ-IESNKVFDRE--EIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENS 1565
            LD ETK  ++L + A D     K  RV +++ V D+N+  P F    +S +     E    GT++ ++ A D D+  N  + F ++S    +   +FA++   G ++    LD+E  K + +++ A D    S    +  S+TI ++D+NDN P  +    N    + EN P++S +  +  TDRDS  N  ++   +    +     L+DKF   + +N  FD E   + +Y + I   D G+P LS+++T+ V + DE++ DP F   +++F V  N+
Sbjct: 2365 LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFG---QSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQS---GDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEG--SPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVL-ENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLF--LIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNA 2633          

HSP 9 Score: 92.8189 bits (229), Expect = 7.480e-19
Identity = 158/669 (23.62%), Postives = 278/669 (41.55%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKK-NRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGE--LDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT--DRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQF--LSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQID------------KYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD--IYVDVEDENDNTP----ILYTDL-------FQLT-----VEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQ-ISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            + I IED N+  P F +  Y V  +    +     ++  A D D  K  N  +TY++  S    +LF +     S   ++          +  + L ++A D       G  ++ + + +I +  P F  +  +  S+ E++  G+ I  ++A    A  +  +T+ + S N       F ++   G + V     LDYE  K + + ++A     +S   +    L I++ID NDN P   F   N  + + E+     P   +K+T  D DS  NG+VT   + + N   +  +     +I + K+ DRE    + + I   D G P  ST+  + V++ D ND  P F  LS     +++E+       T +   ++ +   D D    LT+ +  K  S    +++++             KYS  +  +  ID ++  +  + +    +I V   D  I + V+  +   P    ++Y  +       F+L      V EN +    ++LT R +D  +     R+S++   S     YF++      + + K LD E    F  V+  I D  P    ++     V++ VSD ND  P F     + ++   S   P+G +V  V A D D G NG V + I       D   F +DR TG I
Sbjct: 1840 VRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMV-TATDADTDKSTNGKVTYRLDDSKNSTSLFVV----ESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRA---FYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVS--LNGYMILDINVIDRNDNSP--AFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYS-IWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLS---EVNIRED-------TRTGAVVTSVVATDTDKESRLTYNL--KSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGV-ISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAM-MGTSVLTVRVTDNAAGLPLGRISYNIENS----NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRV----PVYINVSDVNDEKPVF---GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQS---GDDKGSFAIDRKTGVI 2464          

HSP 10 Score: 88.9669 bits (219), Expect = 1.043e-17
Identity = 163/707 (23.06%), Postives = 283/707 (40.03%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATD--NDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS-ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP-----FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS-IHVVCTD--IYVDVEDENDNTPILYTDLFQLTVEENT-------------------INYDR--------ALLTFRPSDLDS-TNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSF-QFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNN-GTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLY 2480
            + IFIED ND  P F+Q  Y     E     G   L   A DKD S  N  I Y +     G      +Y   S+   +      +   K  Y    +A D     K   V + +K+ D N +AP+F+   K+ + VH   +T    ++  + ATD   D   N  +T++L+   N+ +   F +  + G ++         Q  +++ IIA D      R      + I   ++ D+ P     T  + S I EN  + S +T ++     ++ + +VT   +   + R F          + S    D E    + ++++    G  SL+  + L + + D ND  P F  +N    + E++      F   +T ++        +D    G++T+ I     + N   V  ID  +G +  A  +DRE T  + L +   DS I    T+  + V V D NDN P L+  L ++ + E+T                   + Y+         A+L    +D DS +N   + SF  + S+ +      D   +  R+++D     SF Q  +Q  D+       L     V+V++    +  PKF  P+   +   V  +  +G  V  V+  D   G   G + Y I      ++ N F + + +G I +N P   E   RF  ++    +   ++ V+ P+Y
Sbjct: 1736 ITIFIEDQNDNPPVFQQSLYSSTISE-LTPPGTSILNLTASDKD-SGSNGNIVYTLSNDTYG------VYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFT---KTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSL--FVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIG--NIQDDPPRFLNQTPARVS-IPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATD--------VDSGTNGKVTYSI----WTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP-LFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL-----VYVRIIITRE--PKFELPS---YFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI------ENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVY 2394          

HSP 11 Score: 88.1965 bits (217), Expect = 1.701e-17
Identity = 119/477 (24.95%), Postives = 202/477 (42.35%), Query Frame = 3
Query: 1068 LDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVF-------DREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND--SIHVVCTDIYVDVE--DENDNTPILYTDL-----FQLTVEENTINYDRALLTFRPSDLDSTNTG-FRVSFDQSTSEDVLKYFKL-DHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKD-LNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMI 2435
            LD EK   Y++TI+ + + P       S+++ + + D+NDN P     T + K  + EN            +D  SN     T       N F L    D    + ++ V        DRE +D Y +NI   D G+P+    + L++ +ED ND  P+F + ++  ++ EN    T++        ++   D DI    E+ + I+   T  +  ++  I   +GV+     +D E    Y + V   D  S H + +   V +E  D NDN P+++        +Q+T E  TI    A ++   SD DS   G   V+ +       +K+  L D   + + +SLDRE    F       DK   G+    T     + V D ND +PKF   +   +   V  +  +  +V  V A D D G+N  ++Y I+     +  L+ F +D  +G I   +    EQ  +    +++
Sbjct:   20 LDREKVSAYNLTIVEFSTPP------KSYTVLVYVQDLNDNSPSFVRGT-SAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSIL-------QVSASDKDIGTNAEIQYSIE---THSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVT-ENATIGTQVARVSV--SDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDK---GDPPRTTEKSFRINVGDVNDCAPKF---DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLV 470          

HSP 12 Score: 81.2629 bits (199), Expect = 2.074e-15
Identity = 153/642 (23.83%), Postives = 256/642 (39.88%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPI-AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITI---IAYDSAPISERKSSSFSLTISIIDV-----NDNYP--------------ELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF---LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVCTDIYVDVE--DENDNTPILYT-DLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFD--QSTSEDVLKYFKLDHDKLYLRKSL--DREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIY 2306
            L+I + D ND +PAF       +  E   +   + ++ + A D D S  N  +TY I   N    +F +     S    +     LD ET   + L +   D     K     + V V D+N+  P F  +  S  ++ E T  G V+  + ATD D    + +T+ L+S +    A    ++  + D     ++ Y      S  I   I  D+  IS R++    +  S I +     +   P              E KF+  +    + EN  + + V  +++TD   N  G    R    +++ N F +     +   I  NK  D E   R+ + +   D   PS    V + + + D ND+ P F  + +     E  P  T + N       +   D D    G + F I    + D+  S   ID+ +GV+    A+D E    + + V   D     + TD+ V +   D NDN P+        + V EN +  +  L     +D DS     R+SF     T + +   F +D    +L  ++  D E  + +Q+ + I      GN  L +   + V V+D+++  P F   N   +  +V  +  IG  VG+V A D D G+ G V +
Sbjct: 2053 LDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVD-SGTNGKVTYSIWTGNEA-GVFTI----DSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF--DPLSEVNIREDTRTGAVVTSVVATDTDK--ESRLTYNLKSASTPGIA-ILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTD---NAAGLPLGRISYNIENSNYFRIG---QRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVN-------VSAADKDSGANGRVWFAI---QSGDDKGS-FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLEN-LPLNSRLYEINATDRDS-GANARLSFTVIGGTGQGL---FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATD-AGNPPLSSNITIIVNVADEDEYDPSF---NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 13 Score: 59.3066 bits (142), Expect = 1.242e-8
Identity = 73/298 (24.50%), Postives = 131/298 (43.96%), Query Frame = 3
Query:  438 KFVFLIRIFEKQASILTYKLNIFI--EDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCET-KHHYILDLLANDGAGK-EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKI--YSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEV 1313
            +F+ ++   +  A     ++ ++I   D+ND  P F Q  Y  ++ EG   VG   +   A DKD S  N  + + I     G +      D  +    +    ALD ET K H++     ++G+      V + ++V+D+N+  P F     +   V E+    + +  + ATD D+  N  ++F   ++        F ++  +G L      DYE   +  YS+TI A D+   +   SS+ ++ +++ D ++  P   F+  + K  +  N  I   V  +  TDRDS   G V
Sbjct: 2372 RFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEG-IPVGTIVVNVSAADKD-SGANGRVWFAIQ---SGDDKGSFAIDRKTGV--IRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSF---TVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAG--NPPLSSNITIIVNVADEDEYDP--SFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRV 2655          
BLAST of Protocadherin delta 1 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 203.756 bits (517), Expect = 4.348e-53
Identity = 196/697 (28.12%), Postives = 309/697 (44.33%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP--ELKFDTENQKSTI--RENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + +       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F RE +    + E++  GT +  LQATD D  PN  I +   +  +  T   FA+N  +G + V   LD E+  I+ ++++A D +    R +    + I++ DVNDN P  +L++       T+   E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TTL+ ++    K   I + +    +FF               +D+ +GVL  +   DRE  + +   V   D+          + V V DENDN P    + FQ  V EN   Y    ++T   SD    N    +S        +L  F      +    S DRE+ SS+ F ++  D    G     + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDAECSFEIEVVVLPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELI---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARAT----VIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDA-GENAAISLSILNDNENFILDPFS---GVIKSNVSFDREQQSSYTFDVRAIDS---GRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSSIPGSVVAEVFAVDSDTGMNAELKY---TIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 58.9214 bits (141), Expect = 3.490e-8
Identity = 105/383 (27.42%), Postives = 160/383 (41.78%), Query Frame = 3
Query:  216 TLFLKENSPINTTIDIPVFNDK-LFPNIKVIGDGF---NQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPI-SSPVTFLKITDRDSNQNGEVTCRFLKSENR 1343
            T+FL E  PINT I +   +DK    N KVI   F   +  FHL     K V   Q  LE S L  +     +   +  F  +     K +   T  + + +ED ND  P F Q    +   E  K       L  A D+D S KN  I YQ+     G N     +D   +   L      D E +  ++  + A D      + +  + V V+D N+  P+F+      F V E+  K + +  +  TD+DA  N  I+  +  LN+ E    F ++  +G +K     D E+Q  Y+  + A DS       SS+  +TI++IDVNDN P + +   N    +     I  S V  +   D D+  N E+    +   N+
Sbjct:  369 TVFLSEKDPINTKIALITVSDKDTDINGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSALLDY-----EGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLS-ATDED-SGKNAEIVYQL-----GPN--ASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHN-HFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSI--LNDNE---NFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSG--RPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNK 722          
BLAST of Protocadherin delta 1 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 203.371 bits (516), Expect = 9.242e-53
Identity = 196/697 (28.12%), Postives = 309/697 (44.33%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP--ELKFDTENQKSTI--RENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + +       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F RE +    + E++  GT +  LQATD D  PN  I +   +  +  T   FA+N  +G + V   LD E+  I+ ++++A D +    R +    + I++ DVNDN P  +L++       T+   E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TTL+ ++    K   I + +    +FF               +D+ +GVL  +   DRE  + +   V   D+          + V V DENDN P    + FQ  V EN   Y    ++T   SD    N    +S        +L  F      +    S DRE+ SS+ F ++  D    G     + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDAECSFEIEVVVLPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELI---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARAT----VIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDA-GENAAISLSILNDNENFILDPFS---GVIKSNVSFDREQQSSYTFDVRAIDS---GRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSSIPGSVVAEVFAVDSDTGMNAELKY---TIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 58.9214 bits (141), Expect = 3.586e-8
Identity = 107/393 (27.23%), Postives = 164/393 (41.73%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFP-NIKVIGDGF---NQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPI-SSPVTFLKITDRDSNQNGEVTCRFLKSENR 1343
            L  ++S    T+FL E  PINT I +   +DK    N KVI   F   +  FHL     K V   Q  LE S L  +     +   +  F  +     K +   T  + + +ED ND  P F Q    +   E  K       L  A D+D S KN  I YQ+     G N     +D   +   L      D E +  ++  + A D      + +  + V V+D N+  P+F+      F V E+  K + +  +  TD+DA  N  I+  +  LN+ E    F ++  +G +K     D E+Q  Y+  + A DS       SS+  +TI++IDVNDN P + +   N    +     I  S V  +   D D+  N E+    +   N+
Sbjct:  359 LRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSALLDY-----EGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTL-SATDED-SGKNAEIVYQL-----GPNAS--FFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHN-HFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSI--LNDNE---NFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSG--RPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNK 722          
BLAST of Protocadherin delta 1 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 202.986 bits (515), Expect = 1.264e-52
Identity = 196/697 (28.12%), Postives = 309/697 (44.33%), Query Frame = 3
Query:  423 ENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQA---PNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYP--ELKFDTENQKSTI--RENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSP---FHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHV---VCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR-ALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNS-THFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            E+ +C F   + +       L  K+ I ++D ND  P F      +   E    +  +  +P A D D +  N +  Y++     GQ+ F L    T +    P L++   LD E K  Y++ +   DG    K    ++ V V D+N+  P F RE +    + E++  GT +  LQATD D  PN  I +   +  +  T   FA+N  +G + V   LD E+  I+ ++++A D +    R +    + I++ DVNDN P  +L++       T+   E  PI++ +  + ++D+D++ NG+V C F++ +  F L  + D  Y +E++ + D E    Y   I+  D G PSL+ +  + V +EDEND  P F       +V EN+    F TTL+ ++    K   I + +    +FF               +D+ +GVL  +   DRE  + +   V   D+          + V V DENDN P    + FQ  V EN   Y    ++T   SD    N    +S        +L  F      +    S DRE+ SS+ F ++  D    G     + AKV + V D NDN+P  I+P S T F L V      G VV +V A D D G N  + Y    I+   +  LF +D  TG I +              ++ IS  DLG  K
Sbjct:  104 EDAECSFEIEVVVLPNDYFRL-IKIKIIVKDTNDNAPMFPSPVINISIPEN-TLINSRFAIPSATDPD-TGPNSVHKYELI---NGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARAT----VIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVIC-FIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFF--------------DLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDA-GENAAISLSILNDNENFILDPFS---GVIKSNVSFDREQQSSYTFDVRAIDS---GRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKL-VPLSSIPGSVVAEVFAVDSDTGMNAELKY---TIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNIS--DLGYPK 761          

