protein arginine methyltransferase 1-like protein

Overview
Nameprotein arginine methyltransferase 1-like protein (AEX33823.1)
Smed IDSMED30010124
Length (bp)1223
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein arginine methyltransferase 1-like protein (SMED30010124) t-SNE clustered cells

Violin plots show distribution of expression levels for protein arginine methyltransferase 1-like protein (SMED30010124) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein arginine methyltransferase 1-like protein (SMED30010124) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein arginine methyltransferase 1-like protein (SMED30010124) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010124

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010124SMESG000038804.1 SmedASXL_008329SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010124SMESG000038804.1 SmedASXL_008329SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010124SMESG000038804.1 dd_Smed_v4_1755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010124SMESG000038804.1 Contig48414newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010124SMESG000038804.1 Contig48414uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 479.174 bits (1232), Expect = 2.821e-169
Identity = 233/335 (69.55%), Postives = 282/335 (84.18%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL+ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   26 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 479.174 bits (1232), Expect = 5.180e-169
Identity = 233/335 (69.55%), Postives = 282/335 (84.18%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL+ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   44 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 473.781 bits (1218), Expect = 1.218e-167
Identity = 231/332 (69.58%), Postives = 280/332 (84.34%), Query Frame = 3
Query:  123 MTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            MTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL+ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:    1 MTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 325          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT8 (protein arginine methyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:5188])

HSP 1 Score: 462.225 bits (1188), Expect = 4.309e-162
Identity = 225/337 (66.77%), Postives = 278/337 (82.49%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDKVVLDVG GTGIL MFA KAGA+KV GI+CS+I DY+++IIKAN +++ IT+ KGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV+FARDKWLK GG++ PD+A L++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C++KEV++Y +K E+LSF S F L I++NDY+HALV +FNI+FT  HK +GFST P D   THWKQTVFYL+    D LTV  GEEI G  S+KPNA+N RDLD  +++ F+G++ +   +  Y+MR
Sbjct:   56 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAP-DAPYTHWKQTVFYLE----DYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR 385          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Match: PRMT8 (protein arginine methyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:5188])

HSP 1 Score: 462.225 bits (1188), Expect = 5.470e-162
Identity = 225/337 (66.77%), Postives = 278/337 (82.49%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDKVVLDVG GTGIL MFA KAGA+KV GI+CS+I DY+++IIKAN +++ IT+ KGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV+FARDKWLK GG++ PD+A L++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C++KEV++Y +K E+LSF S F L I++NDY+HALV +FNI+FT  HK +GFST P D   THWKQTVFYL+    D LTV  GEEI G  S+KPNA+N RDLD  +++ F+G++ +   +  Y+MR
Sbjct:   65 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAP-DAPYTHWKQTVFYLE----DYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR 394          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Match: prmt-1 (Protein arginine N-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2X0])

HSP 1 Score: 402.519 bits (1033), Expect = 1.573e-139
Identity = 199/334 (59.58%), Postives = 256/334 (76.65%), Query Frame = 3
Query:  120 DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEV-ELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            ++TSKDYYFDSYAHFGIHEEMLKDEVRT TYRN++YHN HL KDKVV+DVG GTGIL MFA KAGA+KV  ++ SN+   +++II  N ++  + +I+ KVE+V ELP  + KVDIIISEWMGYCLFYESMLNTVL ARD+WL   G++ PDKA L++CAIEDRQYK++KI+WW++VYGF+MS I+ VA+ EPLVD+V+  Q+ +N C++K+V++Y +K+EDL+F S F L   ++DYI A V FF ++F+  HK  GFSTGP D + THWKQTVFYL     D+LTV  GEEITG F + PN  N RDLDI I   F+G++  + E  +Y M 
Sbjct:   20 ELTSKDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTGFSTGP-DVQYTHWKQTVFYL----KDALTVKKGEEITGSFEMAPNKNNERDLDINISFDFKGEVCDLNEQNTYTMH 348          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Match: prmt-1 (Protein arginine N-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2X0])

HSP 1 Score: 402.519 bits (1033), Expect = 1.573e-139
Identity = 199/334 (59.58%), Postives = 256/334 (76.65%), Query Frame = 3
Query:  120 DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEV-ELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            ++TSKDYYFDSYAHFGIHEEMLKDEVRT TYRN++YHN HL KDKVV+DVG GTGIL MFA KAGA+KV  ++ SN+   +++II  N ++  + +I+ KVE+V ELP  + KVDIIISEWMGYCLFYESMLNTVL ARD+WL   G++ PDKA L++CAIEDRQYK++KI+WW++VYGF+MS I+ VA+ EPLVD+V+  Q+ +N C++K+V++Y +K+EDL+F S F L   ++DYI A V FF ++F+  HK  GFSTGP D + THWKQTVFYL     D+LTV  GEEITG F + PN  N RDLDI I   F+G++  + E  +Y M 
Sbjct:   20 ELTSKDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTGFSTGP-DVQYTHWKQTVFYL----KDALTVKKGEEITGSFEMAPNKNNERDLDINISFDFKGEVCDLNEQNTYTMH 348          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art1 (gene:FBgn0037834 transcript:FBtr0082304)

HSP 1 Score: 479.559 bits (1233), Expect = 1.999e-169
Identity = 223/335 (66.57%), Postives = 281/335 (83.88%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A +MTS+DYYFDSYAHFGIHEEMLKDEVRT+TYRNA+YHNKHL + K VLDVGCGTGIL MFA KAGA +VI +DCSNII++A++++  N ++D IT++KGK+EE+ELP+ +  VDIIISEWMGYCLFYESML+TVL+ARDKWLK  G++ PD+ TL++ AIEDRQYKDEKINWW++VYGFDMSCIRKVAV+EPLVDVV+P Q+VS  C+VKEV++Y ++  DL+F+S F+L I++ND++ ALV +FNI+FT  HK +GFST P D   THWKQTVFYLD    D +T    EEITG F +KPN RNNRDLD  I+I F+G++SQ++E+ +YRMR
Sbjct:   47 ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSP-DSTYTHWKQTVFYLD----DHMTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKGELSQIQESNTYRMR 376          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art2 (gene:FBgn0031592 transcript:FBtr0077476)

HSP 1 Score: 257.299 bits (656), Expect = 2.019e-82
Identity = 133/317 (41.96%), Postives = 204/317 (64.35%), Query Frame = 3
Query:  129 SKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGK 1079
             +++YF  Y    IHE +LKD VR   YR A+ HN+   + K VLDVGCG G+L MFA KAG+++V+ ++ + I ++A+++++ N+    I +I+GKVE++ELPD + KVDII+ +WMG CLF  +ML ++LFARDKWL   G I PD A L+L AI+ R   D+ + +W +V+GFD+S IR+   S+ +V+ V  +Q++S  C+VK +++Y    +     S F L + +N ++H LVA+F++ F+ S + I FST PS    THW QTVFYL+      L V  GE I G+ ++KP+  +  D +  I + F G+
Sbjct:   29 QEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPS-APWTHWNQTVFYLE----TPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGR 336          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art2 (gene:FBgn0031592 transcript:FBtr0345748)

HSP 1 Score: 257.299 bits (656), Expect = 2.019e-82
Identity = 133/317 (41.96%), Postives = 204/317 (64.35%), Query Frame = 3
Query:  129 SKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGK 1079
             +++YF  Y    IHE +LKD VR   YR A+ HN+   + K VLDVGCG G+L MFA KAG+++V+ ++ + I ++A+++++ N+    I +I+GKVE++ELPD + KVDII+ +WMG CLF  +ML ++LFARDKWL   G I PD A L+L AI+ R   D+ + +W +V+GFD+S IR+   S+ +V+ V  +Q++S  C+VK +++Y    +     S F L + +N ++H LVA+F++ F+ S + I FST PS    THW QTVFYL+      L V  GE I G+ ++KP+  +  D +  I + F G+
Sbjct:   29 QEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPS-APWTHWNQTVFYLE----TPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGR 336          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art6 (gene:FBgn0038189 transcript:FBtr0082878)

HSP 1 Score: 251.136 bits (640), Expect = 2.467e-80
Identity = 133/325 (40.92%), Postives = 204/325 (62.77%), Query Frame = 3
Query:  141 YFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTS--SHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSY 1109
            YF SY+    H  ML+D VR   +R+A+  +  L +DK+VLDVGCGTGIL +FA +AGA KVI ++C++I D A+EII+ N+ E+ + ++KG VE+VELPD + KVDII+SEWMG  L+ E+M+N+VLFARDKWL  GG I+P    L L    D  ++   +N+W NV G DM C+RK    EPLV+ V   Q++++ C +   N+   + + + F S F L + +   I+ LV +F++ F S  S+K +  +T P     THW+QTV +LD    + L V   + + G+ ++ P  ++ R ++  + I FRG+ +++E   S+
Sbjct:   19 YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHS-PWTHWEQTVLHLD----EPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSF 337          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Match: Art3 (gene:FBgn0038306 transcript:FBtr0083135)

HSP 1 Score: 227.639 bits (579), Expect = 1.403e-69
Identity = 131/308 (42.53%), Postives = 193/308 (62.66%), Query Frame = 3
Query:  141 YFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEI 1064
            YF SYAHFGIH EML D+VRT TYR +L  N+ +V+ K VLDVGCGTGIL +FA KAGA +V+GID S+I+  A +II+ NK+E+ + LIKG++E+ +LP+   K DIIISEWMGY L YESML+++++AR+  L   GII+P + TL L    D     +++ +W NVY  DMS +RK ++ EPL+ VV+   +++    +   ++  + +   +F   F+L + K   + A V +F   F      + FST PS    THWKQTVF+++    +   V  G+ I G  + + +  + R L + IE+
Sbjct:  166 YFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPE--TKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFELPSP-VMFSTSPS-ATPTHWKQTVFFIE----NPQVVKEGDVICGKITSRRHKEDVRGLSVDIEV 464          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt1 (protein arginine methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-693])

HSP 1 Score: 483.797 bits (1244), Expect = 2.406e-171
Identity = 236/335 (70.45%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HNKHL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V  VDIIISEWMGYCLFYESMLNTV++ARDKWLK  G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI++VA++EPLVDVV+P Q+VS  C++KEV++Y +K+EDLSF SPF L +++NDYIHALV +FNI+FT  HK  GFST P +   THWKQTVFYLD    D LTV  GEEI G  S+KPN +NNRDLD  ++I F+G++ ++ +T  YRMR
Sbjct:   21 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELP--VENVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAITEPLVDVVDPKQLVSTACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYLD----DYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEVSKTSEYRMR 348          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 450.669 bits (1158), Expect = 1.443e-158
Identity = 219/337 (64.99%), Postives = 271/337 (80.42%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIK+N ++  IT++KGKVEE ELP D  +VDIIISEWMGYCLFYESMLNTV++ARDKWLK GG + PD+ATL++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C+VKEV++Y +K EDLSF S F L I++NDY+HALV +FNI+FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI G  +++PN  N RDLD   E+ F+G++     +  Y+MR
Sbjct:    5 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKTGFSTAP-DAPSTHWKQTVFYLE----DYLTVRRGEEILGSITVRPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 334          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 451.825 bits (1161), Expect = 9.798e-158
Identity = 219/337 (64.99%), Postives = 271/337 (80.42%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIK+N ++  IT++KGKVEE ELP D  +VDIIISEWMGYCLFYESMLNTV++ARDKWLK GG + PD+ATL++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C+VKEV++Y +K EDLSF S F L I++NDY+HALV +FNI+FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI G  +++PN  N RDLD   E+ F+G++     +  Y+MR
Sbjct:   90 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKTGFSTAP-DAPSTHWKQTVFYLE----DYLTVRRGEEILGSITVRPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 419          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 451.825 bits (1161), Expect = 1.014e-157
Identity = 219/337 (64.99%), Postives = 271/337 (80.42%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIK+N ++  IT++KGKVEE ELP D  +VDIIISEWMGYCLFYESMLNTV++ARDKWLK GG + PD+ATL++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C+VKEV++Y +K EDLSF S F L I++NDY+HALV +FNI+FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI G  +++PN  N RDLD   E+ F+G++     +  Y+MR
Sbjct:   91 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKTGFSTAP-DAPSTHWKQTVFYLE----DYLTVRRGEEILGSITVRPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 420          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Match: PRMT8 (protein arginine N-methyltransferase 8-B-like [Source:NCBI gene;Acc:556054])

HSP 1 Score: 449.514 bits (1155), Expect = 6.515e-157
Identity = 219/337 (64.99%), Postives = 270/337 (80.12%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIKAN ++  IT+ KGKVEE ELP D  +VDIIISEWMGYCLFYESMLNTV++ARDKWLK GG++ PD+A L++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+  Q+VSN C++KEV++Y +K E+LSF S F L I++NDYIHALV +FNI+FT  HK  GFST P D   THWKQTVFYL+    + LTV  GEEI G  S+KPN +N RDLD   E+ F+G++ +      Y+MR
Sbjct:   81 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKANHLDSVITIFKGKVEETELPVD--QVDIIISEWMGYCLFYESMLNTVIYARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMKEPLVDIVDSKQVVSNSCLIKEVDIYTVKPEELSFTSSFCLQIQRNDYIHALVTYFNIEFTKCHKKTGFSTAP-DAPFTHWKQTVFYLE----EYLTVKRGEEIVGTVSMKPNEKNVRDLDFTFELDFKGQLCEAAIAHDYKMR 410          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 479.174 bits (1232), Expect = 2.064e-169
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KV+DL+F SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   20 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 347          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 478.404 bits (1230), Expect = 4.662e-169
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KV+DL+F SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   22 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 349          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 478.404 bits (1230), Expect = 4.874e-169
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KV+DL+F SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   26 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 478.019 bits (1229), Expect = 5.069e-169
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KV+DL+F SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   17 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 344          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 478.404 bits (1230), Expect = 5.178e-169
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KV+DL+F SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   28 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 355          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 477.248 bits (1227), Expect = 9.767e-169
Identity = 233/335 (69.55%), Postives = 281/335 (83.88%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   26 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 477.248 bits (1227), Expect = 1.894e-168
Identity = 233/335 (69.55%), Postives = 281/335 (83.88%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   44 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt8 (protein arginine N-methyltransferase 8 [Source:MGI Symbol;Acc:MGI:3043083])

HSP 1 Score: 462.611 bits (1189), Expect = 2.619e-162
Identity = 225/337 (66.77%), Postives = 278/337 (82.49%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDKVVLDVG GTGIL MFA KAGA+KV GI+CS+I DY+++IIKAN +++ IT+ KGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV+FARDKWLK GG++ PD+A L++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C++KEV++Y +K E+LSF S F L I++NDY+HALV +FNI+FT  HK +GFST P D   THWKQTVFYL+    D LTV  GEEI G  S+KPNA+N RDLD  +++ F+G++ +   +  Y+MR
Sbjct:   65 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAP-DAPYTHWKQTVFYLE----DYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR 394          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 433.721 bits (1114), Expect = 4.436e-152
Identity = 213/314 (67.83%), Postives = 261/314 (83.12%), Query Frame = 3
Query:  177 EMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            EMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   12 EMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 318          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 296.204 bits (757), Expect = 1.190e-99
Identity = 134/213 (62.91%), Postives = 170/213 (79.81%), Query Frame = 3
Query:  480 MGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            MGYCLFYESMLNTVL ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:    1 MGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 208          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q99873|ANM1_HUMAN (Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3)