HSP 2 Score: 58.5362 bits (140), Expect = 4.386e-8
Identity = 107/393 (27.23%), Postives = 164/393 (41.73%), Query Frame = 3
Query:  186 LNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFP-NIKVIGDGF---NQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK--EGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPI-SSPVTFLKITDRDSNQNGEVTCRFLKSENR 1343
            L  ++S    T+FL E  PINT I +   +DK    N KVI   F   +  FHL     K V   Q  LE S L  +     +   +  F  +     K +   T  + + +ED ND  P F Q    +   E  K       L  A D+D S KN  I YQ+     G N     +D   +   L      D E +  ++  + A D      + +  + V V+D N+  P+F+      F V E+  K + +  +  TD+DA  N  I+  +  LN+ E    F ++  +G +K     D E+Q  Y+  + A DS       SS+  +TI++IDVNDN P + +   N    +     I  S V  +   D D+  N E+    +   N+
Sbjct:  359 LRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVI--CFIEKDVPFHL-----KAVYDNQYLLETSALLDY-----EGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTL-SATDED-SGKNAEIVYQL-----GPNAS--FFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHN-HFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSI--LNDNE---NFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSG--RPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNK 722          
BLAST of Protocadherin delta 1 vs. Ensembl Medaka
Match: FAT4 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101165038])

HSP 1 Score: 202.216 bits (513), Expect = 6.149e-52
Identity = 212/737 (28.77%), Postives = 334/737 (45.32%), Query Frame = 3
Query:  312 GFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFE-KQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDF-SKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLN----------ALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPI-SERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII----GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQK 2462
            G +  F +D     ++  K++D E                  K+  L+R  + KQ+S +  +LNI ++D+ND TP F +  Y  +    P+ V    ++ + +  D  S+ N  + Y +   +          DGT       LLN          ALD ET+ +YIL   A+DG G    V ++  V+DIN+  P FS    S+ SV ES   G+ I  ++A+D D   N  + +K+ S    +    F +    G L+    LD E Q  Y++ I   D AP  + R +S+  ++I ++DVND  P     T  + + I+EN P+ + V   + TD DS  N  V           F+ G +D   ++      DREE+  Y V ++  D G P LS+S+ +T+++ D ND  P F  N +   V+EN      LT    G   IQV   D      G++ F I    +S N  S  +ID  +GV+ VA  +DRE  + Y L V   D   S  V    + + + D ND +P+     + + V+EN  N  + +L     D D      ++S+  S  ++   +      +L + K+LDRE  + +  +I  +D    G+  L  T  V V V D NDN P F   +S+ F   ++   P G  V  V + D D+G NG V Y +S          F ++  TG+I I+S  L  +  R N+ +++ A D G  K
Sbjct: 1761 GADDSFRIDPESGDLIATKKLDRERRS---------------KYSLLVRADDGKQSSDM--RLNITVKDVNDHTPKFSRPTYSFDI---PEDVTPGSIVEVILASDSDSELNGEVNYSLEEDD---------EDGT------FLLNPVTGVFNVTRALDYETQRYYILTAKAHDGGGLASTVRVYFNVLDINDNPPVFSSSAYST-SVSESLPPGSSIVTVEASDGDDGANAQLLYKIAS---GDPQGHFVIT-KEGVLQTQKALDRESQSFYNLVITVNDLAPPPAARFTSTAQVSIILLDVNDCPPIF---TSQKTTYIQENTPVDTVVFTAQATDADSGPNSYVEYSLRGQHQNKFIIGTVDGDVRLIGE--LDREELSNYTVTVVATDKGVPPLSSSMDVTMIVLDVNDNTPSFSQNIYDIEVEEN-----ILT----GTDVIQVFASDADDGSNGQIRFSI----SSGNTNSDFRIDSVTGVISVAKRLDRETRSAYSLVVQAADRGSSPRVDHATVNIVLLDVNDCSPLFELSPYTINVQENLENLPKDILQVVARD-DDQGANSQLSYMLSGGDEEGAFTLSSAGQLSVTKTLDREFGAEYTLLITATDS---GSPALSGTGTVTVLVDDVNDNVPVF---SSSTFHTTIAEDAPTGTDVLLVNSSDADVGINGAVSYRLS-----GGHGQFSINPATGQI-ISSALLDREE-RANYQLLVVATDGGQPK 2425          

HSP 2 Score: 178.718 bits (452), Expect = 1.315e-44
Identity = 188/649 (28.97%), Postives = 289/649 (44.53%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKN-RMITYQIHFSNGGQNLFQLLY----DGTSQAPNLLLLNALDCETKHHYILDLLAND-GAGKE-GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELK---FDTENQKSTIRENQPISSPVTFLKITDRDS-NQNGEVTCRFLKS-ENRFF--LNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTS-VTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKLD--HDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            ++ I + D+ND +P F      V F E   S G++ +L  A D D         TY+I   N  Q  F+L       G     +L+    LD E    Y L +   D G  K+ G + ++V + DIN+  P F ++   S SV E    G+ I  + A+D D   N  I + L+          F ++   G + +   LD+E +K YS+TI A D    S   S     TI ++DVNDN P +K   F T ++ +++ EN  I + V  L ++D DS + NG ++   L   E R F      +     I+   + DRE I  Y + +   D+G P   +S  +L + + D ND  P F    +R  + E+ P  + +     G+S     D      L + +     S N+     I   SG++  A  +DRE+ +E  L +   D      +  T + V + D ND  P      + +++ E+       LL    SD D   N   R SFD  T   + + F+LD    +L     LDRE+ +S+   I+ +D    G+  L +  +V + + D NDN P F +P    +  +V  +EP G  V  V A D DLG NGTV Y IS      D   FH+  +TG+I
Sbjct:  105 EVRIVVLDMNDNSPVFPDASIVVSFKED-ASRGRQVILDTATDADIGSNGVDHTTYRIVEGN-EQRKFRLDITVNPSGEGAFLHLVSTGGLDRELTPFYQLLIEVEDKGVPKKFGYLQVNVTIQDINDNPPVFEQDQYHS-SVFEDAAVGSSILQITASDQDEGANAEIRYILDE------GTPFQIDPKTGTIVIKESLDFESKKEYSLTIHAADKGVPS--LSGRTETTIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSPSANGNISVSILGGNEQRHFEVHKSTVPNLSLIKVASLLDRERISSYNLTVSVSDNGRPMARSSFASLVIFVNDINDHPPIFQEELYRVDISEDIPKGSYI----KGVSATDG-DSGQNANLRYSL----VSGNSLGWFSISDNSGLVTSAALLDREVASEIVLNISAKDQGLQPKISYTKLIVSITDVNDQVPTFTQSTYHVSLLEHA-PAGTELLVLSASDSDLGPNGTIRFSFDAETPASLRELFRLDAVSGRLSTAVELDREDQASYLLHIRAADA---GSPPLHSVGRVNITLWDINDNRPVF-YP--VQYFASVKENEPPGSYVTTVLASDRDLGRNGTVKYVISS----GDTTKFHIHSNTGKI 722          

HSP 3 Score: 154.066 bits (388), Expect = 3.809e-37
Identity = 183/677 (27.03%), Postives = 306/677 (45.20%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVI--DINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYE---KQK---IYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS--ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFH-----TTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILY-TDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLK--YFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            L I + D+ND +P F Q  Y V   E  + V  +     A DKD S  N  I Y I   N G ++F +  DG      L +   LD E +  Y L ++A D A +     ++V VI  D+N+  P F+      F   E   +G+++  + A D D  PN+ I +  E+       + F +N   G+L    +LD E   +Q+   + S  +++ D   P   R  +   + + I D+NDN P  KF  +  +++I E+ P  + +  +  +D D ++NG V     +   E +F ++       Q+      D E    Y + II  D GD  LS+S  L++ I DEND  P F  ++    V EN          T T++++G +           ++T+ I    T+ N      I   +G +++   +D E  + Y+L +   D+     +    + V V D NDN P+    D+F+ ++ EN +    ++LT    D D+   G     + S  + V +  YF +D     +Y  K +DRE  + F+  ++ +D+      + F    V + V+D NDN P F+  N+     N+     IG ++  + AFDPD   NG V YE    L + D + F +DR++G+I + S  +     R  + + +SA D G
Sbjct:  958 LIISVYDVNDNSPMFDQLSYEVIILES-EPVNSRFFKVEATDKD-SGLNGEIMYDIAGGNTG-DMFGIFPDG-----QLYIKAELDREVQDRYNLVVVAKDRAVEPLSASVNVTVILDDVNDNRPLFN-STNYVFHFKEEQQRGSLVGQVFAEDKDFGPNSEIRYSFET-----PQHNFELNTITGELTSTLKLDRESLMRQRGTAVLSFVVVSSDQGLPRPLRDQAK--VQVYIQDINDNPP--KFTKDIYQASISESAPNMTQLLRVSASDVDESKNGVVHYHIAEGNEEAQFTID---SSSGQVTLVGKLDYESSSSYLLKIIADDAGDVPLSSSCMLSISILDENDNSPSFPKSSLSVDVLENMRIGDLVVSVTATDADSGQN----------ADITYSI----TAINNHGTFSISPNTGSIFLVKKLDYETQSFYKLNITAKDNGRPARSSSIPVVVYVRDFNDNPPVFAPGDIFK-SIPEN-LPVSASVLTITAHDTDADING---QLEYSIVQQVPRGNYFGIDPSSGLIYTSKEIDREFSNLFELTVKATDQAVPVEFRRFALKNVTIWVTDLNDNFPTFVSQNALVAEPNIV----IGSILTTLVAFDPDDEANGEVEYE----LVEGDSDTFIMDRYSGDIRLASQLVP---SRLMYTLTVSATDHG 1583          