HSP 1 Score: 479.174 bits (1232), Expect = 2.488e-168
Identity = 233/335 (69.55%), Postives = 282/335 (84.18%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL+ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   44 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 371          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q28F07|ANM1_XENTR (Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=prmt1 PE=2 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 2.833e-168
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KV+DL+F SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   24 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q6VRB0|ANM1B_XENLA (Protein arginine N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=prmt1-b PE=1 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 5.641e-168
Identity = 233/335 (69.55%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+VSN C++KEV++Y +KV+DL+F SPF L +++NDYIHA+VA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G  S+KPNA+NNRDLD  ++I F+G++ ++  +  YRMR
Sbjct:   24 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLNPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVSNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHAMVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQLCELSCSTDYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q63009|ANM1_RAT (Protein arginine N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Prmt1 PE=1 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 6.832e-168
Identity = 233/335 (69.55%), Postives = 281/335 (83.88%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGARKVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTVL ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+V+N C++KEV++Y +KVEDL+F SPF L +++NDY+HALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   ++PNA+NNRDLD  I++ F+G++ ++  +  YRMR
Sbjct:   26 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR 353          
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q8AV13|ANM1A_XENLA (Protein arginine N-methyltransferase 1-A OS=Xenopus laevis OX=8355 GN=prmt1-a PE=1 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 1.106e-167
Identity = 235/340 (69.12%), Postives = 282/340 (82.94%), Query Frame = 3
Query:   99 GDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            G    A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HN+HL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV++ARDKWL   G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI+ VA+ EPLVDVV+P Q+VSN C++KEV++Y +KV+DLSF SPF L +++NDYIHALVA+FNI+FT  HK  GFST P +   THWKQTVFY++    D LTV  GEEI G   +KPNA+NNRDLD   +I F+G++ ++  +  YRMR
Sbjct:   37 GVKTNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTPDGLIFPDRATLYITAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVSNACLIKEVDIYTVKVDDLSFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYME----DYLTVKTGEEIFGTIGMKPNAKNNRDLDFTFDIDFKGQLCELSCSTDYRMR 369          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: A0A4Y5WRE5 (Protein arginine methyltransferase 1 OS=Dugesia japonica OX=6161 GN=Prmt1 PE=2 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 339/347 (97.69%), Postives = 347/347 (100.00%), Query Frame = 3
Query:   78 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            MEHAS+NGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGA+KVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELP+DVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSF+SPFTLA+RKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDI+IE+KFRGKISQMEETF+YRMR
Sbjct:    1 MEHASVNGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGAKKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPEDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFSSPFTLAVRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDISIEVKFRGKISQMEETFNYRMR 347          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: H2ESD9 (Protein arginine methyltransferase 1-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 340/343 (99.13%), Postives = 341/343 (99.42%), Query Frame = 3
Query:   78 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFS 1106
            MEHASINGDAIEASDMTSKDYYFDSYAHFGI EEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVND+LTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETF 
Sbjct:    1 MEHASINGDAIEASDMTSKDYYFDSYAHFGIPEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDALTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFQ 343          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: A0A504Z1W6 (Arginine methyltransferase 1 OS=Fasciola gigantica OX=46835 GN=FGIG_00455 PE=3 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 264/350 (75.43%), Postives = 302/350 (86.29%), Query Frame = 3
Query:   87 ASINGDAI------EASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            AS+NG A        +S+MTSKDYYFDSYAHFGIHEEMLKDE RTLTYR+AL HNKHLVKDKVVLDVGCGTGILC+FA+KAGAR  IGI+CSNIID A EI+KAN M D+ITLIKGKVEEVELPD   KVDIIISEWMGYCLFYESMLNTVLFARDKWL  GGIIMPD+ATL++CAIEDRQYKDEKINWW++VYGFDMSCIRKVA++EPLVDVV+PNQ+V+N C+VKEV+MY I V+DLSF +PFTL  ++NDYI ALV FFNIDFT  HK  GFSTGP +RR THWKQTVFYLD+G +D LTV  GE++ G  S+KPNARNNRDLDI+++I F G++S M+  F+YRMR
Sbjct:    2 ASVNGGASGDVEEKSSSEMTSKDYYFDSYAHFGIHEEMLKDETRTLTYRSALIHNKHLVKDKVVLDVGCGTGILCLFAIKAGARHAIGIECSNIIDRAMEIVKANNMSDRITLIKGKVEEVELPDGFCKVDIIISEWMGYCLFYESMLNTVLFARDKWLAPGGIIMPDRATLYVCAIEDRQYKDEKINWWDSVYGFDMSCIRKVALTEPLVDVVDPNQVVTNCCLVKEVDMYTITVDDLSFTAPFTLTCKRNDYIQALVTFFNIDFTCCHKPTGFSTGPDERRYTHWKQTVFYLDNGEDDCLTVKKGEQVNGSMSIKPNARNNRDLDISVKILFEGELSSMDSVFNYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: A0A4E0R8A4 (Arginine methyltransferase 1 OS=Fasciola hepatica OX=6192 GN=D915_007414 PE=3 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 264/350 (75.43%), Postives = 302/350 (86.29%), Query Frame = 3
Query:   87 ASINGDAI------EASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            AS+NG A        +S+MTSKDYYFDSYAHFGIHEEMLKDE RTLTYR+AL HNKHLVKDKVVLDVGCGTGILC+FA+KAGAR  IGI+CSNIID A EI+KAN M D+ITLIKGKVEEVELPD   KVDIIISEWMGYCLFYESMLNTVLFARDKWL  GGIIMPD+ATL++CAIEDRQYKDEKINWW++VYGFDMSCIRKVA++EPLVDVV+PNQ+V+N C+VKEV+MY I V+DLSF +PFTL  ++NDYI ALV FFNIDFT  HK  GFSTGP +RR THWKQTVFYLD+G +D LTV  GE++ G  S+KPNARNNRDLDI+++I F G++S M+  F+YRMR
Sbjct:    2 ASVNGGASGDVEEKSSSEMTSKDYYFDSYAHFGIHEEMLKDETRTLTYRSALIHNKHLVKDKVVLDVGCGTGILCLFAIKAGARHAIGIECSNIIDRAMEIVKANNMSDRITLIKGKVEEVELPDGFCKVDIIISEWMGYCLFYESMLNTVLFARDKWLAPGGIIMPDRATLYVCAIEDRQYKDEKINWWDSVYGFDMSCIRKVALTEPLVDVVDPNQVVTNCCLVKEVDMYTITVDDLSFTAPFTLTCKRNDYIQALVTFFNIDFTCCHKPTGFSTGPDERRYTHWKQTVFYLDNGEDDCLTVKKGEQVNGSMSIKPNARNNRDLDISVKILFEGELSSMDSVFNYRMR 351          
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Match: C7TY98 (Arginine methyltransferase 1 OS=Schistosoma japonicum OX=6182 GN=Art1 PE=2 SV=1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 254/338 (75.15%), Postives = 300/338 (88.76%), Query Frame = 3
Query:  105 AIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A E+SDMTSKDYYFDSYAHFGIHEEMLKDE+RTLTYR+AL HNKHLVKDKVVLDVGCGT ILC+FA+KAGA+  IGI+CSNIID A E+++AN M D+ITLIKGKVEEVELP +  KVDI+ISEWMGYCLFYESMLNTV++ARDKWL  GGIIMPD+ATL++CAIEDRQYKDEKINWW++VYGFDMSCIRKVA++EPLVDVV+PNQ+V+N C+VKEV+MY I V DL+F++PFTL  ++NDYI ALV FFNIDFTS HK  GFSTGP +RR THWKQTVFYLD+G +D LTV  GE+I G+ S+KPN RNNRDLDI I+++F G++S ++ TF+YRMR
Sbjct:   23 ATESSDMTSKDYYFDSYAHFGIHEEMLKDEIRTLTYRSALIHNKHLVKDKVVLDVGCGTAILCLFAIKAGAKHAIGIECSNIIDRAVEVVRANNMSDRITLIKGKVEEVELPPEFPKVDIVISEWMGYCLFYESMLNTVIYARDKWLAPGGIIMPDRATLYVCAIEDRQYKDEKINWWDSVYGFDMSCIRKVALTEPLVDVVDPNQVVTNCCLVKEVDMYSITVPDLTFSAPFTLTCKRNDYIQALVTFFNIDFTSCHKPTGFSTGPDERRYTHWKQTVFYLDNGDDDCLTVKKGEQINGVMSIKPNERNNRDLDINIKVEFEGELSSIDTTFNYRMR 360          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:103022674])

HSP 1 Score: 485.723 bits (1249), Expect = 4.855e-172
Identity = 237/335 (70.75%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN+++HNKHL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V  VDIIISEWMGYCLFYESMLNTV++ARDKWLK  G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI++VA+ EPLVDVV+P Q+VS+ C++KEV++Y +K+EDLSF SPF L +++NDYIHALV +FNI+FT  HK  GFST P +   THWKQTVFYLD    D LTV  GEEI G  S+KPN +NNRDLD  ++I F+G++ +M +T  YRMR
Sbjct:   35 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELP--VEHVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYLD----DYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEMSKTSEYRMR 362          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt8b (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:103024775])

HSP 1 Score: 451.055 bits (1159), Expect = 1.708e-157
Identity = 219/337 (64.99%), Postives = 271/337 (80.42%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKHL KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIK+N ++D IT+ KGKVEE ELP D  +VDII+SEWMGYCLFYESML TV++ARDKWLK GG + PD+ATL++ AIEDRQYKD KI+WWENVYGFDM+CIR VA+ EPLVD+V+P Q+V+N C++KEV++Y +K+EDL+F S F L I++NDYIHALV +FNI+FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI G  ++KPN  N RDLD   E+ F+G++     +  Y+MR
Sbjct:   84 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHLFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDDVITIFKGKVEETELPVD--QVDIIVSEWMGYCLFYESMLKTVIYARDKWLKPGGYMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLIKEVDIYTVKLEDLAFTSAFCLQIQRNDYIHALVTYFNIEFTKCHKKTGFSTAP-DAPSTHWKQTVFYLE----DYLTVRRGEEILGSIAVKPNENNERDLDFTFELDFKGQLCDAAISHDYKMR 413          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:103022674])

HSP 1 Score: 441.81 bits (1135), Expect = 2.216e-155
Identity = 218/318 (68.55%), Postives = 264/318 (83.02%), Query Frame = 3
Query:  165 GIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            G   EMLKDEVRTLTYRN+++HNKHL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KANK++  +T+IKGKVEEVELP  V  VDIIISEWMGYCLFYESMLNTV++ARDKWLK  G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI++VA+ EPLVDVV+P Q+VS+ C++KEV++Y +K+EDLSF SPF L +++NDYIHALV +FNI+FT  HK  GFST P +   THWKQTVFYLD    D LTV  GEEI G  S+KPN +NNRDLD  ++I F+G++ +M +T  YRMR
Sbjct:    6 GASGEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELP--VEHVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEVDIYTVKIEDLSFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTGFSTSP-ESPYTHWKQTVFYLD----DYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKGQLCEMSKTSEYRMR 316          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt6 (protein arginine methyltransferase 6 [Source:NCBI gene;Acc:448867])

HSP 1 Score: 221.09 bits (562), Expect = 3.284e-68
Identity = 129/332 (38.86%), Postives = 200/332 (60.24%), Query Frame = 3
Query:  141 YFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENV---YGFDMSCIRKVAVS-----EPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFAS-PFTLAIRKNDYIHALVAFFNIDFTSSH-KHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFS 1106
            YF SYA   IHEEML D VRT TYR A++     +  K VLDVG GTG+L +F  +AGAR+V  ++ S+I + A  I++ N++ED++ +I+G VE VELP+   +VD+I+SEWMGY L +ESMLN+V+ ARD+WLK GG+I+P++A L +  I D    +E++N+W+ V   YG DMSC+ + A S     E  V  V    ++S+ C   ++++  + +E+L   S  F      +  ++AL  +F + F +     +  ST P  +  THWKQ V YLD+ V+    V    ++ G  S+ P+ +++R + I ++    G+  Q  +TFS
Sbjct:   33 YFQSYADVSIHEEMLADTVRTDTYRRAIFRCAAALAGKAVLDVGAGTGVLSVFCAQAGARRVYAVEASSIAEQAARIVRQNRVEDRVQVIRGTVESVELPE---RVDVIVSEWMGYALLHESMLNSVITARDRWLKPGGLILPERAELFVAPISD-LVAEERLNFWDTVKGQYGVDMSCMAEFARSCVLNGEIAVHPVTVEDVLSHPCRFAQLDLRTVTLEELKRVSGAFCCQCFGSSSLNALCVWFTVTFPAEDMPPLVLSTSPF-KAETHWKQAVLYLDEPVD----VRQDTKVEGNISMYPSEKSSRYVCIHVDYTV-GEHKQKSKTFS 354          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Match: prmt3 (protein arginine methyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-041105-1])

HSP 1 Score: 218.009 bits (554), Expect = 3.207e-66
Identity = 107/203 (52.71%), Postives = 155/203 (76.35%), Query Frame = 3
Query:  141 YFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVK 749
            YF SY H+ IHEEMLKD VRT +YR+ +Y N  + KDKVVLDVGCGTGIL MFA ++GA+KVI +D S II  A +I+++N++E+ ITLIKG++E+V+LP  V KVDIIISEWMGY L +ESML++VL+ARD++L  GG++ PD+  + L A+ D +   ++I +W+NVYGF M C+++V + E +V+V+ P  ++S   +++
Sbjct:  219 YFSSYGHYSIHEEMLKDTVRTESYRDFIYGNPDVFKDKVVLDVGCGTGILSMFAARSGAKKVIAVDQSEIIYQAIDIVRSNQLENTITLIKGRIEDVDLP--VEKVDIIISEWMGYFLLFESMLDSVLWARDRYLADGGLVFPDRCIISLAAVGDTEKHSDRIAFWDNVYGFKMECMKEVVIPEAVVEVLKPETVISEPAVIQ 419          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Match: prmt1 (protein arginine methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-693])

HSP 1 Score: 478.404 bits (1230), Expect = 5.612e-170
Identity = 234/345 (67.83%), Postives = 281/345 (81.45%), Query Frame = 3
Query:   84 HASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            + S+ G A  A +MTSKDYYFDSYAHFGIHEEMLKDEVRT TYRNA+YHN+HL KDKVVLDVG GTGILCMFA KAGA+KV GI+CSNI DY+++IIKAN ++  IT++KGKVEEV+L  D  KVDIIISEWMGYCL YESMLNTV+ ARDKWLK GG I PD+A+L L AIEDRQYK+ KINWWE+VYGFDMSCIR VA+ EPLVDVV P Q+V+N C+VKEV++Y +KV+DL+F SPF L +R+ DY+HALVA+F ++FT  HK  GFST P D   THWKQTVFYL +   D LTV  GEEI G  SL+PNA+NNRDLD  I+++F+G++ ++  +  YRMR
Sbjct:   14 NGSVEGTAPNADEMTSKDYYFDSYAHFGIHEEMLKDEVRTRTYRNAMYHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVFGIECSNIADYSQQIIKANNLDSVITIVKGKVEEVDLLVD--KVDIIISEWMGYCLLYESMLNTVICARDKWLKPGGAIFPDRASLFLTAIEDRQYKENKINWWEDVYGFDMSCIRDVAIQEPLVDVVEPKQVVTNSCLVKEVDIYTVKVDDLTFTSPFCLQVRRADYVHALVAYFTVEFTRCHKRTGFSTAP-DAPYTHWKQTVFYLKE---DCLTVKPGEEIYGTISLRPNAKNNRDLDFTIDVEFKGQLCEVSSSQEYRMR 352          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Match: prmt2 (protein arginine methyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-041104-1])