HSP 4 Score: 143.665 bits (361), Expect = 6.500e-34
Identity = 181/624 (29.01%), Postives = 278/624 (44.55%), Query Frame = 3
Query:  492 KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGT-----SQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAP----EFSRELKSSFSVHESTVKGTVIAHLQATDNDA-YPNNNITFKLESLNNAETANTFAMNLHNGDL-KVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRF-LKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHG-DPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDII--GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS----IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL--NVSCHEPIGHVVGKVQAFDPDLGNN 2291
            ++N+ I+DIND  P F+Q QY+   +E   +VG   L   A D+D    N  I Y             +L +GT      +   +++  +LD E+K  Y L + A D       GR    +K++D+N+  P     +        SV E+   GTV+A L  +D+D+   N NI+  +   N           + N  L KV   LD E+   Y++T+   D+  P++  +SS  SL I + D+ND+ P   F  E  +  I E+ P  S +  +  TD DS QN  +  R+ L S N      + D    + S  + DRE      +NI   D G  P +S +  L V I D NDQ P F  + +  S+ E++P  T L         +   D D+   G + F  D   T  +   + ++D  SG L  A  +DRE    Y L +   D+    +H V   + + + D NDN P+ Y   +  +V+EN       + T   SD D    G  V +  S+ +    +   +  K+    +LDREE +++Q  ++ +D    G     T A V V V+D  DN P F   N + FV+  NVS     G V+G V A   DL +N
Sbjct:  220 QVNVTIQDINDNPPVFEQDQYHSSVFED-AAVGSSILQITASDQD-EGANAEIRY-------------ILDEGTPFQIDPKTGTIVIKESLDFESKKEYSLTIHAADKGVPSLSGRTETTIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSPSANGNISVSILGGNEQRHFEVHKSTVPNLSLIKVASLLDRERISSYNLTVSVSDNGRPMA--RSSFASLVIFVNDINDHPP--IFQEELYRVDISEDIPKGSYIKGVSATDGDSGQNANL--RYSLVSGNSLGWFSISDNSGLVTSAALLDREVASEIVLNISAKDQGLQPKISYT-KLIVSITDVNDQVPTFTQSTYHVSLLEHAPAGTELL-------VLSASDSDLGPNGTIRFSFD-AETPASLRELFRLDAVSGRLSTAVELDREDQASYLLHIRAADAGSPPLHSVGR-VNITLWDINDNRPVFYPVQYFASVKENEPP-GSYVTTVLASDRDLGRNG-TVKYVISSGDTTKFHIHSNTGKITTLVALDREEKTAYQLQVRATDG---GGLSSHTHAFVTVTVTDTQDNPPVFSQENYS-FVMFENVSP----GTVIGTVSATTVDLNSN 802          

HSP 5 Score: 141.354 bits (355), Expect = 3.477e-33
Identity = 193/768 (25.13%), Postives = 321/768 (41.80%), Query Frame = 3
Query:  225 LKENSPINTTIDIPVFNDKLFP---NIK-VIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIE----DINDWTPAFKQRQYYVEFYE--GPKSV-GQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD------------IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSP--FLSEQFCRFNFIIMISAEDLG 2453
            +KEN P  + +   + +D+       +K VI  G    FH+  +  KI  +  +D E+                 K  + +++       L+   + F+     D  D  P F Q  Y    +E   P +V G      + +       N  I+Y I  S   + LF +   G   A +L+     D E K  Y L ++A  G    G   +++ V D+N+ AP F    +   +V E+   G +I   +A+D D   N  + + L+          F ++  +G + + G L       Y + + A D      +++SS SL IS+ DVNDN P   FD  + +  I E++P++S    ++ TD+DS  NGE+                 D    I++    DRE  DRY + ++  D     LS SV +TV+++D ND  P F S N+ F  KE             G    QV   D   +     + +++ +      +++  +G L     +DRE  +  R R     S  VV +D            + V ++D NDN P    D++Q ++ E+  N  + LL    SD+D +  G         +E+          ++ L   LD E  SS+   I   D    G+  L ++  + + + D+NDNSP   FP S+   ++V  +  IG +V  V A D D G N  + Y I+ I    +   F +  +TG IF+     + ++ F + N    I+A+D G
Sbjct:  675 VKENEPPGSYVTTVLASDRDLGRNGTVKYVISSGDTTKFHIHSNTGKITTLVALDREE-----------------KTAYQLQVRATDGGGLSSHTHAFVTVTVTDTQDNPPVFSQENYSFVMFENVSPGTVIGTVSATTVDL-------NSNISYLIT-SGDQRGLFAVNGAGQITASSLI-----DREEKGFYQLKVVARAGE-ITGEAFVNITVRDLNDNAPRFLHAAEHVSAV-ENWSTGHIIFQAKASDPDEGLNGVVVYSLKE----NPKGLFHIHEKHGLITLTGSLKASTNS-YEVEVTASDMG--VPQRTSSLSLIISVYDVNDNSP--MFDQLSYEVIILESEPVNSRFFKVEATDKDSGLNGEIMYDIAGGNTGDMFGIFPDGQLYIKAE--LDREVQDRYNLVVVAKDRAVEPLSASVNVTVILDDVNDNRPLFNSTNYVFHFKE---------EQQRGSLVGQVFAED--KDFGPNSEIRYSFETPQHNFELNTITGELTSTLKLDRE--SLMRQRGTAVLSFVVVSSDQGLPRPLRDQAKVQVYIQDINDNPPKFTKDIYQASISESAPNMTQ-LLRVSASDVDESKNGVVHYHIAEGNEEAQFTIDSSSGQVTLVGKLDYESSSSYLLKIIADDA---GDVPLSSSCMLSISILDENDNSPS--FPKSS-LSVDVLENMRIGDLVVSVTATDADSGQNADITYSITAI---NNHGTFSISPNTGSIFLVKKLDYETQSFYKLN----ITAKDNG 1372          

HSP 6 Score: 138.658 bits (348), Expect = 2.258e-32
Identity = 174/664 (26.20%), Postives = 284/664 (42.77%), Query Frame = 3
Query:  441 FVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR-----VLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELK---FDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIES-NKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIG--ELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTD---IYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDK-HPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            ++   +  +      T ++   + DIND  P F    Y     E     G   +   A D D    N  + Y+I  S   Q  F +  +G  Q        ALD E++  Y L +  ND A            + + ++D+N+  P F+ + K+++ + E+T   TV+   QATD D+ PN+ + + L      +  N F +   +GD+++IGELD E+   Y++T++A D    P+S    SS  +T+ ++DVNDN P      +D E     + EN    + V  +  +D D   NG++  RF  S      +  +D    + S  K  DRE    Y + +   D G        T+ +++ D ND  P F  + +  +V+EN      L N    + ++   D D     +L++ +         T        +G L V   +DRE   EY L +   DS     +    + V V+D NDN P+  +  F  T+ E+       LL    SD D    G  VS+  S        F ++     +  S  LDREE +++Q ++  +D   P G   L ++A V V V+D NDN P+F   +   +V ++      G +V  V   D D G+N  + Y     L  ++   F +D   G I
Sbjct: 1891 YILTAKAHDGGGLASTVRVYFNVLDINDNPPVFSSSAYSTSVSESLPP-GSSIVTVEASDGD-DGANAQLLYKIA-SGDPQGHFVITKEGVLQT-----QKALDRESQSFYNLVITVNDLAPPPAARFTSTAQVSIILLDVNDCPPIFTSQ-KTTY-IQENTPVDTVVFTAQATDADSGPNSYVEYSLR----GQHQNKFIIGTVDGDVRLIGELDREELSNYTVTVVATDKGVPPLS----SSMDVTMIVLDVNDNTPSFSQNIYDIE-----VEENILTGTDVIQVFASDADDGSNGQI--RFSISSGNTNSDFRIDSVTGVISVAKRLDRETRSAYSLVVQAADRGSSPRVDHATVNIVLLDVNDCSPLFELSPYTINVQEN------LENLPKDILQVVARDDDQGANSQLSYMLSGGDEEGAFTL-----SSAGQLSVTKTLDREFGAEYTLLITATDSGSPALSGTGTVTVLVDDVNDNVPVFSSSTFHTTIAEDAPTGTDVLL-VNSSDADVGING-AVSYRLSGGH---GQFSINPATGQIISSALLDREERANYQLLVVATDGGQPKG---LSSSATVSVTVADINDNPPRF---HHHPYVTHIPASTAAGALVFAVTVTDEDAGSNAQLQYS----LMGRNAEKFKIDPVRGAI 2503          

HSP 7 Score: 138.658 bits (348), Expect = 2.396e-32
Identity = 169/610 (27.70%), Postives = 273/610 (44.75%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFS-LTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVT-CRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLST--SVTLTVLIEDENDQDPQFLSNNFRFSVKEN-SPFHTTLTNSNNGLSKIQVIDHDII---GELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIY---VDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK-LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDL 2282
            + I + + N  TP F Q Q      E   +VG       A DKD  + N +ITY I   N    +F L     S+   L L N LD E K  + L + A DG    K   V + ++V D+N+  P F  + +   +V E+   GT +  + ATD D+ PN  + + ++S +    ++ F ++ + G +   G LDYE +++Y +T+ A++   I +    SF+ + I +   N+  P  +F ++     + E  P  + V  +  +DRD  ++G V    F KS N+ F   +  K  QI    + DRE+ ++  + ++  + G    +    V + + I D ND  P F  + +   V E  SP         + ++ ++  D D +      ++FID + T +    +  I+  +G + VA  +DRE T  Y L V   D+     T I    V++ED NDN P L T   ++ +E        A LT    DL      F  S   S   +    F L     L   + +DRE+IS F   + I D    G  Q+ +T  V VKV+DQNDN  +   P S    ++       G  +G V+  DPD+
Sbjct: 3056 VRIAVTEENHHTPEFSQSQISATVPES-LAVGTAIRTVSAKDKD-KEMNGLITYNITSGND-NGVFML----NSKTGVLSLANPLDFEEKQQHELRVSAIDGGWIAKTSYVSVTIQVTDVNDNPPIFDPD-EYFPTVQENVPSGTTVVRMNATDRDSGPNAVMAYVIQSSD----SDLFVIDPNTGIITTQGFLDYEAKQVYHLTVKAFN---IPDEDRCSFANVNIQLKGANEYVP--RFVSKQYYFEVSEAAPKGTVVGEVFASDRDQGEDGVVYYLIFGKSRNKGF--SINKKTGQIYVTGMLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDANDP-PVFTQDLYDVQVSEGLSP--------GDLVTFVKADDSDSVPSWSRFSYFIDPELTKN----MFTINPKTGQVSVAAELDRETTPVYNLTVLAVDTGTPPATGIATVIVNLEDINDNGPTLTTTYAEV-MENQRAGTAVATLTASDPDLPPNQGPFLYSLMNSGPAN--NCFSLSSTGVLTTSQEIDREQISDFYLHVMIKDS---GVPQMSSTGTVHVKVNDQNDNPSE---PRSLEIFVHYFGSLFPGGFLGSVKPQDPDI 3624          

HSP 8 Score: 137.887 bits (346), Expect = 3.477e-32
Identity = 172/658 (26.14%), Postives = 282/658 (42.86%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEG-PKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNAL-DCETKHHYILDLLANDGAGKEGRVL---IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNK-------VFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIM 2432
            L IF+ DIND  P F++  Y V+  E  PK    K +   A D D S +N  + Y +   N       L +   S    L+   AL D E     +L++ A D  G + ++    + V + D+N+  P F++      S+ E    GT +  L A+D+D  PN  I F  ++   A     F ++  +G L    ELD E Q  Y + I A D+   S    S   + I++ D+NDN P   F      ++++EN+P  S VT +  +DRD  +NG  T +++ S      +G   KF+ I SN          DREE   Y + +   D G  S  T   +TV + D  D  P F   N+ F + EN    T        +  +     D+   +++ I    TS +   +  ++  +G +  +  IDRE    Y+L+V            + + V D NDN P        ++  EN  +    +   + SD D    G  V +    +   L +    H  + L  SL +   +S++  +  SD    G  Q  ++  + + V D NDNSP F   +   + + +   EP+     KV+A D D G NG ++Y+I+         +F      G+++I +    E   R+N +++
Sbjct:  439 LVIFVNDINDHPPIFQEELYRVDISEDIPKGSYIKGVS--ATDGD-SGQNANLRYSLVSGN------SLGWFSISDNSGLVTSAALLDREVASEIVLNISAKD-QGLQPKISYTKLIVSITDVNDQVPTFTQSTYH-VSLLEHAPAGTELLVLSASDSDLGPNGTIRFSFDAETPASLRELFRLDAVSGRLSTAVELDREDQASYLLHIRAADAG--SPPLHSVGRVNITLWDINDNRP--VFYPVQYFASVKENEPPGSYVTTVLASDRDLGRNG--TVKYVIS------SGDTTKFH-IHSNTGKITTLVALDREEKTAYQLQVRATDGGGLSSHTHAFVTVTVTDTQDNPPVFSQENYSFVMFENVSPGTV-------IGTVSATTVDLNSNISYLI----TSGDQRGLFAVNG-AGQITASSLIDREEKGFYQLKVVARAGEITGEAFVNITVRDLNDNAPRFLHAAEHVSAVEN-WSTGHIIFQAKASDPDEGLNGV-VVYSLKENPKGLFHIHEKHGLITLTGSL-KASTNSYEVEVTASDM---GVPQRTSSLSLIISVYDVNDNSPMF---DQLSYEVIILESEPVNSRFFKVEATDKDSGLNGEIMYDIAGGNTGDMFGIF----PDGQLYIKAELDREVQDRYNLVVV 1047          

HSP 9 Score: 132.88 bits (333), Expect = 1.236e-30
Identity = 180/736 (24.46%), Postives = 315/736 (42.80%), Query Frame = 3
Query:  327 FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYK----LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGR---VLIHVKVIDINEYAPEFS-----RELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA-PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRE-NQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVI----QIDKYSGVLYVAGAIDRELTNE------YRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            F +D S  ++ LV ++D E S                   +L++I    A  +       L+I I D ND +P+F +    V+  E  + +G   +   A D D S +N  ITY I   N     F +    +    ++ L+  LD ET+  Y L++ A D  G+  R   + + V V D N+  P F+     + +  +  V  S +  T+ AH    D DA  N  + + +  +      N F ++  +G +    E+D E   ++ +T+ A D A P+  R+ +  ++TI + D+NDN+P       +Q + + E N  I S +T L   D D   NGEV    ++ ++  F+        ++ S  V  R     Y + +   DHG    ++   LT+++E  +   P F    +   +KE  P  T + + N       V      G++ +FI    + ++    +     I ++SGV+  A  +DRE  ++      Y +    N       T++ + ++D NDN P+   D+  +T+EEN I+  + ++     D D            S ++D    F++D +   L   K LDRE  S +  +++  D     + +L  T K      D ND++PKF  P    +  ++      G +V  + A D D   NG V Y + +   D +   F L+  TG +F  +  L  +  R+ +I+   A D G 
Sbjct: 1234 FTIDSSSGQVTLVGKLDYESSS-----------------SYLLKIIADDAGDVPLSSSCMLSISILDENDNSPSFPKSSLSVDVLENMR-IGDLVVSVTATDAD-SGQNADITYSITAINN-HGTFSI----SPNTGSIFLVKKLDYETQSFYKLNITAKDN-GRPARSSSIPVVVYVRDFNDNPPVFAPGDIFKSIPENLPVSASVL--TITAH----DTDADINGQLEYSI--VQQVPRGNYFGIDPSSGLIYTSKEIDREFSNLFELTVKATDQAVPVEFRRFALKNVTIWVTDLNDNFPTFV----SQNALVAEPNIVIGSILTTLVAFDPDDEANGEVEYELVEGDSDTFIMDRYSGDIRLASQLVPSRL---MYTLTVSATDHGIDRKTSKTELTIILEGADG--PIFSQPKYITVLKEGQPPGTNVISLN------AVSPRGPKGKVEYFIVAVRSGESGGKAMGRLFSIGRHSGVIQTAAELDREQGSDLYVLDVYAIETDANQP-RTQRTEVEITLQDINDNPPVFANDVLDVTIEENIIDGFK-IMQLTAKDADEGPNALVTYTIISGADD---SFRIDPESGDLIATKKLDRERRSKYSLLVRADDGKQSSDMRLNITVK------DVNDHTPKFSRPT---YSFDIPEDVTPGSIVEVILASDSDSELNGEVNYSLEE---DDEDGTFLLNPVTG-VFNVTRALDYETQRY-YILTAKAHDGGG 1902          

HSP 10 Score: 118.627 bits (296), Expect = 2.484e-26
Identity = 186/753 (24.70%), Postives = 324/753 (43.03%), Query Frame = 3
Query:  450 LIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGK---EGRVLIHVKVIDINEYAPEFSRELKSSFSVH--ESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTL---TVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLT--------NSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAI--DRELTNEYRLRVCCND-SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDR--ALLTFRPSDLDSTNTGFRVSF--DQSTSEDVLKYFKLDHDKLYLRKS--LDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPI--GHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDI----PR----SYSAKITL-ITPRLILTVILS 2600
            L R    QA     K+ ++I+DIND  P F +  Y     E   ++   QLL ++       KN ++ Y  H + G +   Q   D +S    + L+  LD E+   Y+L ++A+D AG        ++ + ++D N+ +P F    KSS SV   E+   G ++  + ATD D+  N +IT+ + ++NN     TF+++ + G + ++ +LDYE Q  Y + I A D+      +SSS  + + + D NDN P   F   +   +I EN P+S+ V  +   D D++ NG++    ++   R    G+      I ++K  DRE  + + + +   D   P       L   T+ + D ND  P F+S N     + N    + LT        +  NG  + ++++    G+   FI              +D+YSG + +A  +   R +   Y L V   D  I    +   + +  E  + PI     +   ++E         +L    P         F V+    +S  + + + F +      ++ +  LDRE+ S   +V+ +       N       +V + + D NDN P  +F N    VL+V+  E I  G  + ++ A D D G N  V Y I     D     F +D  +G++        E+  R  + +++ A+D G Q             +  +L+IT+ D+    P+    +YS  I   +TP  I+ VIL+
Sbjct: 1162 LPRPLRDQA-----KVQVYIQDINDNPPKFTKDIYQASISESAPNM--TQLLRVSASDVDESKNGVVHY--HIAEGNEEA-QFTIDSSSG--QVTLVGKLDYESSSSYLLKIIADD-AGDVPLSSSCMLSISILDENDNSPSFP---KSSLSVDVLENMRIGDLVVSVTATDADSGQNADITYSITAINN---HGTFSISPNTGSIFLVKKLDYETQSFYKLNITAKDNG--RPARSSSIPVVVYVRDFNDNPP--VFAPGDIFKSIPENLPVSASVLTITAHDTDADINGQLEYSIVQQVPRGNYFGIDPSSGLIYTSKEIDREFSNLFELTVKATDQAVPVEFRRFALKNVTIWVTDLNDNFPTFVSQN-ALVAEPNIVIGSILTTLVAFDPDDEANGEVEYELVE----GDSDTFI--------------MDRYSGDIRLASQLVPSRLM---YTLTVSATDHGIDRKTSKTELTIILEGADGPIFSQPKYITVLKEGQPPGTNVISLNAVSPRGPKGKVEYFIVAVRSGESGGKAMGRLFSIGRHSGVIQTAAELDREQGSDL-YVLDVYAIETDANQPRTQRTEVEITLQDINDNPP--VFAND---VLDVTIEENIIDGFKIMQLTAKDADEGPNALVTYTIISGADDS----FRIDPESGDLIATKKLDRER--RSKYSLLVRADD-GKQS------------SDMRLNITVKDVNDHTPKFSRPTYSFDIPEDVTPGSIVEVILA 1844          

HSP 11 Score: 112.079 bits (279), Expect = 2.630e-24
Identity = 174/704 (24.72%), Postives = 297/704 (42.19%), Query Frame = 3
Query:  327 FHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTY--KLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLN-ALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFF-LNGLLDKFY-----QIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD-----IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH---VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDK--LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            FH+D+   ++ +   +D E    C+            K+V  I   ++     +   K+ I + D+ND  P F +  +  E  E      Q+ LL  A+D D    N  + Y I   N   N+F +      +A   +  N  LD E    Y L + A D     K   V + V+V+D+N+ AP FS+    S +V E+   G  +  +  TD DA  N    + L      ++   F++N + GD+ +   L+ E+   Y + + A+DS       + S  +TI I DVNDN P  +F   +      E   I S VT +   D D   NG++   F++S++ +F +N    + +     + +++       I+R+   +   D     L +  T+ + I D ND  P F S ++   V ++    T L         ++V+ HD     +  E+ + I    T  N++S   +DK SG + V  ++  E+   + + V   D  +      T + + V +EN +TP         TV E ++    A+ T    D D    G  ++++ ++  D    F L+     L L   LD EE    +  +   D    G     +   V ++V+D NDN P F   +   +   V  + P G  V ++ A D D G N  + Y    ++   D +LF +D +TG I
Sbjct: 2593 FHIDQLSGELSIRHPLDYE----CIQ-----------KYVLWIEARDQGFPPYSSYEKVEITVLDVNDNLPVFDKDPFNAEILENLPP--QQVLLVSAVDLD-KGSNGQLEYAIIDGNK-DNIFSI-----HRATGEIRTNRPLDREKVALYSLKVKATDRGSPPKSTSVKVLVRVLDVNDNAPRFSKIF--SATVAENAPVGYTVTRVTTTDEDAGSNAISRYSL-----TDSGLPFSINPNTGDITINRPLNREETDHYIVKVSAHDSG-----WTVSTDVTIFITDVNDNVP--RFTRPSYYLEYPELTEIGSLVTQVSAVDPDEGFNGKI-FYFIRSQSEYFRINASTGEVFVKQQLKYQNSTGASSLNINRHSFIVTASDRAVKPLISETTVILNIVDSNDNPPVFESLSYFTPVTKSVKVGTRL---------MRVVAHDEKDFGLNSEIEYLI----TGGNSSSKFVLDKTSGWITVFSSLVSEVNKIFLMNVTAKDKGNPPLSANTAVRIAVTEENHHTPEFSQSQISATVPE-SLAVGTAIRTVSAKDKDKEMNGL-ITYNITSGNDN-GVFMLNSKTGVLSLANPLDFEEKQQHELRVSAIDG---GWIAKTSYVSVTIQVTDVNDNPPIF---DPDEYFPTVQENVPSGTTVVRMNATDRDSGPNAVMAY----VIQSSDSDLFVIDPNTGII 3231          