HSP 1 Score: 188.734 bits (478), Expect = 8.416e-56
Identity = 116/342 (33.92%), Postives = 190/342 (55.56%), Query Frame = 3
Query:  120 DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVK-AGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHL--CAIEDRQYKDEKINWWENVYGFDMSCIRKVAV----SEPLVD-VVNPNQIVSNFCIVKEVNMYEIKVEDL-SFASPFTLAIRKNDYIHALVAFFNIDF--TSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYR 1112
            D    D YF+SY+   + +EML D VRT TY   +  ++  ++ K VLDVGCG+GI+ M   K A   +V  ++ S +    +++++ N M+D + +++G+VE+VELP     VD ++SEWMG CL +E M+ +VL ARD+WL+ GG++ P  A LHL  C+ + R+Y D KI +W+  Y  D S +R  A     S+P  D  ++P+  ++  C + +++M +++  +L      F   ++K   +H   A+F+ +F    S+  I   TGP     THWKQT+F LD  V     V  G+ + G  +L+ N    R + +A    FR +++   +  S R
Sbjct:   92 DTWQDDEYFNSYSKLKLQQEMLADRVRTETYGAVMKRSRAWLRGKAVLDVGCGSGIISMLCAKHAQPSRVYAVEASELARLTEQVVRCNGMKDTVRVLQGRVEDVELPG---SVDCLVSEWMGTCLLFEFMIESVLQARDRWLRDGGVMWPSTAALHLTPCSAQ-REYTD-KIGFWDWQYELDFSQLRTEAAKEYFSKPKHDHQMDPDDCLAEPCCILQLDMSKVQTSELEEITYEFIFEVKKAGPMHGFAAWFSTEFKCPDSNPSIILDTGPMS-TATHWKQTLFMLDSPV----AVTPGDFVVGSVALRRNPVWRRHMSVA----FRWRVAPSTDATSRR 419          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Match: carm1 (coactivator-associated arginine methyltransferase 1 [Source:NCBI gene;Acc:445251])

HSP 1 Score: 181.03 bits (458), Expect = 1.631e-51
Identity = 121/351 (34.47%), Postives = 191/351 (54.42%), Query Frame = 3
Query:   66 LLKNMEHASINGDAI-EASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDE---KINWW--ENVYGFDMSCIRKVAVSE----PLVDVVNPNQIVSNFCIVKEVNMYEIKVEDL-SFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKIS 1085
            LLK+ +  S+      E ++ +S   YF  Y +    + M++D +RT TY+ A+  N    +DK+VLDVGCG+GIL  FAV+AGARKV  ++ S++  +A+ ++++N ++D+I +I GKVE+V +PD   KVD+IISE MGY LF E ML + L A+ KWLK  G + P    +HL    D Q   E   K N+W  ++ +G D+S +R  A+ E    P+VD  +  +I+    I   VN  + + EDL     PF   + ++  +H L  +F++ F  S   +  ST P++   THW Q    L       L    G+ ++G   +  N R + D+++   +   G  S
Sbjct:   99 LLKSCQGRSVERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYIRTGTYQRAILQNHADFRDKIVLDVGCGSGILSFFAVQAGARKVYAVEASSMAQHAEVLVRSNNLQDRIVVIPGKVEDVSIPD---KVDVIISEPMGYMLFNERMLESYLHAK-KWLKPNGNMFPTLGDVHLAPFTDEQLYMEQFSKANFWYQQSFHGVDLSSLRGAALEEYFRQPIVDTFD-IRILMARSIKYTVNFQQAREEDLHRIEIPFKFQMLQSGLVHGLAFWFDVAFVGSMLTVWLSTAPTEPL-THWYQVRCLLQ----SPLFTKAGDTLSGTVVMIANKRQSYDINLVAVVDQTGSKS 439          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Yeast
Match: HMT1 (Nuclear SAM-dependent mono- and asymmetric methyltransferase; modifies hnRNPs, including Npl3p and Hrp1p, affecting their activity and nuclear export; methylates U1 snRNP protein Snp1p, ribosomal protein Rps2p, and histones H3 and H4; interacts genetically with genes encoding components of Rpd3(L) and this interaction is important for Rpd3 recruitment to the subtelomeric region [Source:SGD;Acc:S000000238])

HSP 1 Score: 312.383 bits (799), Expect = 6.716e-105
Identity = 167/335 (49.85%), Postives = 227/335 (67.76%), Query Frame = 3
Query:   78 MEHASINGDAIEASDMT-SKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTS--SHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFR 1073
            M   ++   A E + ++ S+ +YF+SY H+GIHEEML+D VRTL+YRNA+  NK L KDK+VLDVGCGTGIL MFA K GA+ VIG+D S+II+ AKE+++ N   DKITL++GK+E+V LP    KVDIIISEWMGY L YESM++TVL+ARD +L  GG+I PDK ++HL  +ED QYKDEK+N+W++VYGFD S    + + EP+VD V  N + +    + E ++  +K+ DL+F S F L  ++ D I+ +V +F+I F +    + + FSTGP     THWKQT+FY      D L    G+ I G     PN +NNRDL+I I  KF 
Sbjct:    1 MSKTAVKDSATEKTKLSESEQHYFNSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLP--FPKVDIIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLEDSQYKDEKLNYWQDVYGFDYSPFVPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDLAFKSNFKLTAKRQDMINGIVTWFDIVFPAPKGKRPVEFSTGPHAPY-THWKQTIFYFP----DDLDAETGDTIEGELVCSPNEKNNRDLNIKISYKFE 328          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO47611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI7])

HSP 1 Score: 455.677 bits (1171), Expect = 2.276e-160
Identity = 229/335 (68.36%), Postives = 272/335 (81.19%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            AS+MTS DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKHL +DK+VLDVGCGTGIL MFA KAGA+ V  I+ S+I+DY+K IIK N  +  ITLIKGKVE+VELP  V KVDIIISEWMGYCLFYESML+TVL+ARDKWLK  G++ PDKA L++CAIEDRQYK+EKI WW+ VYGFDMS IRKVA+SEPLVDVV+P Q+V+N C+VKEV++  +K EDL+F +PF L   +NDY+HALV+FF I+FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEITG   ++PNARNNRD+D  I I+F G++S  ++   YRMR
Sbjct:   53 ASEMTSADYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHLFRDKIVLDVGCGTGILSMFAAKAGAKHVYAIEMSSIVDYSKTIIKDNNFDSVITLIKGKVEDVELP--VEKVDIIISEWMGYCLFYESMLDTVLYARDKWLKPDGMLFPDKAKLYVCAIEDRQYKEEKIYWWDRVYGFDMSSIRKVALSEPLVDVVDPKQVVTNSCMVKEVDIQTVKKEDLNFTAPFRLYCHRNDYVHALVSFFTIEFTHCHKRTGFSTAP-DCPYTHWKQTVFYLE----DYLTVKYGEEITGSIHMEPNARNNRDIDFNIGIQFEGELSNYDKEQKYRMR 380          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO49961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER6])