HSP 12 Score: 108.997 bits (271), Expect = 2.549e-23
Identity = 128/491 (26.07%), Postives = 219/491 (44.60%), Query Frame = 3
Query: 1017 NTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDRE--------EISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFD-PDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGN 2456
            N F ++  +G+L +   LDYE  + Y + I A D        SS   + I+++DVNDN P   FD +   + I EN P    V  +   D D   NG++    +   N+  +  +     +I +N+  DRE++  Y + +   D G P  STSV + V + D ND  P+F S  F  +V EN+P   T+T       ++   D D          ++++  ++     I+  +G + +   ++RE T+ Y ++V  +DS   V TD+ + + D NDN P      + L   E T      +      D D    G    F +S SE    YF+++    ++++++ L  +         I+   F++  SD+       L +   V + + D NDN P F    S  +   V+    +G  + +V A D  D G N  + Y I+        + F LD+ +G I + S  +SE      F++ ++A+D GN
Sbjct: 2591 NAFHIDQLSGELSIRHPLDYECIQKYVLWIEARDQG--FPPYSSYEKVEITVLDVNDNLP--VFDKDPFNAEILENLPPQQ-VLLVSAVDLDKGSNGQLEYAIIDG-NKDNIFSIHRATGEIRTNRPLDREKVALYSLKVKATDRGSPPKSTSVKVLVRVLDVNDNAPRF-SKIFSATVAENAPVGYTVT-------RVTTTDEDAGSNAI----SRYSLTDSGLPFSINPNTGDITINRPLNREETDHYIVKVSAHDSGWTVSTDVTIFITDVNDNVPRFTRPSYYLEYPELT-EIGSLVTQVSAVDPDEGFNGKIFYFIRSQSE----YFRINASTGEVFVKQQLKYQNSTGASSLNINRHSFIVTASDR---AVKPLISETTVILNIVDSNDNPPVF---ESLSYFTPVTKSVKVGTRLMRVVAHDEKDFGLNSEIEYLITG---GNSSSKFVLDKTSGWITVFSSLVSE--VNKIFLMNVTAKDKGN 3047          

HSP 13 Score: 100.138 bits (248), Expect = 1.129e-20
Identity = 169/728 (23.21%), Postives = 302/728 (41.48%), Query Frame = 3
Query:  324 YFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL-LYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANT-----FAMNLHNGDLKVIGELDYEKQK-IYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKEN-SPFHTTLTNSNNGLSKIQVI-----DHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCT-DIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG---FRVSFDQSTSEDVLKYFKLDHDK-LYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            YF +D S   I   K+ID E S L        D+ +  +F    R F  +       + I++ D+ND  P F  +   V   E    +G      +A D D  + N  + Y++    G  + F +  Y G  +  + L+ + L       Y L + A D           + +I      P FS+  K    + E    GT +  L A      P   + + + ++ + E+        F++  H+G ++   ELD E+   +Y + + A ++   ++ ++    + I++ D+NDN P    D  +   TI EN      +  L   D D   N  VT   +   +  F   +  +   + + K  DRE   +Y + ++  D G    S+ + L + ++D ND  P+F    + F + E+ +P            S ++VI     D ++ GE+ + ++     D+      ++  +GV  V  A+D E    Y L    +D   +  T  +Y +V D NDN P+  +  +  +V E ++    +++T   SD D        ++++     S D   +F +  +  L  +K+LDRE  S +  VI ++D  P   ++  +TA+V + + D ND  P F    +T+   N     P+  VV   QA D D G N  V Y     L  +  N F +    G++ +      E+    N+ + + A D G
Sbjct: 1444 YFGIDPSSGLIYTSKEIDREFSNLFELTVKATDQAVPVEF----RRFALK------NVTIWVTDLNDNFPTFVSQNALVA--EPNIVIGSILTTLVAFDPD-DEANGEVEYEL--VEGDSDTFIMDRYSGDIRLASQLVPSRL------MYTLTVSATDHGIDRKTSKTELTIILEGADGPIFSQP-KYITVLKEGQPPGTNVISLNAVSPRG-PKGKVEYFIVAVRSGESGGKAMGRLFSIGRHSGVIQTAAELDREQGSDLYVLDVYAIETD-ANQPRTQRTEVEITLQDINDNPPVFANDVLD--VTIEENIIDGFKIMQLTAKDADEGPNALVTYTIISGADDSFR--IDPESGDLIATKKLDRERRSKYSL-LVRADDG--KQSSDMRLNITVKDVNDHTPKFSRPTYSFDIPEDVTPG-----------SIVEVILASDSDSELNGEVNYSLEE----DDEDGTFLLNPVTGVFNVTRALDYETQRYYILTAKAHDGGGLASTVRVYFNVLDINDNPPVFSSSAYSTSVSE-SLPPGSSIVTVEASDGDDGANAQLLYKIA-----SGDPQGHFVITKEGVLQTQKALDRESQSFYNLVITVNDLAPPPAARFTSTAQVSIILLDVNDCPPIFTSQKTTYIQENT----PVDTVVFTAQATDADSGPNSYVEYS----LRGQHQNKFIIGTVDGDVRLIGELDREELS--NYTVTVVATDKG 2109          

HSP 14 Score: 88.1965 bits (217), Expect = 5.649e-17
Identity = 135/554 (24.37%), Postives = 223/554 (40.25%), Query Frame = 3
Query:  870 SRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNG--EVTCRFLKS--ENRFFLNGLLD-----KFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-SIHVVC--TDIYVDVEDENDNTPILYTDLFQLT-----VEENT-INYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKS---LDREEISSFQFVIQISD-KHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQ 2459
            S +++  F V E    GT +  ++          + T++      +E    FA+N   G +     +D E      I ++   S P    +     + I ++D+NDN P   F   +   + +E+      V     TD D   NG    T R ++   + +F L+  ++      F  + S    DRE    Y + I   D G P     + + V I+D ND  P F  + +  SV E++   +++        +I   D D     E+ + +D         +  QID  +G + +  ++D E   EY L +   D  +  +   T+  + + D NDN P++    F  T     V+EN  I    ALLT   SD  S N    VS      +   +  K     L L K    LDRE ISS+   + +SD   P   S     A + + V+D ND+ P F       + +++S   P G  +  V A D D G N  + Y    ++    L  F +  ++G   + S  L ++      ++ ISA+D G Q
Sbjct:   27 SSQVRQEFQVLEEQPIGTYVGTIET-------KASFTYRF-----SENHKLFAINGSTGVICTAALIDRELLPSDVINVVVLSSQPTYPTE-----VRIVVLDMNDNSP--VFPDASIVVSFKEDASRGRQVILDTATDADIGSNGVDHTTYRIVEGNEQRKFRLDITVNPSGEGAFLHLVSTGGLDRELTPFYQLLIEVEDKGVPKKFGYLQVNVTIQDINDNPPVFEQDQYHSSVFEDAAVGSSIL-------QITASDQDEGANAEIRYILDEG-------TPFQIDPKTGTIVIKESLDFESKKEYSLTIHAADKGVPSLSGRTETTIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSPSANGNISVSILGGNEQRHFEVHKSTVPNLSLIKVASLLDRERISSYNLTVSVSDNGRPMARSSF---ASLVIFVNDINDHPPIF---QEELYRVDISEDIPKGSYIKGVSATDGDSGQNANLRY---SLVSGNSLGWFSISDNSG--LVTSAALLDREVASEIVLNISAKDQGLQ 536          

HSP 15 Score: 73.9442 bits (180), Expect = 1.020e-12
Identity = 153/682 (22.43%), Postives = 290/682 (42.52%), Query Frame = 3
Query:  495 LNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQ--KQLLPIAIDKDFSKK------NRMITYQIHFSNGGQNLF---QLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVK-GTVIAHLQATDNDAYP-NNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKS-ENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCC---NDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTG--FRVSFDQSTSEDVLKYFKLDH--DKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPI--GHVVGKVQAFDPDLGNNGTVIYEISK----ILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            + IFI D+ND  P F +  YY+E+ E    +G    Q+  +  D+ F+ K      ++   ++I+ S G   +F   QL Y  ++ A +L +        +H +I+   A+D A K       + + ++D N+  P F  E  S F+    +VK GT +  + A D   +  N+ I + +   N   +++ F ++  +G + V   L  E  KI+ + + A D    +   S++ ++ I++ + N + PE  F      +T+ E+  + + +  +   D+D   NG +T       +N  F+  L  K   +      D EE  ++ + +   D G  + ++ V++T+ + D ND  P F  + +  +V+EN P  TT+        ++   D D  G          +SD  + +  ID  +G++   G +D E    Y L V      D       ++ + ++  N+  P   +  +   V E           F  SD D    G  + + F +S +    K F ++    ++Y+   LDRE+       +   +    G+ +     +VFV ++  + N P    P  T  + +V   E +  G +V  V+A D D       +   S+    I P+   N+F ++  TG++ + +    E    +N  ++  A D G
Sbjct: 2839 VTIFITDVNDNVPRFTRPSYYLEYPE-LTEIGSLVTQVSAVDPDEGFNGKIFYFIRSQSEYFRINASTG--EVFVKQQLKYQNSTGASSLNI-------NRHSFIV--TASDRAVKPLISETTVILNIVDSNDNPPVF--ESLSYFTPVTKSVKVGTRLMRVVAHDEKDFGLNSEIEYLITGGN---SSSKFVLDKTSGWITVFSSLVSEVNKIFLMNVTAKDKG--NPPLSANTAVRIAVTEENHHTPE--FSQSQISATVPESLAVGTAIRTVSAKDKDKEMNGLITYNITSGNDNGVFM--LNSKTGVLSLANPLDFEEKQQHELRVSAIDGGWIAKTSYVSVTIQVTDVNDNPPIFDPDEYFPTVQENVPSGTTVV-------RMNATDRD-SGPNAVMAYVIQSSD--SDLFVIDPNTGIITTQGFLDYEAKQVYHLTVKAFNIPDEDRCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTVVGEVFA-SDRDQGEDGVVYYLIFGKSRN----KGFSINKKTGQIYVTGMLDREKEEKISLKVLAKNA---GSIRGADIDEVFVNITILDANDP----PVFTQDLYDVQVSEGLSPGDLVTFVKADDSD------SVPSWSRFSYFIDPELTKNMFTINPKTGQVSVAAELDRETTPVYNLTVL--AVDTG 3467          
BLAST of Protocadherin delta 1 vs. Ensembl Medaka
Match: ENSORLT00000041998.1 (pep primary_assembly:ASM223467v1:10:15145116:15147689:-1 gene:ENSORLG00000024089.1 transcript:ENSORLT00000041998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 6.622e-49
Identity = 153/537 (28.49%), Postives = 256/537 (47.67%), Query Frame = 3
Query:  291 NIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQI----HFS----NGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGA--GKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDN---ATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDS-IHVVCTDIYVD--VEDENDNTP 1853
            ++ ++     +YF ++     +V+  +ID E  ELC H   C    L  + V           +  +++ I + D+ND +PAF +  +++   E   + G++ +LPIA D D    N + +Y++    HFS    +GG +           +  L+L  ALD E +    L L A DG    + G + IHV VID+N+  P FS+ L     V E+T  GT++  + ATD D   N+ +T+      N + +N F +N   G++ V   +DYE+   Y I + A D    +  +S+   L I IID NDN PE+   +    + ++E+  + + V F+ ++D+D+  NG   C  + S   F L       Y +  +   DRE I  Y V I   D G+P LS+   LTV + D ND  P+F        VKENSP  +        +SKI+ +D D+      +   + +S      +S+I ++  +G +    + D E    ++ +V   DS +  + +++ V+  V DENDN+P
Sbjct:  115 DLSIVSSYSKKYFDVNLQTGNLVVHDRIDRE--ELCPHMAKCL---LTIQAVL-------NNPMTAHRIEINVVDVNDNSPAFMENIFFLNISESSLT-GERYVLPIAADSDMGS-NSVKSYKLSQNEHFSLDVQSGGDH---------GMSAELVLNTALDREKQSVISLVLTAVDGGKPSRSGSLQIHVNVIDVNDNVPAFSKSLYK-VRVKENTAPGTIVLRVNATDLDEGINSRLTYSFIKRGNIDPSNLFELNAETGEITVKRNIDYEESPAYDIRVQAKDRG--ASPRSTHAKLLIEIIDENDNAPEISVTS--LMTPVKEDAEVGAVVAFITVSDKDAGSNGVTKCTIVGSA-PFKLKSNYKNDYSLVVDGPLDRENISVYNVTIKATDEGNPPLSSIHVLTVQVADVNDNAPKFTEPVINVYVKENSPVGSI-------ISKIKAVDPDLENNANVYYKLQESSQRNVLTSSLINVNSETGEITSLQSFDYEKLKTFQFKVQATDSGVPPLSSNVTVNVFVLDENDNSP 615          

HSP 2 Score: 138.658 bits (348), Expect = 7.555e-33
Identity = 149/547 (27.24%), Postives = 239/547 (43.69%), Query Frame = 3
Query:  825 IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNG-------DLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLK-----SENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTT---LTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND-------SIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLD-STNTGFRVSFDQSTSEDVLKYFKL----DHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL---NVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEI 2375
            I + V+D+N+ +P F   +    ++ ES++ G       A D+D   N+  ++KL    +      F++++ +G       +L +   LD EKQ + S+ + A D    S  +S S  + +++IDVNDN P   F     K  ++EN    + V  +  TD D   N  +T  F+K       N F LN    +  +I   +  D EE   Y + +   D G    ST   L + I DEND  P+    +    VKE++        +T S+       V    I+G   F + + + +D          YS  L V G +DRE  + Y + +   D       SIHV+     V V D NDN P     +  + V+EN+      +   +  D D   N        +S+  +VL    +    +  ++   +S D E++ +FQF +Q +D    G   L +   V V V D+NDNSP  + P S H  +   N+      G+ V K++A DPD G N  + Y +S+    K  NLF +   +GEI
Sbjct:  171 IEINVVDVNDNSPAFMENI-FFLNISESSLTGERYVLPIAADSDMGSNSVKSYKLSQNEH------FSLDVQSGGDHGMSAELVLNTALDREKQSVISLVLTAVDGGKPS--RSGSLQIHVNVIDVNDNVP--AFSKSLYKVRVKENTAPGTIVLRVNATDLDEGINSRLTYSFIKRGNIDPSNLFELNA---ETGEITVKRNIDYEESPAYDIRVQAKDRGASPRSTHAKLLIEIIDENDNAPEISVTSLMTPVKEDAEVGAVVAFITVSDKDAGSNGVTKCTIVGSAPFKLKSNYKND----------YS--LVVDGPLDRENISVYNVTIKATDEGNPPLSSIHVLT----VQVADVNDNAPKFTEPVINVYVKENS-PVGSIISKIKAVDPDLENNANVYYKLQESSQRNVLTSSLINVNSETGEITSLQSFDYEKLKTFQFKVQATDS---GVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDPDSGYNALLSYHLSE---PKGNNLFRIGTSSGEI 680          

HSP 3 Score: 119.398 bits (298), Expect = 7.199e-27
Identity = 149/551 (27.04%), Postives = 248/551 (45.01%), Query Frame = 3
Query:  888 SFSVHESTVKGTVIAHLQATDN----DAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYS----ITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFD------TENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFL-----NGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTF-FIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCND---SIHVVCTDIYVDVEDENDNTP-ILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGF-RVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHE--PIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDL--NLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLG 2453
            S+SV E   KG+V+ ++    N    D Y  +       S+ ++ +   F +NL  G+L V   +D E+   +     +TI A  + P++  +     + I+++DVNDN P    +      +E+  +  R   PI++          DS+        +  S+N  F       G      ++  N   DRE+     + +   D G PS S S+ + V + D ND  P F  + ++  VKEN+   T +   N        +D  I   LT+ FI  K  + + +++ +++  +G + V   ID E +  Y +RV   D   S       + +++ DENDN P I  T L     E+  +    A +T   SD D+ + G  + +   S    +   +K D+  L +   LDRE IS +   I+ +D+   GN  L +   + V+V+D NDN+PKF  P     V+NV   E  P+G ++ K++A DPDL NN  V Y++ +      L  +L +++  TGEI     F  E+   F F   + A D G
Sbjct:   84 SYSVSEEVNKGSVVGNIAKDLNIKVQDLYQRD------LSIVSSYSKKYFDVNLQTGNLVVHDRIDREELCPHMAKCLLTIQAVLNNPMTAHR-----IEINVVDVNDNSPAFMENIFFLNISESSLTGERYVLPIAA----------DSDMGSNSVKSYKLSQNEHFSLDVQSGGDHGMSAELVLNTALDREKQSVISLVLTAVDGGKPSRSGSLQIHVNVIDVNDNVPAFSKSLYKVRVKENTAPGTIVLRVN-----ATDLDEGINSRLTYSFI--KRGNIDPSNLFELNAETGEITVKRNIDYEESPAYDIRVQAKDRGASPRSTHAKLLIEIIDENDNAPEISVTSLMTPVKEDAEVGAVVAFITV--SDKDAGSNGVTKCTIVGSAPFKLKSNYKNDY-SLVVDGPLDRENISVYNVTIKATDE---GNPPLSSIHVLTVQVADVNDNAPKFTEP-----VINVYVKENSPVGSIISKIKAVDPDLENNANVYYKLQESSQRNVLTSSLINVNSETGEITSLQSFDYEKLKTFQF--KVQATDSG 593          

HSP 4 Score: 77.7962 bits (190), Expect = 5.504e-14
Identity = 70/269 (26.02%), Postives = 133/269 (49.44%), Query Frame = 3
Query:  726 NLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHV---KVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLE--SLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSA--PISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTF----LKITDRDSNQNGEVTCRFLKSE-NRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLI 1496
            +L++   LD E    Y + + A D  G      IHV   +V D+N+ AP+F+  + + + V E++  G++I+ ++A D D   N N+ +KL+  S  N  T++   +N   G++  +   DYEK K +   + A DS   P+S    S+ ++ + ++D NDN P +        S   EN P S+   +    ++  D DS  N  ++    + + N  F  G      +I + +     ++  + + ++  D+G+PSLS +V++ V++
Sbjct:  458 SLVVDGPLDRENISVYNVTIKATD-EGNPPLSSIHVLTVQVADVNDNAPKFTEPVINVY-VKENSPVGSIISKIKAVDPDLENNANVYYKLQESSQRNVLTSSLINVNSETGEITSLQSFDYEKLKTFQFKVQATDSGVPPLS----SNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDPDSGYNALLSYHLSEPKGNNLFRIGTSSG--EIRTKRRMSDNDLKSHPLLVLVSDNGEPSLSATVSIEVVV 718          
BLAST of Protocadherin delta 1 vs. Planmine SMEST
Match: SMESG000050290.1 (SMESG000050290.1)

HSP 1 Score: 1840.47 bits (4766), Expect = 0.000e+0
Identity = 912/912 (100.00%), Postives = 912/912 (100.00%), Query Frame = 3
Query:  135 MQSRNCCWKFFSISLQLLNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSMXXXXXXXXXXXXXTKDEDECQSETVTYIHRDDIEKFDSMSDYKSFRPVSFCP 2870
            MQSRNCCWKFFSISLQLLNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSMNLLNNNIILDQNNTKDEDECQSETVTYIHRDDIEKFDSMSDYKSFRPVSFCP
Sbjct:    1 MQSRNCCWKFFSISLQLLNLVMSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSMNLLNNNIILDQNNTKDEDECQSETVTYIHRDDIEKFDSMSDYKSFRPVSFCP 912          

HSP 2 Score: 92.4337 bits (228), Expect = 1.372e-18
Identity = 59/62 (95.16%), Postives = 59/62 (95.16%), Query Frame = 1
Query: 2857 CPFVRRCPILIRMQSFFSIQNLLKSQELMKKAHKTQILNPFHXXXXXXXXXXXXMPRKTPRV 3042
            CP   RCPILIRMQSFFSIQNLLKSQELMKKAHKTQILNPFHRQNANLQRRAQRMPRKTPRV
Sbjct:  911 CP---RCPILIRMQSFFSIQNLLKSQELMKKAHKTQILNPFHRQNANLQRRAQRMPRKTPRV 969          
BLAST of Protocadherin delta 1 vs. Planmine SMEST
Match: SMESG000050290.1 (SMESG000050290.1)

HSP 1 Score: 1793.86 bits (4645), Expect = 0.000e+0
Identity = 891/891 (100.00%), Postives = 891/891 (100.00%), Query Frame = 3
Query:  198 MSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSMXXXXXXXXXXXXXTKDEDECQSETVTYIHRDDIEKFDSMSDYKSFRPVSFCP 2870
            MSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSMNLLNNNIILDQNNTKDEDECQSETVTYIHRDDIEKFDSMSDYKSFRPVSFCP
Sbjct:    1 MSIEIKTLFLKENSPINTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRKSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFSRTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWALIIFRQRQRNLRLKSDENKCYYSMNLLNNNIILDQNNTKDEDECQSETVTYIHRDDIEKFDSMSDYKSFRPVSFCP 891          

HSP 2 Score: 92.4337 bits (228), Expect = 1.179e-18
Identity = 59/62 (95.16%), Postives = 59/62 (95.16%), Query Frame = 1
Query: 2857 CPFVRRCPILIRMQSFFSIQNLLKSQELMKKAHKTQILNPFHXXXXXXXXXXXXMPRKTPRV 3042
            CP   RCPILIRMQSFFSIQNLLKSQELMKKAHKTQILNPFHRQNANLQRRAQRMPRKTPRV
Sbjct:  890 CP---RCPILIRMQSFFSIQNLLKSQELMKKAHKTQILNPFHRQNANLQRRAQRMPRKTPRV 948          
BLAST of Protocadherin delta 1 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 221.861 bits (564), Expect = 5.519e-59
Identity = 216/719 (30.04%), Postives = 336/719 (46.73%), Query Frame = 3
Query:  306 GDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS-----ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL--LYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTEN--QKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTN----EYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNT-GFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL-NVSCHEPIGHVVGKVQAFDPD--LGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFIN 2384
            G  F +Y HLD +  K+   ++ID +   LC   + CC  ++ C     + +   Q S      +  K  I IED ND  P F+   + +   E    V     LP+AIDKD S K  + +Y+   S    ++F L   +     +  L L N LD E    Y L + A DG      G +++H+ V+D+N+  P F    + +  V ES +    IA ++ATD D   N  I +KL+S         F ++  +G + +I  LDYEK + Y + I A +  P     +++ +LT+++I++ND  P +  D  N  Q ++I E +   + V  + + D+D    G+V C+       F L       Y+I + +  DRE   +Y ++I+C D G PSLS    + V+I D+ND  P+  S +  F V EN P  T +T       KI   D D  + G+LT+ I +    +  +S + ID  +G++     IDRE TN    +  L V  +DS          I + ++DENDN P      F+ +V EN     R L     SD D T +    +SF +S +         + ++ +L   +SLDREE+  ++ VI  +D    G      +A V V V D NDN P FIFP S +  +  V   +  G++V    A D D     NG + + I+        NLF++D H GEI I+
Sbjct:   60 GGSFIEYLHLDSNNGKLFAKRKIDRD--SLCSEIELCCKSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISES-CPVSTTFQLPLAIDKD-SDKYSVKSYKF-ISKSDLSIFSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVF-ENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDS-------GMFRVDELSGSVYMISPLDYEKDQEYKLIITARNRIP--GVNTATATLTVNVININDEKPVIFVDYFNNWQHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNSPGQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSI-FHVSENKPPGTIVT-------KIDATDKDDGLNGKLTYSITDAQ--NLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYR-LGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDG--AGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINS----NSNNLFNIDPHNGEIRIH 746          