HSP 1 Score: 290.041 bits (741), Expect = 2.612e-93
Identity = 158/313 (50.48%), Postives = 209/313 (66.77%), Query Frame = 3
Query:  141 YFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKH-IGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRG 1076
            YF SY+HFGIHEEMLKD+VRT +YR+ +Y N  + KDKVVLDVGCGTGIL MFA ++GAR+VIGID S II  A +II+ N  E  ITLIKGK EEV LP  V +VD+IISEWMGY L +ESML+TVLF RDKWL   G + PDK T+HL AI   + K  KIN+W++VYGF MSC++K    E  ++ V+ + ++S  C +K +++   K EDL+F S F   I+K D+   +V++F+I F    K  + FST P+    THWKQ +FY      + + V  G+ +TG  S   N +  R LD+ IE+  +G
Sbjct:  223 YFSSYSHFGIHEEMLKDKVRTESYRDFIYGNPDIFKDKVVLDVGCGTGILSMFAARSGARQVIGIDQSEIIYQAMDIIRENGFEKTITLIKGKAEEVTLP--VEQVDVIISEWMGYFLLFESMLDTVLFCRDKWLNPQGSVYPDKCTMHLVAIGTGEKKQPKINFWDDVYGFKMSCMKKTVSKEAAIETVDVDALISTHCTIKSIDINSCKKEDLNFISSFRFEIKKPDFFTGIVSYFDIFFEHEAKEKVVFSTSPA-HTPTHWKQAIFYF----QNPIPVTQGQILTGHISCYKNLKEPRSLDVRIEVVDKG 528          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO39146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAV4])

HSP 1 Score: 176.022 bits (445), Expect = 5.412e-51
Identity = 125/323 (38.70%), Postives = 175/323 (54.18%), Query Frame = 3
Query:  135 DYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAG-ARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFD----MSCIRKVAVSEPLVD-VVNPNQIVSNFCIVKEVNMYEIKVEDLSF-ASPFTLAIRKNDYIHALVAFFNIDFTS-------SHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIE 1061
            D YF  Y    IH EMLKD+ RT +YR A+       KDKVVLDVGCGTGIL +F  + G A KV  ++ S I    +EIIK N ++DKIT+I+GK+EEVELP+   KVDII+SEWMG  L +E ML +VL ARD WLK  G++ P +A L L     +   DE I+ W + YGFD    +S  ++  +S P+ + V N    +S    + +++  +    DL   A  F   I ++  ++   ++F++ F +        +  +  STGP     THWKQ +F LD      L V   + I G   LK N    R L +  +
Sbjct:   67 DEYFADYGSLKIHLEMLKDKPRTESYRMAIEQGAGYFKDKVVLDVGCGTGILSLFCAREGKASKVYAVEASEIAKLTEEIIKQNNLDDKITVIQGKIEEVELPE---KVDIIVSEWMGTFLVFEFMLESVLTARDIWLKPNGLVWPSEAKLFLVPCCTKTAYDEVIHIWRDQYGFDYSPAISKAKQEFLSRPIYNHVFNYEDCISTPQPIIKLDTLKTARHDLEHSAHGFEFVIEQDSMLYGFCSWFDVLFGNIPHGEDKRNSAVVLSTGPQCDL-THWKQDLFLLD----MPLPVQENDLIKGSICLKRNPDFRRHLSVVFD 381          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO28377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M8])

HSP 1 Score: 92.4337 bits (228), Expect = 1.162e-22
Identity = 48/142 (33.80%), Postives = 79/142 (55.63%), Query Frame = 3
Query:  642 NVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKH-IGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEI 1064
            ++ GF MSC++K    E  ++ V+ + ++S  C +K +++   K EDL+F S F   I+K D+   +V++F+I F    K  + FST P+    THWKQ +FY      + + V  G+ +TG  S   N +  R LD+ IE+
Sbjct:    1 DLAGFKMSCMKKTVSKEAAIETVDVDALISTHCTIKSIDINSCKKEDLNFISSFRFEIKKPDFFTGIVSYFDIFFEHEAKEKVVFSTSPA-HTPTHWKQAIFYF----QNPIPVTQGQILTGHISCYKNLKEPRSLDVRIEV 137          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO38718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBZ7])

HSP 1 Score: 58.5362 bits (140), Expect = 2.453e-9
Identity = 55/193 (28.50%), Postives = 94/193 (48.70%), Query Frame = 3
Query:  171 HEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNII-DYAKEIIKANKMEDKITLIKGKVEEVELPDDVL-KVDIIISEWMGYCLFYESMLNTVLFARDKWL-----------------KTGGI---IMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVA 683
            H  ML D  R L Y+ A+  N       +VLD+G G+GIL MFAV+AGA+KV   + S  + + +K+++  N+ME  I +I  K  ++ +  D+  +V ++ +E +   L  E +L T+  A +  L                 +T GI   ++P  A L+   IE    + +      NV GF++  ++ + 
Sbjct:  137 HFRMLNDRQRNLAYKKAI-SNAVSNGCDIVLDIGSGSGILSMFAVQAGAKKVYACEMSKTMYELSKDVLLGNQMESFIEVIHKKSTDLLIGKDLPGRVSLVCTETLDCGLLGEGILKTISHAWEALLQEKKSITSTEQQIDGVVRTSGISPMVIPRGAKLYGQVIESSDIRHQSY-CRPNVAGFNVRIVKVIG 327          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:101173551])

HSP 1 Score: 483.797 bits (1244), Expect = 1.664e-171
Identity = 235/335 (70.15%), Postives = 283/335 (84.48%), Query Frame = 3
Query:  114 ASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            A DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN++++NKHL KDKVVLDVG GTGILCMFA KAGA+KVIGI+CS+I DYA +I+KAN M+D +T+IKGKVEEVELP D  KVDIIISEWMGYCLFYESMLNTV++ARDKWLK  G+I PD+ATL++ AIEDRQYKD KI+WWENVYGFDMSCI++VA+ EPLVDVV+P Q+VSN C+++EV++Y +K EDL+F SPF L +++NDYIHALV +FNI+FT  HK IGFST P +   THWKQTVFYL+    D LTV +GEEI G  S+KPN +NNRDLD  +++ F G++  M ++  YRMR
Sbjct:   21 AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFYNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANNMDDVVTIIKGKVEEVELPVD--KVDIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSNSCLIREVDIYTVKAEDLTFTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRIGFSTSP-ESPYTHWKQTVFYLE----DYLTVKSGEEIFGTISMKPNVKNNRDLDFTVDVDFTGQLCTMTKSLEYRMR 348          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020054.2 (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101162208])

HSP 1 Score: 454.907 bits (1169), Expect = 3.823e-159
Identity = 221/337 (65.58%), Postives = 276/337 (81.90%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIK+N ++  IT+ KGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV+FARDKWLK GG++ PD+A+L++ AIEDRQ+KD KI+WWENVYGFDM+CIR VA+ EPLVDVV+P Q+V+N C+VKEV++Y +K EDL+F+S F L I++NDYIHALV +F+++FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI+G  S+KPN +N RDLD  +E+ F+G++ +      Y+MR
Sbjct:   81 LTPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRASLYVLAIEDRQFKDFKIHWWENVYGFDMTCIRNVAMKEPLVDVVDPKQVVTNSCLVKEVDIYTVKPEDLTFSSTFCLQIQRNDYIHALVTYFSVEFTKCHKKTGFSTAP-DAAYTHWKQTVFYLE----DYLTVRRGEEISGSISMKPNEKNIRDLDFTVELDFKGQLCEAAIAHDYKMR 410          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: prmt8b (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101155736])

HSP 1 Score: 451.44 bits (1160), Expect = 7.061e-158
Identity = 221/337 (65.58%), Postives = 271/337 (80.42%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            I   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRNA+YHNKH+ KDK+VLDVG GTGIL MFA  AGA+ V GI+CS+I +Y+++IIK+N M + IT+ KGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV+FARDKWLK GG++ PD+A L++ AIEDRQYKD KI+WWENVYGFDMSCIR +A+ EPLVDVV+  Q+V+N C++KEV++Y +K EDLSF S F L I++N Y+HALV +FNI+FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI G  S++PN +N RDL+  +E+ F+G++ +   +  Y+MR
Sbjct:   76 ISPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSMFAANAGAKHVYGIECSSISEYSEKIIKSNHMHNAITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMSCIRNIAIKEPLVDVVDHKQVVTNSCLLKEVDIYTVKPEDLSFTSAFCLQIQRNHYVHALVTYFNIEFTKCHKKTGFSTAP-DAPSTHWKQTVFYLE----DYLTVKKGEEIFGSLSVRPNEKNVRDLEFTLELDFKGQLCEAAISHDYKMR 405          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018691.2 (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101162208])

HSP 1 Score: 401.749 bits (1031), Expect = 1.069e-138
Identity = 204/337 (60.53%), Postives = 258/337 (76.56%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            +   +MTS+DYYFDSYAHFGIHEEMLKDEVRTLTYRN++YHNKH+ KDK+VLDVG GTGIL MFA KAGA+ V GI+CS+I +Y+++IIK+N ++  IT+ KGKVEEVELP  V KVDIIISEWMGYCLFYESMLNTV+FARDKWL     ++P +    +  +   +     +  WENVYGFDM+CIR VA+ EPLVDVV+P Q+V+N C+VKEV++Y +K EDL+F+S F L I++NDYIHALV +F+++FT  HK  GFST P D   THWKQTVFYL+    D LTV  GEEI+G  S+KPN +N RDLD  +E+ F+G++ +      Y+MR
Sbjct:   55 LTPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIFARDKWL-----MLPLEEVEKVLKVCVNKVTPLFLAGWENVYGFDMTCIRNVAMKEPLVDVVDPKQVVTNSCLVKEVDIYTVKPEDLTFSSTFCLQIQRNDYIHALVTYFSVEFTKCHKKTGFSTAP-DAAYTHWKQTVFYLE----DYLTVRRGEEISGSISMKPNEKNIRDLDFTVELDFKGQLCEAAIAHDYKMR 379          
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Match: prmt3 (protein arginine methyltransferase 3 [Source:NCBI gene;Acc:101174166])

HSP 1 Score: 273.092 bits (697), Expect = 1.161e-86
Identity = 142/319 (44.51%), Postives = 220/319 (68.97%), Query Frame = 3
Query:  141 YFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDF-TSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQME 1094
            YF SY H+GIHEEMLKD+VRT +YR+ +Y N  + +DKVVLDVGCGTGIL MFA +AGA +VIG+D S+I+  A +II++N++EDKITLIKG++E+++LP  V KVDIIISEWMGY L +ESML++V++ARD +L  GG + PD   + L A+ D+    +++ +W++VYGF+MSC++K A+ E LV+VV  + ++S   +++ ++   + + +L F + F L + K     A+V +F+I F    +  + FSTGP   + THWKQTVF L+  +    +V  G+E+ G   ++ N ++ R L + I+++ R +   ++
Sbjct:  202 YFSSYGHYGIHEEMLKDKVRTESYRDFMYRNPDVFRDKVVLDVGCGTGILSMFAARAGATQVIGVDQSDIVYQAMDIIRSNQLEDKITLIKGRIEDIKLP--VAKVDIIISEWMGYFLLFESMLDSVVYARDLYLSDGGSVYPDLCNISLAAVGDKHKHHDRVAFWDDVYGFNMSCMKKAALPEALVEVVKMDTVISEPTVIQTIDCNRVCLSELEFTTDFCLRMTKTTVCTAIVGYFDIFFDKDCNNKVMFSTGPQVTK-THWKQTVFLLERPI----SVQAGDELQGKILVRKNKKDPRALWVTIDLRDRKQTYSLQ 513          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038804.1 (SMESG000038804.1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 3
Query:   78 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR
Sbjct:    1 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 347          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 258/347 (74.35%), Postives = 313/347 (90.20%), Query Frame = 3
Query:   78 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            M+H   N +A++ +DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGA++VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+F++PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D++ V  GEEI G+FSLKPNA NNR +D++I++KF+G++  +++ ++Y M+
Sbjct:    1 MDH---NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAVNNRAIDVSIDLKFKGELKTVDKVYNYSMK 344          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 254/337 (75.37%), Postives = 307/337 (91.10%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            ++ +DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGA++VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+F++PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D++ V  GEEI G+FSLKPNA NNR +D++I++KF+G++  +++ ++Y M+
Sbjct:    1 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAVNNRAIDVSIDLKFKGELKTVDKVYNYSMK 337          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 256/347 (73.78%), Postives = 311/347 (89.63%), Query Frame = 3
Query:   78 MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            M+H   N +A++ +DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGA++VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+F++PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D++ V  GEEI G+FSLKPNAR    +D++I++KF+G++  +++ ++Y M+
Sbjct:    1 MDH---NSNAMDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 341          
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 252/337 (74.78%), Postives = 305/337 (90.50%), Query Frame = 3
Query:  108 IEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALYHNKHXXXXXXXXXXGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIKANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLFARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRKVAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKNDYIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLTVNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR 1118
            ++ +DMT+KDYYFDSYAHFGIHEEMLKDE+RT++YRNALYHN+HLVKDKVVLDVGCGTGILCMFAV+AGA++VIGIDCSNIIDYAKEI+KANKM+ KITLIKGKVEEVELP DVLKVD+IISEWMGYCL YESMLNTVLFARDKWL  GGIIMPDKATLH+ AIEDR+YKDEKINWW+NVYGFDMSCIRK A SEPLVDVVNP+QIVS+ C+VKE+NMY+I V+DL+F++PFTL++ +NDY+HA+V +FNI+FTSS K I FST P+ RR THWKQ+VFYLDDG +D++ V  GEEI G+FSLKPNAR    +D++I++KF+G++  +++ ++Y M+
Sbjct:    1 MDTNDMTAKDYYFDSYAHFGIHEEMLKDEIRTISYRNALYHNEHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAPGGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDITVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKPITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA---IDVSIDLKFKGELKTVDKVYNYSMK 334          
The following BLAST results are available for this feature:
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRMT12.821e-16969.55protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT15.180e-16969.55protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT11.218e-16769.58protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT84.309e-16266.77protein arginine methyltransferase 8 [Source:HGNC ... [more]
PRMT85.470e-16266.77protein arginine methyltransferase 8 [Source:HGNC ... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prmt-11.573e-13959.58Protein arginine N-methyltransferase 1 [Source:Un... [more]
prmt-11.573e-13959.58Protein arginine N-methyltransferase 1 [Source:Un... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Art11.999e-16966.57gene:FBgn0037834 transcript:FBtr0082304[more]
Art22.019e-8241.96gene:FBgn0031592 transcript:FBtr0077476[more]
Art22.019e-8241.96gene:FBgn0031592 transcript:FBtr0345748[more]
Art62.467e-8040.92gene:FBgn0038189 transcript:FBtr0082878[more]
Art31.403e-6942.53gene:FBgn0038306 transcript:FBtr0083135[more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt12.406e-17170.45protein arginine methyltransferase 1 [Source:ZFIN;... [more]
prmt8b1.443e-15864.99protein arginine methyltransferase 8b [Source:NCBI... [more]
prmt8b9.798e-15864.99protein arginine methyltransferase 8b [Source:NCBI... [more]
prmt8b1.014e-15764.99protein arginine methyltransferase 8b [Source:NCBI... [more]
PRMT86.515e-15764.99protein arginine N-methyltransferase 8-B-like [Sou... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
il1rap2.064e-16969.55interleukin 1 receptor accessory protein [Source:X... [more]
il1rap4.662e-16969.55interleukin 1 receptor accessory protein [Source:X... [more]
il1rap4.874e-16969.55interleukin 1 receptor accessory protein [Source:X... [more]
il1rap5.069e-16969.55interleukin 1 receptor accessory protein [Source:X... [more]
il1rap5.178e-16969.55interleukin 1 receptor accessory protein [Source:X... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prmt19.767e-16969.55protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt11.894e-16869.55protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt82.619e-16266.77protein arginine N-methyltransferase 8 [Source:MGI... [more]
Prmt14.436e-15267.83protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt11.190e-9962.91protein arginine N-methyltransferase 1 [Source:MGI... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99873|ANM1_HUMAN2.488e-16869.55Protein arginine N-methyltransferase 1 OS=Homo sap... [more]
sp|Q28F07|ANM1_XENTR2.833e-16869.55Protein arginine N-methyltransferase 1 OS=Xenopus ... [more]
sp|Q6VRB0|ANM1B_XENLA5.641e-16869.55Protein arginine N-methyltransferase 1-B OS=Xenopu... [more]
sp|Q63009|ANM1_RAT6.832e-16869.55Protein arginine N-methyltransferase 1 OS=Rattus n... [more]
sp|Q8AV13|ANM1A_XENLA1.106e-16769.12Protein arginine N-methyltransferase 1-A OS=Xenopu... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y5WRE50.000e+097.69Protein arginine methyltransferase 1 OS=Dugesia ja... [more]
H2ESD90.000e+099.13Protein arginine methyltransferase 1-like protein ... [more]
A0A504Z1W60.000e+075.43Arginine methyltransferase 1 OS=Fasciola gigantica... [more]
A0A4E0R8A40.000e+075.43Arginine methyltransferase 1 OS=Fasciola hepatica ... [more]
C7TY980.000e+075.15Arginine methyltransferase 1 OS=Schistosoma japoni... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt14.855e-17270.75protein arginine methyltransferase 1 [Source:NCBI ... [more]
prmt8b1.708e-15764.99protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt12.216e-15568.55protein arginine methyltransferase 1 [Source:NCBI ... [more]
prmt63.284e-6838.86protein arginine methyltransferase 6 [Source:NCBI ... [more]
prmt33.207e-6652.71protein arginine methyltransferase 3 [Source:ZFIN;... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prmt15.612e-17067.83protein arginine methyltransferase 1 [Source:ZFIN;... [more]
prmt28.416e-5633.92protein arginine methyltransferase 2 [Source:ZFIN;... [more]
carm11.631e-5134.47coactivator-associated arginine methyltransferase ... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HMT16.716e-10549.85Nuclear SAM-dependent mono- and asymmetric methylt... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476112.276e-16068.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499612.612e-9350.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391465.412e-5138.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283771.162e-2233.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387182.453e-928.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt11.664e-17170.15protein arginine methyltransferase 1 [Source:NCBI ... [more]
ENSORLT00000020054.23.823e-15965.58protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt8b7.061e-15865.58protein arginine N-methyltransferase 8-B [Source:N... [more]
ENSORLT00000018691.21.069e-13860.53protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt31.161e-8644.51protein arginine methyltransferase 3 [Source:NCBI ... [more]
back to top
BLAST of protein arginine methyltransferase 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038804.10.000e+0100.00SMESG000038804.1[more]
SMESG000038790.10.000e+074.35SMESG000038790.1[more]
SMESG000038790.10.000e+075.37SMESG000038790.1[more]
SMESG000038790.10.000e+073.78SMESG000038790.1[more]
SMESG000038790.10.000e+074.78SMESG000038790.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010124
GenBankAEX33823.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010124 ID=SMED30010124|Name=protein arginine methyltransferase 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1223bp
AAAATATTGTAAACCATGTTTAGTTTTATTTCATAAAATAATCTATTTTA
TAATTTTATTAATATTTATTGAAGAATATGGAGCACGCATCAATCAATGG
AGATGCTATTGAAGCATCAGACATGACGTCAAAAGATTATTATTTTGATT
CATATGCTCATTTCGGGATCCATGAAGAAATGCTAAAAGATGAAGTCCGA
ACTTTAACTTACCGAAATGCTTTGTATCATAATAAGCATTTAGTAAAAGA
CAAAGTAGTTTTAGATGTTGGATGCGGAACTGGTATACTTTGCATGTTCG
CTGTTAAAGCTGGTGCCAGAAAAGTTATTGGCATTGATTGTTCTAATATA
ATCGATTATGCAAAAGAAATAATTAAAGCCAATAAAATGGAAGACAAAAT
TACCTTGATTAAAGGTAAAGTTGAGGAAGTTGAGTTACCGGATGATGTTT
TAAAAGTGGATATTATAATTAGCGAATGGATGGGATATTGTCTATTTTAT
GAATCGATGTTAAACACGGTGTTGTTTGCCCGAGACAAGTGGCTTAAAAC
TGGAGGCATTATTATGCCAGATAAAGCGACTCTCCATCTGTGTGCGATTG
AGGATAGACAATATAAAGATGAAAAGATTAATTGGTGGGAAAATGTTTAT
GGTTTTGACATGAGCTGTATTAGAAAAGTTGCTGTTTCTGAACCTCTTGT
AGATGTTGTTAATCCCAATCAAATCGTTTCCAATTTCTGCATTGTCAAAG
AAGTTAATATGTATGAAATAAAAGTCGAGGATTTATCATTTGCATCTCCA
TTCACGTTGGCAATACGAAAAAATGATTATATTCATGCTTTGGTAGCGTT
CTTCAATATTGATTTTACTTCGTCCCATAAGCATATTGGATTCTCAACTG
GCCCCAGTGATCGGCGCGGTACTCATTGGAAACAAACTGTGTTTTATTTA
GATGACGGAGTTAATGATTCTCTGACAGTCAATAATGGGGAAGAAATTAC
TGGGATATTTTCTTTAAAACCCAATGCTAGAAATAATAGGGATTTAGATA
TCGCAATTGAGATTAAATTTCGGGGCAAAATTAGCCAAATGGAGGAAACA
TTCAGTTATCGAATGCGATAATTTGAGCTGGAATCTTGTCACGGTAAAAA
TGGAATTTTACATTGAATAAATTGTTCAACTTGTCTTTTTGCTGATTGTT
TTAATATATGCTTATAATCGTTT
back to top

protein sequence of SMED30010124-orf-1

>SMED30010124-orf-1 ID=SMED30010124-orf-1|Name=SMED30010124-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MEHASINGDAIEASDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNALY
HNKHLVKDKVVLDVGCGTGILCMFAVKAGARKVIGIDCSNIIDYAKEIIK
ANKMEDKITLIKGKVEEVELPDDVLKVDIIISEWMGYCLFYESMLNTVLF
ARDKWLKTGGIIMPDKATLHLCAIEDRQYKDEKINWWENVYGFDMSCIRK
VAVSEPLVDVVNPNQIVSNFCIVKEVNMYEIKVEDLSFASPFTLAIRKND
YIHALVAFFNIDFTSSHKHIGFSTGPSDRRGTHWKQTVFYLDDGVNDSLT
VNNGEEITGIFSLKPNARNNRDLDIAIEIKFRGKISQMEETFSYRMR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016274protein-arginine N-methyltransferase activity
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0018216peptidyl-arginine methylation
GO:0035246peptidyl-arginine N-methylation
GO:0006479protein methylation
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR029063SAM-dependent_MTases
IPR025799Arg_MeTrfase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF06325PrmAcoord: 55..139
e-value: 5.7E-11
score: 42.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 10..164
e-value: 1.0E-64
score: 219.0
NoneNo IPR availableGENE3DG3DSA:2.70.160.11coord: 166..347
e-value: 1.1E-62
score: 213.1
NoneNo IPR availablePANTHERPTHR11006PROTEIN ARGININE N-METHYLTRANSFERASEcoord: 11..347
NoneNo IPR availablePANTHERPTHR11006:SF47PROTEIN ARGININE N-METHYLTRANSFERASE 8coord: 11..347
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 61..163
e-value: 1.60862E-12
score: 61.2918
IPR025799Protein arginine N-methyltransferasePROSITEPS51678SAM_MT_PRMTcoord: 19..347
score: 94.11
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 25..346