HSP 2 Score: 51.2174 bits (121), Expect = 5.391e-6
Identity = 75/315 (23.81%), Postives = 132/315 (41.90%), Query Frame = 3
Query:  612 AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYI--LDL---LANDGAGKEGRVL-IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT----DRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIED----ENDQ 1514
            A DKD    N  +TY I      QNL        SQ   +  L  +D E  +  +  LDL   +++ G  K+  +  I + + D N+ AP+F +     FSV E+      +  ++ +D D   +  +       NN ++  +     +   L     LD E+   Y + IIA D A      +S+ ++ ++++D+NDN P   F     ++  +   P      +L +T    D+D+   G     F  + N   L  +     +I  ++     +I  +F+ I   D G P LS+   + + I+D    END+
Sbjct:  485 ATDKD-DGLNGKLTYSI---TDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQS-TFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASA-TVNVTVLDINDNPPIFIFPRSGNETIPK--VPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKIQDIPIYENDK 791          
BLAST of Protocadherin delta 1 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 221.476 bits (563), Expect = 5.748e-59
Identity = 216/719 (30.04%), Postives = 336/719 (46.73%), Query Frame = 3
Query:  306 GDGFNQYFHLDKSRNKIVLVKQIDLEDSELCVHNQNCCDENLDCKFVFLIRIFEKQAS-----ILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQL--LYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKE--GRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTEN--QKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHD--IIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTN----EYRLRVCCNDS---IHVVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNT-GFRVSFDQSTSEDVLKYFKLDHDKLYLR--KSLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVL-NVSCHEPIGHVVGKVQAFDPD--LGNNGTVIYEISKILPDKDLNLFHLDRHTGEIFIN 2384
            G  F +Y HLD +  K+   ++ID +   LC   + CC  ++ C     + +   Q S      +  K  I IED ND  P F+   + +   E    V     LP+AIDKD S K  + +Y+   S    ++F L   +     +  L L N LD E    Y L + A DG      G +++H+ V+D+N+  P F    + +  V ES +    IA ++ATD D   N  I +KL+S         F ++  +G + +I  LDYEK + Y + I A +  P     +++ +LT+++I++ND  P +  D  N  Q ++I E +   + V  + + D+D    G+V C+       F L       Y+I + +  DRE   +Y ++I+C D G PSLS    + V+I D+ND  P+  S +  F V EN P  T +T       KI   D D  + G+LT+ I +    +  +S + ID  +G++     IDRE TN    +  L V  +DS          I + ++DENDN P      F+ +V EN     R L     SD D T +    +SF +S +         + ++ +L   +SLDREE+  ++ VI  +D    G      +A V V V D NDN P FIFP S +  +  V   +  G++V    A D D     NG + + I+        NLF++D H GEI I+
Sbjct:   55 GGSFIEYLHLDSNNGKLFAKRKIDRD--SLCSEIELCCKSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISES-CPVSTTFQLPLAIDKD-SDKYSVKSYKF-ISKSDLSIFSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVF-ENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDS-------GMFRVDELSGSVYMISPLDYEKDQEYKLIITARNRIP--GVNTATATLTVNVININDEKPVIFVDYFNNWQHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNSPGQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSI-FHVSENKPPGTIVT-------KIDATDKDDGLNGKLTYSITDAQ--NLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYR-LGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDG--AGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINS----NSNNLFNIDPHNGEIRIH 741          

HSP 2 Score: 51.2174 bits (121), Expect = 5.430e-6
Identity = 75/315 (23.81%), Postives = 132/315 (41.90%), Query Frame = 3
Query:  612 AIDKDFSKKNRMITYQIHFSNGGQNLFQLLYDGTSQAPNLLLLNALDCETKHHYI--LDL---LANDGAGKEGRVL-IHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKIT----DRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIED----ENDQ 1514
            A DKD    N  +TY I      QNL        SQ   +  L  +D E  +  +  LDL   +++ G  K+  +  I + + D N+ AP+F +     FSV E+      +  ++ +D D   +  +       NN ++  +     +   L     LD E+   Y + IIA D A      +S+ ++ ++++D+NDN P   F     ++  +   P      +L +T    D+D+   G     F  + N   L  +     +I  ++     +I  +F+ I   D G P LS+   + + I+D    END+
Sbjct:  480 ATDKD-DGLNGKLTYSI---TDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQS-TFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPFSITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASA-TVNVTVLDINDNPPIFIFPRSGNETIPK--VPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKIQDIPIYENDK 786          
BLAST of Protocadherin delta 1 vs. Planmine SMEST
Match: SMESG000027424.1 (SMESG000027424.1)

HSP 1 Score: 221.476 bits (563), Expect = 6.833e-59
Identity = 203/716 (28.35%), Postives = 342/716 (47.77%), Query Frame = 3
Query:  294 IKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSELC-------VHNQNC-CDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQRQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNL-FQLLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAG--KEGRVLIHVKVIDINEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLESLNNAETANTFAMNLHNGDLKVIGELDYEK-QKIYSITIIAYDSAPISERKSSSFSLTISIIDVNDNYPELKF-----DTENQKSTIRENQPISSPVTFLKITDRDSNQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICHDHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSNNGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAIDRELTNEYRLRVCCNDSIH-----VVCTDIYVDVEDENDNTPILYTDLFQLTVEENTINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK--SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFPNSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNLFHLDRHTG 2369
            IK + D F + F ++ +  ++V+ ++ID +  ++C       ++ +N       +CK    I +     +I+T K+ I IEDIND  P++  ++  V+F +G K    K  LP A DKD  +       QI +S   ++L F+L    T     L  L  LD E K  Y   L+A+D     + G + +HV + D+N+ +P FS+ +    +V E +  GT+I  L+A+D D+  N    FK          + F +   +G + V   LD ++        ++  D A     KSS  ++ + I DVND  PELK      D+   K  + E+  I + +  L++TDRD N    V+C    S+          K Y+I +N  FDRE++    + I C D      S++ ++   I+D ND  P F  + +   +KEN P HT L       SK+   D D    + +FI  +++S+       ID+ +G++    + DRE+   Y ++V   DSI        CT + V + DENDN P+   + +   + EN    + A+   + +DLD  ++   +S+    S    + FK++     +    +LDRE+ + + F++ + D + +   +   T+ V V + D NDNSPKFI PN+T    ++S  + +GH +  V A D D+ +N  + Y I+      D N+F +D  TG
Sbjct:   46 IKNLNDRFVKCFKINMN-GQLVVARRIDRD--QMCEKSTSQPIYTKNSRITPEEECKI--FINVASPSLNIMT-KVVITIEDINDNIPSWNLQRIEVKFIDGCKE-RTKVSLPPAFDKDIGQ-----NAQIEYSFKERDLPFRL---DTEDGFYLQTLQTLDREQKESYTFTLIASDKGNPVQTGEIEVHVVIEDLNDNSPIFSKPIYRFKAVSEDSAVGTIIGKLEASDADSGVNGKFNFKFAEAVPEIVKHYFQIQ-SDGTVIVAAPLDSDRGNNELKFKVVVEDEALRPYSKSSDATVYVYINDVNDEKPELKLIFMNHDSRTNKPFVVEHTKIGTLIGILEVTDRDYNNKDTVSCNVDNSQFALISEDRPVK-YKITTNMDFDREKMTTADLRIFCRDSVGNLASSNHSIN--IKDINDNPPNFTKSFYVMKIKENQPVHTMLP------SKLVATDPDSESTIQYFISPEYSSN-----FSIDRETGIISTLVSFDREICASYTIKVIAKDSIKEPINTGTCT-VQVIILDENDNKPVFTHEFYTFHIPENNFP-NTAVGIVKATDLDEQDSQSSLSYRLEYSSKT-RPFKINSRSGAITAIITLDREKETFYSFIVYVEDGNDYPMKRNTVTSSVTVVIDDVNDNSPKFIIPNATKSSFDISIKDTVGHKIINVYAEDADVSDNSRIYYNITA---GNDENIFSIDSATG 725          
The following BLAST results are available for this feature:
BLAST of Protocadherin delta 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDHGA123.615e-5128.04protocadherin gamma subfamily A, 12 [Source:HGNC S... [more]
PCDHGA126.537e-5127.89protocadherin gamma subfamily A, 12 [Source:HGNC S... [more]
PCDH11Y2.105e-4927.24protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.134e-4927.64protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH92.149e-4928.64protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.412e-4625.75FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.927e-3926.45FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-14.812e-3526.06Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-14.812e-3526.06Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
cdh-14.243e-2625.22CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds7.581e-5026.36gene:FBgn0284247 transcript:FBtr0078045[more]
ds7.581e-5026.36gene:FBgn0284247 transcript:FBtr0343249[more]
stan2.426e-4626.81gene:FBgn0024836 transcript:FBtr0303223[more]
stan2.426e-4626.81gene:FBgn0024836 transcript:FBtr0088214[more]
stan2.510e-4626.95gene:FBgn0024836 transcript:FBtr0304900[more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh93.407e-5427.90protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh94.277e-5427.90protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh94.277e-5427.90protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.15.705e-5427.90pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdhb5.113e-5329.64protocadherin b [Source:ZFIN;Acc:ZDB-GENE-020731-3... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047804.11.039e-5428.33protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.11.186e-5428.33protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.11.209e-5428.33protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
FAT48.907e-5326.11FAT atypical cadherin 4 [Source:NCBI gene;Acc:1001... [more]
vapa1.897e-5129.22VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhga123.482e-5027.36protocadherin gamma subfamily A, 12 [Source:MGI Sy... [more]
Pcdh11x3.906e-5027.42protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x6.563e-5027.42protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x6.719e-5027.25protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x7.911e-5027.25protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin delta 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DRB9|PCDGC_PANTR1.269e-5029.52Protocadherin gamma-A12 OS=Pan troglodytes OX=9598... [more]
sp|O60330|PCDGC_HUMAN3.139e-5027.89Protocadherin gamma-A12 OS=Homo sapiens OX=9606 GN... [more]
sp|Q71M42|PC11X_PANTR5.506e-5027.31Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA5.849e-5027.31Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6X862|PC11X_GORGO2.352e-4927.31Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
back to top
BLAST of Protocadherin delta 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YTN03.468e-10728.52Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A2H1CW723.570e-10728.89Cadherin domain protein OS=Fasciola hepatica OX=61... [more]
A0A5K3FP611.439e-10529.42Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QTH42.323e-10429.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5J4NZP86.168e-10329.41Protocadherin delta 1 OS=Paragonimus westermani OX... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000003988.25.307e-5227.84FAT atypical cadherin 4 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000031516.16.133e-5227.84FAT atypical cadherin 4 [Source:NCBI gene;Acc:1030... [more]
pcdh92.555e-5127.47protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh93.324e-5127.47protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh119.384e-5127.97protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.12.360e-4726.69pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.13.855e-4426.24pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
pcdh111.199e-4125.64protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.19.119e-4126.51protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.14.758e-3626.46pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.661e-4526.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.899e-4325.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.881e-3926.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410052.092e-3927.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404704.671e-3928.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin delta 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh94.348e-5328.12protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh99.242e-5328.12protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.264e-5228.12protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
FAT46.149e-5228.77FAT atypical cadherin 4 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000041998.16.622e-4928.49pep primary_assembly:ASM223467v1:10:15145116:15147... [more]
back to top
BLAST of Protocadherin delta 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050290.11.372e-18100.00SMESG000050290.1[more]
SMESG000050290.11.179e-18100.00SMESG000050290.1[more]
SMESG000059376.15.519e-5930.04SMESG000059376.1[more]
SMESG000059376.15.748e-5930.04SMESG000059376.1[more]
SMESG000027424.16.833e-5928.35SMESG000027424.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010131 ID=SMED30010131|Name=Protocadherin delta 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3543bp
GCAGGCAATGTAATTATAGCTTTATTTCTAAATTTAAATAATAATCAACG
GTTTTCAACAAATAATAATGTTTCTTTGCCTAACTTTCTTCACCAATGAC
AATGGAAAATGCATTTCACATGCTTGGAAGAGTAATGCAATCCAGGAATT
GTTGTTGGAAATTTTTCAGTATTTCTCTTCAACTATTGAACCTTGTAATG
AGCATTGAAATCAAAACATTATTTTTAAAAGAAAACTCCCCAATCAATAC
GACAATAGATATTCCAGTTTTCAATGACAAACTTTTTCCAAACATCAAAG
TAATCGGAGACGGCTTTAATCAATATTTCCATTTGGATAAAAGCAGAAAC
AAAATCGTTCTCGTGAAACAAATCGATTTGGAAGATTCCGAGTTATGTGT
TCACAATCAGAATTGCTGTGATGAAAATCTCGACTGTAAATTCGTGTTTC
TTATTAGAATATTTGAGAAACAGGCGTCAATTCTAACCTACAAATTGAAC
ATTTTCATTGAAGACATCAACGATTGGACTCCAGCATTTAAACAGAGACA
ATATTATGTTGAGTTTTATGAAGGTCCAAAATCGGTCGGTCAGAAACAGC
TATTGCCTATTGCAATTGATAAAGATTTTTCGAAAAAAAATCGAATGATA
ACTTATCAAATACATTTTTCGAATGGTGGACAGAATTTGTTTCAACTTCT
GTATGATGGAACTTCTCAAGCCCCTAATTTGTTATTATTGAACGCTTTGG
ATTGTGAGACAAAGCATCATTATATATTAGATCTACTAGCCAATGACGGA
GCGGGAAAGGAAGGTCGGGTGTTAATACATGTCAAAGTCATAGACATTAA
TGAATACGCTCCTGAGTTTTCTAGAGAATTAAAAAGTTCTTTTTCCGTTC
ATGAATCAACAGTTAAAGGAACTGTAATTGCTCACTTGCAAGCCACAGAT
AACGATGCATATCCAAATAATAACATCACGTTTAAATTAGAATCTCTCAA
TAACGCCGAAACGGCAAATACATTTGCTATGAATTTACACAACGGTGATT
TGAAAGTAATCGGAGAGTTGGATTATGAAAAACAGAAAATTTATTCCATA
ACAATAATTGCATATGATAGTGCACCGATATCAGAGAGAAAATCCTCCAG
TTTTTCATTGACAATTTCTATAATAGACGTCAATGACAATTATCCGGAAT
TGAAATTCGATACGGAAAATCAAAAATCAACTATTCGGGAAAATCAACCA
ATCTCTTCTCCAGTGACTTTTCTAAAAATCACTGATCGAGATTCCAATCA
AAACGGTGAAGTGACATGTCGATTTTTGAAAAGTGAAAACCGATTTTTTC
TCAATGGACTTCTTGATAAATTCTATCAAATCGAATCGAACAAAGTTTTT
GATCGAGAAGAAATCGATCGGTATTTTGTGAATATCATTTGCCACGATCA
CGGTGATCCGTCGTTGTCAACTAGTGTGACTTTGACAGTTTTAATCGAAG
ACGAAAACGATCAAGATCCTCAATTTCTTTCAAATAATTTTCGATTTAGC
GTGAAAGAAAATTCTCCATTCCACACGACTCTGACAAATTCCAACAATGG
ATTGTCGAAAATCCAAGTGATAGATCATGATATTATTGGAGAATTGACAT
TTTTCATTGACAACAAACACACATCGGATAATGCGACAAGTGTCATTCAA
ATCGACAAATACTCAGGGGTTTTGTATGTTGCCGGTGCGATCGACAGAGA
ATTGACCAATGAATATAGATTGCGCGTTTGTTGCAATGACTCAATCCATG
TTGTGTGCACTGACATTTACGTTGACGTTGAAGACGAAAATGATAACACT
CCAATTTTATACACAGATCTATTTCAATTAACTGTTGAAGAAAACACAAT
CAATTACGATAGAGCCTTATTGACATTCCGACCAAGCGATCTTGATTCTA
CAAATACCGGGTTTAGAGTCTCATTTGATCAGTCAACATCTGAAGATGTG
TTGAAATATTTCAAATTAGATCATGATAAACTATATTTGAGAAAATCATT
AGACCGCGAGGAGATCTCATCATTTCAGTTTGTCATACAAATAAGTGACA
AACACCCCCATGGGAATTCCCAGTTGTTTACTACAGCAAAAGTGTTTGTA
AAAGTCAGCGATCAAAATGATAATTCACCAAAATTTATTTTCCCAAACTC
GACACATTTTGTTCTCAATGTTTCATGTCATGAGCCTATCGGTCATGTCG
TTGGAAAAGTTCAAGCATTTGATCCAGATTTGGGAAATAATGGAACAGTA
ATTTATGAAATCTCGAAAATTCTACCGGACAAAGATTTGAATCTCTTTCA
TTTGGATCGTCACACCGGGGAAATATTCATCAACAGTCCATTTTTAAGTG
AACAGTTCTGTCGGTTTAATTTCATAATTATGATATCAGCCGAAGATTTG
GGAAATCAAAAAGTGAAAAATCCCCTTTACAGAAAATATTTTTCGCGCAC
TTTTGAAAAATTACACATTACTCTGTTAGACATCCCTAGAAGTTATTCAG
CGAAAATTACATTAATAACTCCCAGATTAATTCTGACTGTAATTTTATCG
TTTTCGACTTTATTTCTAATGTGTTTGTTGATTGCTTGGGCTCTTATTAT
TTTTCGACAAAGGCAACGAAATCTCAGACTGAAATCCGATGAAAATAAAT
GCTACTATTCGATGAACCTGCTCAATAATAATATAATATTGGATCAAAAT
AACACAAAAGACGAAGACGAATGCCAGTCTGAAACGGTCACTTACATTCA
CAGAGATGATATTGAAAAATTCGACTCCATGTCTGATTACAAATCGTTTC
GGCCGGTGTCCTTTTGTCCGGCGATGTCCAATTCTAATCCGAATGCAGTC
ATTCTTCTCAATCCAAAATCTCCTCAAATCTCAAGAGCTAATGAAGAAAG
CTCACAAAACACAGATTCTCAATCCGTTTCACAGGCAAAATGCAAATCTC
CAACGTCGAGCTCAACGGATGCCACGGAAGACGCCACGAGTGTAGGTAAT
CAGAAAAAATCAAACAGCACAAACCCGACAGTCGATTATGAACCTATTTA
TGTGCTGCGCAGTCGGACAATATGTGTTCCAAAACGGGAGTGTAAAAATT
CAGATATTTATACAACTTTAATGCCCCATTCAAGCGTGGTAAAATTCACG
CCCGTCTATTCAAATCGCTATGAGCTGGAAAACGAAAACGACACTTATGT
CTAGCGATAATTATATAAAGACTAAAAATACTGTTGATACAGCAAATGTT
TTCAGACTCTCAGCTATTTTCTGTATGCCAAATATATACAATTTTCATAA
TTGCAGCCCGCTCATTGAAACAACACAGCCAGTTATCAAAGCACTTGATG
ACCCAGGGTGGCATCGAGTTCGCATATATTACTGTTGAAAGAAGAAAGAT
TTATAAATAACAGAAAACTATTGGAGCATAAAGTATACATTAAATAAGTT
TTCGAGTTTCCTGTTATTTATTTATATTTTTGTCGACGTCTTA
back to top

protein sequence of SMED30010131-orf-1

>SMED30010131-orf-1 ID=SMED30010131-orf-1|Name=SMED30010131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1053bp
MTMENAFHMLGRVMQSRNCCWKFFSISLQLLNLVMSIEIKTLFLKENSPI
NTTIDIPVFNDKLFPNIKVIGDGFNQYFHLDKSRNKIVLVKQIDLEDSEL
CVHNQNCCDENLDCKFVFLIRIFEKQASILTYKLNIFIEDINDWTPAFKQ
RQYYVEFYEGPKSVGQKQLLPIAIDKDFSKKNRMITYQIHFSNGGQNLFQ
LLYDGTSQAPNLLLLNALDCETKHHYILDLLANDGAGKEGRVLIHVKVID
INEYAPEFSRELKSSFSVHESTVKGTVIAHLQATDNDAYPNNNITFKLES
LNNAETANTFAMNLHNGDLKVIGELDYEKQKIYSITIIAYDSAPISERKS
SSFSLTISIIDVNDNYPELKFDTENQKSTIRENQPISSPVTFLKITDRDS
NQNGEVTCRFLKSENRFFLNGLLDKFYQIESNKVFDREEIDRYFVNIICH
DHGDPSLSTSVTLTVLIEDENDQDPQFLSNNFRFSVKENSPFHTTLTNSN
NGLSKIQVIDHDIIGELTFFIDNKHTSDNATSVIQIDKYSGVLYVAGAID
RELTNEYRLRVCCNDSIHVVCTDIYVDVEDENDNTPILYTDLFQLTVEEN
TINYDRALLTFRPSDLDSTNTGFRVSFDQSTSEDVLKYFKLDHDKLYLRK
SLDREEISSFQFVIQISDKHPHGNSQLFTTAKVFVKVSDQNDNSPKFIFP
NSTHFVLNVSCHEPIGHVVGKVQAFDPDLGNNGTVIYEISKILPDKDLNL
FHLDRHTGEIFINSPFLSEQFCRFNFIIMISAEDLGNQKVKNPLYRKYFS
RTFEKLHITLLDIPRSYSAKITLITPRLILTVILSFSTLFLMCLLIAWAL
IIFRQRQRNLRLKSDENKCYYSMNLLNNNIILDQNNTKDEDECQSETVTY
IHRDDIEKFDSMSDYKSFRPVSFCPAMSNSNPNAVILLNPKSPQISRANE
ESSQNTDSQSVSQAKCKSPTSSSTDATEDATSVGNQKKSNSTNPTVDYEP
IYVLRSRTICVPKRECKNSDIYTTLMPHSSVVKFTPVYSNRYELENENDT
YV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane