Forkhead box protein N3

Overview
NameForkhead box protein N3
Smed IDSMED30010118
Length (bp)1785
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead box protein N3 (SMED30010118) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead box protein N3 (SMED30010118) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box protein N3 (SMED30010118) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box protein N3 (SMED30010118) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010118

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010118h1SMcG0006700 BK013016smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010118h1SMcG0006700 BK013016smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal progenitor cellSMED30010118h1SMcG0006700 BK013016smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010118h1SMcG0006700 BK013016smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30010118h1SMcG0006700 BK013016smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30010118h1SMcG0006700 BK013016smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010118h1SMcG0006700 dd_Smed_v4_13005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010118h1SMcG0006700 dd_Smed_v4_13005_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXN3 (forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928])

HSP 1 Score: 109.383 bits (272), Expect = 9.584e-27
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXN3 (forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928])

HSP 1 Score: 110.153 bits (274), Expect = 5.489e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXN3 (forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928])

HSP 1 Score: 110.153 bits (274), Expect = 5.489e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXN3 (forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928])

HSP 1 Score: 110.153 bits (274), Expect = 5.489e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXN3 (forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928])

HSP 1 Score: 110.153 bits (274), Expect = 5.990e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 85.1149 bits (209), Expect = 3.448e-18
Identity = 36/79 (45.57%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVD 561
            ++P FSY  LI MAI++SP K +T+  IY +   N+P+Y +   GW+NS+RHNLS+NKCF K+ +     G+G+ W++D
Sbjct:   92 DKPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLD 170          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-6 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q10924])

HSP 1 Score: 79.337 bits (194), Expect = 6.257e-16
Identity = 39/83 (46.99%), Postives = 52/83 (62.65%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANA----IHGWKNSLRHNLSINKCFKKITKMGQG----GRGSLW 552
            ++P +SY  LI MAI+ SP K MT+N IY + E  FPYY +A      GW+NS+RHNLS+N CF K  + GQ      +G+ W
Sbjct:   20 DKPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLNDCFVKKARDGQSCANDRKGNYW 102          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-10 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:O17593])

HSP 1 Score: 75.8702 bits (185), Expect = 1.350e-15
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDP 564
            +P  SY  LI MAI +SP K M + ++Y W    +PY+ +   GW+NS+RHNLS+N CF K  +    G+G  W V P
Sbjct:   42 KPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAAN-GKGHYWAVHP 118          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-10 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:O17593])

HSP 1 Score: 75.8702 bits (185), Expect = 1.350e-15
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDP 564
            +P  SY  LI MAI +SP K M + ++Y W    +PY+ +   GW+NS+RHNLS+N CF K  +    G+G  W V P
Sbjct:   42 KPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAAN-GKGHYWAVHP 118          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: lin-31 (pep chromosome:WBcel235:II:3982549:3986944:1 gene:WBGene00003017.1 transcript:K10G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 75.485 bits (184), Expect = 3.936e-15
Identity = 36/91 (39.56%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMG-QGGRGSLWIVDPREKQHLVSTMC 597
            ++P +SY  L YMAI++S  K + + +IY +    FP+Y      W+NSLRHNLS N CF KI +   + G+GS W V P       +  C
Sbjct:   12 QKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAVHPNASGMFENGSC 102          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0310287)

HSP 1 Score: 99.3673 bits (246), Expect = 2.751e-21
Identity = 44/91 (48.35%), Postives = 66/91 (72.53%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRA 603
            +P +S++ LI+MAIE S  KA+ V +IY W   +FPY+  A +GWKNS+RHNLS+NK F K+ K    G+GSLW V+P+++Q+L+  + R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNMGKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0112946)

HSP 1 Score: 99.3673 bits (246), Expect = 2.849e-21
Identity = 44/91 (48.35%), Postives = 66/91 (72.53%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRA 603
            +P +S++ LI+MAIE S  KA+ V +IY W   +FPY+  A +GWKNS+RHNLS+NK F K+ K    G+GSLW V+P+++Q+L+  + R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNMGKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0333203)

HSP 1 Score: 99.3673 bits (246), Expect = 2.849e-21
Identity = 44/91 (48.35%), Postives = 66/91 (72.53%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRA 603
            +P +S++ LI+MAIE S  KA+ V +IY W   +FPY+  A +GWKNS+RHNLS+NK F K+ K    G+GSLW V+P+++Q+L+  + R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNMGKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0071079)

HSP 1 Score: 99.3673 bits (246), Expect = 2.849e-21
Identity = 44/91 (48.35%), Postives = 66/91 (72.53%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRA 603
            +P +S++ LI+MAIE S  KA+ V +IY W   +FPY+  A +GWKNS+RHNLS+NK F K+ K    G+GSLW V+P+++Q+L+  + R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNMGKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: slp1 (gene:FBgn0003430 transcript:FBtr0077499)

HSP 1 Score: 86.2705 bits (212), Expect = 3.627e-18
Identity = 38/88 (43.18%), Postives = 58/88 (65.91%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDPREKQHLVS 588
            ++P +SY  LI MAI++SP + +T+N IY +    FPY+     GW+NS+RHNLS+NKCF KI +     G+G+ WI+DP  ++  + 
Sbjct:  119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIG 206          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxn3 (forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-39])

HSP 1 Score: 108.997 bits (271), Expect = 4.477e-26
Identity = 48/90 (53.33%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK--MGQGGRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE++P K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDAPSKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxn3 (forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-39])

HSP 1 Score: 110.153 bits (274), Expect = 2.105e-25
Identity = 49/90 (54.44%), Postives = 68/90 (75.56%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE++P K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDAPSKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: FOXN2 (forkhead box N2a [Source:NCBI gene;Acc:100330010])

HSP 1 Score: 107.457 bits (267), Expect = 2.873e-25
Identity = 48/90 (53.33%), Postives = 68/90 (75.56%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQ-GGRGSLWIVDPREKQHLVSTM 594
            +P FS++ LIYMAIE SP K++ V DIY W   +FPY+++A  GWKNS+RHNLS+NKCF+K+ K +G+  G+GSLW VDP  + +L+  +
Sbjct:  109 KPPFSFSLLIYMAIEQSPSKSLPVKDIYGWILEHFPYFSSAPTGWKNSVRHNLSLNKCFRKVEKSLGKVNGKGSLWCVDPEYRPNLIQAL 198          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxn2b (forkhead box N2b [Source:ZFIN;Acc:ZDB-GENE-050417-1])

HSP 1 Score: 102.834 bits (255), Expect = 3.939e-23
Identity = 46/93 (49.46%), Postives = 68/93 (73.12%), Query Frame = 1
Query:  322 FYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQ-GGRGSLWIVDPREKQHLVSTM 594
            +  +P FS++ LIYMAIE+SP K++ V DIY W   +FPY+++A  GWKNS+RHNLS+NKCF+K+ + +G+  G+GSLW V P  +  L+  +
Sbjct:  118 YKSKPPFSFSLLIYMAIEHSPSKSLPVKDIYGWILKHFPYFSSAPTGWKNSVRHNLSLNKCFRKVERSIGKTNGKGSLWCVHPEFRPMLMQAL 210          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxn2b (forkhead box N2b [Source:ZFIN;Acc:ZDB-GENE-050417-1])

HSP 1 Score: 102.449 bits (254), Expect = 4.570e-23
Identity = 46/93 (49.46%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  322 FYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQ-GGRGSLWIVDPREKQHLVSTM 594
            +  +P FS++ LIYMAIE SP K++ V DIY W   +FPY+++A  GWKNS+RHNLS+NKCF+K+ + +G+  G+GSLW V P  +  L+  +
Sbjct:  118 YKSKPPFSFSLLIYMAIEQSPSKSLPVKDIYGWILKHFPYFSSAPTGWKNSVRHNLSLNKCFRKVERSIGKTNGKGSLWCVHPEFRPMLMQAL 210          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: foxn3 (forkhead box N3 [Source:NCBI gene;Acc:549054])

HSP 1 Score: 110.153 bits (274), Expect = 4.101e-25
Identity = 54/111 (48.65%), Postives = 76/111 (68.47%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPAS 657
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  +Q+L+  + +     ++  S +  T P S
Sbjct:  113 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRQNLIQALKK---TPYHPYSHVFNTPPTS 220          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: foxn3 (forkhead box N3 [Source:NCBI gene;Acc:549054])

HSP 1 Score: 110.153 bits (274), Expect = 5.067e-25
Identity = 54/111 (48.65%), Postives = 76/111 (68.47%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPAS 657
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  +Q+L+  + +     ++  S +  T P S
Sbjct:  113 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRQNLIQALKK---TPYHPYSHVFNTPPTS 220          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: adgrf3 (adhesion G protein-coupled receptor F3 [Source:Xenbase;Acc:XB-GENE-959826])

HSP 1 Score: 100.138 bits (248), Expect = 7.010e-22
Identity = 47/90 (52.22%), Postives = 64/90 (71.11%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKM-GQ-GGRGSLWIVDPREKQHLVSTM 594
            +P +S++ LIYMAIE+SP K + V DIY+W    FPY+A A  GWKNS+RHNLS+NK F+K+ +  G+  G+GSLW VDP  K  L+  +
Sbjct:  108 KPPYSFSLLIYMAIEHSPNKCLPVKDIYSWILDRFPYFATAPTGWKNSVRHNLSLNKYFQKVERSHGKVNGKGSLWCVDPEYKPSLIQAL 197          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: ptgs1 (prostaglandin-endoperoxide synthase 1 [Source:Xenbase;Acc:XB-GENE-995315])

HSP 1 Score: 92.4337 bits (228), Expect = 1.545e-19
Identity = 39/83 (46.99%), Postives = 60/83 (72.29%), Query Frame = 1
Query:  319 RFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            R  E+P +SY  LI MAI++SP K +T+++IY + +  FP++  +  GWKNS+RHNLS+N+CF K+ K +G+ G+G  W +DP
Sbjct:   58 RRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP 140          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: foxf1 (forkhead box F1 [Source:NCBI gene;Acc:734087])

HSP 1 Score: 92.0485 bits (227), Expect = 1.598e-19
Identity = 44/105 (41.90%), Postives = 67/105 (63.81%), Query Frame = 1
Query:  253 ERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            E  N    +KK+   I      R  E+P +SY  LI MAI++SP K +T+++IY + +  FP++  +  GWKNS+RHNLS+N+CF K+ K +G+ G+G  W +DP
Sbjct:   34 ESANCATKTKKTNAGI------RRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP 132          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxn3 (forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625])

HSP 1 Score: 109.768 bits (273), Expect = 3.762e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxn3 (forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625])

HSP 1 Score: 109.768 bits (273), Expect = 3.762e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxn3 (forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625])

HSP 1 Score: 109.768 bits (273), Expect = 3.762e-25
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxn3 (forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625])

HSP 1 Score: 98.2117 bits (243), Expect = 3.571e-23
Identity = 45/78 (57.69%), Postives = 59/78 (75.64%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIV 558
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCI 191          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxn2 (forkhead box N2 [Source:MGI Symbol;Acc:MGI:1347478])

HSP 1 Score: 102.449 bits (254), Expect = 8.170e-23
Identity = 48/95 (50.53%), Postives = 67/95 (70.53%), Query Frame = 1
Query:  316 KRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKM-GQ-GGRGSLWIVDPREKQHLVSTM 594
            K    +P +S++ LIYMAIE+SP K + V +IY+W    FPY+A A  GWKNS+RHNLS+NKCF+K+ +  G+  G+GSLW VDP  K +L+  +
Sbjct:  107 KSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYSWILDRFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLMQAL 201          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q33BP8|FOXN3_PIG (Forkhead box protein N3 OS=Sus scrofa OX=9823 GN=FOXN3 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.126e-25
Identity = 55/120 (45.83%), Postives = 80/120 (66.67%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPASLDHHRIVIG 684
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  + +     +++ S +  T PAS   ++   G
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQALKK---TPYHSHSNVFNTPPASPQAYQSTSG 230          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q28G71|FOXN3_XENTR (Forkhead box protein N3 OS=Xenopus tropicalis OX=8364 GN=foxn3 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.172e-24
Identity = 54/111 (48.65%), Postives = 76/111 (68.47%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPAS 657
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  +Q+L+  + +     ++  S +  T P S
Sbjct:  113 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRQNLIQALKK---TPYHPYSHVFNTPPTS 220          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q499D0|FOXN3_MOUSE (Forkhead box protein N3 OS=Mus musculus OX=10090 GN=Foxn3 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.631e-24
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|O00409|FOXN3_HUMAN (Forkhead box protein N3 OS=Homo sapiens OX=9606 GN=FOXN3 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.877e-24
Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K      G+GSLW +DP  +Q+L+  +
Sbjct:  114 KPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQAL 203          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q3BJS3|FOXN3_XENLA (Forkhead box protein N3 OS=Xenopus laevis OX=8355 GN=foxn3 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 3.877e-24
Identity = 53/111 (47.75%), Postives = 76/111 (68.47%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPAS 657
            +P +S++ LI+MA+E+SP K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  +Q+L+  + +     ++  S +  T P S
Sbjct:  113 KPPYSFSCLIFMAVEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRQNLIQALKK---TPYHPYSHVFNTPPTS 220          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A0X3P2P9 (Forkhead box protein N3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=FOXN3 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.029e-30
Identity = 68/157 (43.31%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  133 PQFKSEMLTNSFCENAYPVEDSYIDSNKDFSVLEDFYRFQERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG-GRGSLWIVDPREKQHLVSTMCR 600
            P  K E LT+      Y V  S+I      S L          +  + S    +    +   +   +P +SYT LI+MAIE++P K MTVN IYNWCE NFP+Y +A  GWKNSLRHNLSINK FK++ + G+G GRG+ W V+PRE+Q+L+  + R
Sbjct:   98 PSLKEETLTS-----GYTVCPSHITVASTGSTLPTRLSLSSTTSQVLSSSYVGSSAFSNPYSQGLGKPCYSYTHLIFMAIESTPQKCMTVNQIYNWCEANFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDGRGPGRGAYWAVEPRERQNLLGAVKR 249          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A0X3PWA1 (Forkhead box protein N3 OS=Schistocephalus solidus OX=70667 GN=FOXN3 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.524e-28
Identity = 75/188 (39.89%), Postives = 105/188 (55.85%), Query Frame = 1
Query:  133 PQFKSEMLTNSFCENAYPVEDSYIDSNKDFSVLEDFYRFQERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG-GRGSLWIVDPREKQHLVSTMCRAN-VASFNAPSFIIQTAPA-SLDHHRIVIGD 687
            P  K E LT+      Y V  S+I      S L          +  + S    +    +   +   +P +SYT LI+MAIE++P K MTVN IYNWCE NFP+Y +A  GWKNSLRHNLSINK FK++ + G+G GRG+ W V+PRE+Q+L+  + R     +FN    +I+  P  ++     VIG+
Sbjct:   87 PSLKEETLTS-----GYTVCPSHITVASTGSTLPTRLSLSSTTSQVLSSSYVGSSAFSNPYSQGLGKPCYSYTHLIFMAIESTPQKCMTVNQIYNWCEANFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDGRGPGRGAYWAVEPRERQNLLGAVKRNPWSVNFNRERSVIRQLPCNAITDSTSVIGN 269          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A5K3FM86 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.361e-27
Identity = 55/91 (60.44%), Postives = 72/91 (79.12%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG-GRGSLWIVDPREKQHLVSTMCR 600
            +P +SYT LI+MAIE++P K MTVN IYNWCE NFP+Y +A  GWKNSLRHNLSINK FK++ + G+G GRG+ W V+PRE+ +L+  + R
Sbjct:  144 KPCYSYTHLIFMAIESTPAKCMTVNQIYNWCETNFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDGRGPGRGAYWAVEPRERPNLLDAVKR 234          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A183RNV7 (Fork-head domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.063e-26
Identity = 58/101 (57.43%), Postives = 75/101 (74.26%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG-GRGSLWIVDPREKQHLVSTMCRA--NVASFNA 624
            +P++SYT LI+MAIE++P K MTVN IYNWCE NFP+Y +A  GWKNSLRHNLSINK FK++ +  +G GRG+ W V+PRE+  L+  + R   N AS  A
Sbjct:  156 KPNYSYTHLIFMAIESTPQKCMTVNQIYNWCESNFPFYKHAGVGWKNSLRHNLSINKSFKRLPRDSRGPGRGAFWTVEPRERASLLDAIKRNPWNFASVTA 256          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A4Z2D7P5 (Forkhead box protein I2 OS=Schistosoma japonicum OX=6182 GN=EWB00_003674 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.604e-26
Identity = 58/103 (56.31%), Postives = 76/103 (73.79%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG-GRGSLWIVDPREKQHLVSTMCR-----ANVASFN 621
            +P++SYT LI+MAIE++P K MTVN IYNWCE NFP+Y +A  GWKNSLRHNLSINK FK++ +  +G GRG+ W V+PRE+  L+  + R     ANVA+  
Sbjct:  167 KPNYSYTHLIFMAIESTPQKCMTVNQIYNWCESNFPFYKHAGVGWKNSLRHNLSINKSFKRLPRDSRGPGRGAFWTVEPRERASLLDAIKRNPWNFANVAAIG 269          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: FOXN2 (forkhead box protein N2 [Source:NCBI gene;Acc:103027993])

HSP 1 Score: 108.612 bits (270), Expect = 5.589e-25
Identity = 52/104 (50.00%), Postives = 74/104 (71.15%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQ-GGRGSLWIVDPREKQHLVSTMCRANVASFNAPSFI 636
            +P FS++ LIYMAIE SP K++ V DIY W   +FPY+++A  GWKNS+RHNLS+NKCF+K+ K +G+  G+GSLW VDP  + +L+  + + +   F AP  I
Sbjct:  118 KPPFSFSLLIYMAIEQSPSKSLPVKDIYGWILEHFPYFSSAPTGWKNSVRHNLSLNKCFRKVEKSLGKVNGKGSLWCVDPEYRPNLIQALKKQH---FPAPHGI 218          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxn3 (forkhead box N3 [Source:NCBI gene;Acc:103032353])

HSP 1 Score: 108.227 bits (269), Expect = 9.955e-25
Identity = 48/90 (53.33%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE++P K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  + +L+  +
Sbjct:  116 KPPYSFSCLIFMAIEDAPSKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRHNLIQAL 205          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxn3 (forkhead box N3 [Source:NCBI gene;Acc:103032353])

HSP 1 Score: 108.227 bits (269), Expect = 9.955e-25
Identity = 48/90 (53.33%), Postives = 67/90 (74.44%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE++P K + V DIYNW   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  + +L+  +
Sbjct:  116 KPPYSFSCLIFMAIEDAPSKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWCIDPEYRHNLIQAL 205          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxn2b (forkhead box protein N2-like [Source:NCBI gene;Acc:103026529])

HSP 1 Score: 102.449 bits (254), Expect = 3.256e-23
Identity = 46/90 (51.11%), Postives = 66/90 (73.33%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQ-GGRGSLWIVDPREKQHLVSTM 594
            +P FS++ LIYMAIE SP K++ V DIY W   +FPY+++A  GWKNS+RHNLS+NKCF+K+ + +G+  G+GSLW V P  +  L+  +
Sbjct:  127 KPPFSFSLLIYMAIEQSPSKSLPVKDIYGWILEHFPYFSSAPTGWKNSVRHNLSLNKCFRKVERSLGKTNGKGSLWCVHPEFRPTLMQAL 216          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxn2b (forkhead box protein N2-like [Source:NCBI gene;Acc:103026529])

HSP 1 Score: 102.834 bits (255), Expect = 3.513e-23
Identity = 46/90 (51.11%), Postives = 66/90 (73.33%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQ-GGRGSLWIVDPREKQHLVSTM 594
            +P FS++ LIYMAIE SP K++ V DIY W   +FPY+++A  GWKNS+RHNLS+NKCF+K+ + +G+  G+GSLW V P  +  L+  +
Sbjct:  127 KPPFSFSLLIYMAIEQSPSKSLPVKDIYGWILEHFPYFSSAPTGWKNSVRHNLSLNKCFRKVERSLGKTNGKGSLWCVHPEFRPTLMQAL 216          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxn3 (forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-39])

HSP 1 Score: 101.679 bits (252), Expect = 2.223e-25
Identity = 52/113 (46.02%), Postives = 75/113 (66.37%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG--GRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPASLD 663
            +P +S++ LI+++IE SP K + V  IY+W   +FPY+  A  GWKNS+RHNLS+NKCFKK+ K      G+GSLW VDP  + +L+ T+ +   A ++  S I+ T PAS D
Sbjct:   63 KPPYSFSCLIFLSIEASPYKRLPVKGIYDWILDHFPYFVGAPSGWKNSVRHNLSLNKCFKKVDKDRHQSLGKGSLWCVDPDYRPNLIQTLKK---APYHPYSHILNTPPASPD 172          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 95.1301 bits (235), Expect = 1.684e-23
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            E+P FSY  LI MAI++SP K +T+++IY + +  FP++  A  GWKNS+RHNLS+N+CF K+ K +G+ G+G  W +DP
Sbjct:    5 EKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDP 84          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 93.9745 bits (232), Expect = 2.238e-23
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            E+P FSY  LI MAI++SP K +T+++IY + +  FP++  A  GWKNS+RHNLS+N+CF K+ K +G+ G+G  W +DP
Sbjct:    4 EKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDP 83          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004728.1 (pep scaffold:Pmarinus_7.0:GL476947:39389:44169:1 gene:ENSPMAG00000004307.1 transcript:ENSPMAT00000004728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 4.089e-22
Identity = 47/119 (39.50%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  223 SVLEDFYRFQERRNAFIDSKKSQTQIN--QSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGG---RGSLWIVDP 564
            SV + +   +   N +   + S  +I+  Q   ++ Y +P +SY+ LI MA++NS   ++ V+DIY++   NFPY+  A  GWKNS+RHNLS+NKCF+KI     GG   +G LW ++P
Sbjct:    5 SVSQPYPAMRPYSNGYASHQYSPHKIHTMQGRQQKVYPKPIYSYSCLIAMALKNSKNGSLPVSDIYHFMTENFPYFKTAPDGWKNSVRHNLSLNKCFEKIENKASGGSSRKGCLWTLNP 123          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxg1a (forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-267])

HSP 1 Score: 86.6557 bits (213), Expect = 5.553e-20
Identity = 45/122 (36.89%), Postives = 66/122 (54.10%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDPREKQHLVST-MCRANVASFNAPSFIIQTAPASLDHHRIVIGD 687
            ++P FSY  LI MAI  SP K +T++ IY +   NFPYY     GW+NS+RHNLS+NKCF K+ +     G+G+ W++DP      +     +    S  +P  +   AP     H + + D
Sbjct:   31 DKPPFSYNALIMMAIRQSPEKRLTLSGIYEYIMHNFPYYRQNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGRTGKLRRRSAASPRGLALRAPPRFSAHDLALMD 152          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 70.0922 bits (170), Expect = 3.519e-13
Identity = 33/81 (40.74%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  322 FYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDP 564
              ++P +SY  LI +AI  S    +T++ IY+W  ++FPYY      W+NS+RHNLS+N  F K T+    G+G  W V P
Sbjct:  106 LAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIK-TEKSCDGKGHFWEVRP 185          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 67.781 bits (164), Expect = 2.430e-12
Identity = 34/105 (32.38%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKM-GQGGRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQ 642
            +P  SY  +I  AI +SP   +++ DIY +   N+ YY  A  GW+NS+RHNLS+NK F+K+ +   + G+G  W +    +Q  ++      V      S + +
Sbjct:  340 KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFLNKWNTGKVGKIRRGSSVAR 444          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 67.3958 bits (163), Expect = 3.971e-12
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  322 FYERPSFSYTQLIYMAIEN-SPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVD-----PREKQ 576
            +  +P+ SY+ ++   I   S  K M++++IY      FPYY     GW++S+RHNLS+NK F+K++K    G+G LW +D      RE+Q
Sbjct:  458 YRTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE---GKGWLWGLDEEYIAERERQ 545          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 65.4698 bits (158), Expect = 8.450e-12
Identity = 31/79 (39.24%), Postives = 50/79 (63.29%), Query Frame = 1
Query:  325 YERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIV 558
            Y +P  SY  +I  AI ++P  ++++ DIY +   N+ +Y  +   W+NS+RHNLS+NK F+K+ K  GQ G+G  W +
Sbjct:  301 YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKI 379          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO49084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI36])

HSP 1 Score: 103.605 bits (257), Expect = 9.174e-27
Identity = 49/93 (52.69%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRA 603
            +P +S++ LI+MAIE SP K + V DIYNW   +FPY+ +A  GWKNS+RHNLS+NKCFKK+ K  GQ  G+GSLW VDP  + +L+  + + 
Sbjct:    2 KPPYSFSSLIFMAIEESPNKRLPVKDIYNWIMDHFPYFRDARLGWKNSVRHNLSLNKCFKKVDKDKGQNVGKGSLWTVDPDFRPNLLQALRKT 94          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO46828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP00])

HSP 1 Score: 86.6557 bits (213), Expect = 9.963e-21
Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 1
Query:  328 ERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            E+P+FSY  LI MAI  S  K +T++ IY +   NFPYY N   GW+NS+RHNLS+NKCF K+ +     G+G+ W++DP
Sbjct:    1 EKPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMKNFPYYRNNKQGWQNSIRHNLSLNKCFVKVPRNYDDPGKGNYWMLDP 80          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO47812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL76])

HSP 1 Score: 83.5741 bits (205), Expect = 1.283e-19
Identity = 39/79 (49.37%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGR-GSLWIVDP 564
            +P +SY  LI MAI  SP K +T+N IY +    FPYY     GW+NS+RHNLS+N+CF K+ + G G R G+ W +DP
Sbjct:    1 KPPYSYVALIAMAIRESPEKRLTLNGIYQYIISKFPYYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDP 79          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 79.337 bits (194), Expect = 3.748e-18
Identity = 38/79 (48.10%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            +P +SY  LI MAI+ S G+ +T++ IY +   NFPYY     GW+NS+RHNLS+NKCF KI +     G+G  W +DP
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDP 81          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 85.8853 bits (211), Expect = 7.562e-18
Identity = 37/79 (46.84%), Postives = 57/79 (72.15%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG-GRGSLWIVDP 564
            +P +SY  LI MAI+++P K +T++ IY++    FPYY N   GW+NS+RHNLS+N+CF K+ +  +  G+GS W++DP
Sbjct:   79 KPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLDP 157          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: FOXN2 (forkhead box N2 [Source:NCBI gene;Acc:101160261])

HSP 1 Score: 106.686 bits (265), Expect = 2.012e-24
Identity = 48/100 (48.00%), Postives = 73/100 (73.00%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRANVASFNA 624
            +P FS++ LIYMAIE SP K++ V +IY W   +FPY++NA  GWKNS+RHNLS+NKCF+K+ + +G+  G+GSLW VDP  + +L+  + + +  + +A
Sbjct:  121 KPPFSFSLLIYMAIEQSPSKSLPVKEIYGWILEHFPYFSNAPTGWKNSVRHNLSLNKCFRKVDRSLGKSNGKGSLWCVDPEYRPNLIQALKKQHFPAASA 220          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: FOXN2 (forkhead box N2 [Source:NCBI gene;Acc:101160261])

HSP 1 Score: 106.686 bits (265), Expect = 2.018e-24
Identity = 48/100 (48.00%), Postives = 73/100 (73.00%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTMCRANVASFNA 624
            +P FS++ LIYMAIE SP K++ V +IY W   +FPY++NA  GWKNS+RHNLS+NKCF+K+ + +G+  G+GSLW VDP  + +L+  + + +  + +A
Sbjct:  154 KPPFSFSLLIYMAIEQSPSKSLPVKEIYGWILEHFPYFSNAPTGWKNSVRHNLSLNKCFRKVDRSLGKSNGKGSLWCVDPEYRPNLIQALKKQHFPAASA 253          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: ches1 (forkhead box N3 [Source:NCBI gene;Acc:101159152])

HSP 1 Score: 105.145 bits (261), Expect = 1.108e-23
Identity = 47/90 (52.22%), Postives = 66/90 (73.33%), Query Frame = 1
Query:  331 RPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQG-GRGSLWIVDPREKQHLVSTM 594
            +P +S++ LI+MAIE++P K + V DIY W   +FPY+ANA  GWKNS+RHNLS+NKCFKK+ K   Q  G+GSLW +DP  + +L+  +
Sbjct:  126 KPPYSFSCLIFMAIEDAPNKRLPVKDIYGWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRSQSIGKGSLWSIDPEYRHNLIQAL 215          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: foxf2a (forkhead box protein F2 [Source:NCBI gene;Acc:101168243])

HSP 1 Score: 96.2857 bits (238), Expect = 4.528e-21
Identity = 45/115 (39.13%), Postives = 71/115 (61.74%), Query Frame = 1
Query:  223 SVLEDFYRFQERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVDP 564
            + L D +R  E  +     K+  + +      R  E+P +SY  LI MAI++SP K +T+++IY + +  FP++  A  GWKNS+RHNLS+N+CF K+ K +G+ G+G  W +DP
Sbjct:   24 AALLDAHRGMESAHDAAKGKRGSSGM------RRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQYLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP 132          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: foxj2 (forkhead box protein J2 [Source:NCBI gene;Acc:101166414])

HSP 1 Score: 96.2857 bits (238), Expect = 1.902e-20
Identity = 51/124 (41.13%), Postives = 68/124 (54.84%), Query Frame = 1
Query:  196 SYIDSNKDFSVLEDFYRFQER-RNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITK-MGQGGRGSLWIVD 561
            S     K   V +D  + + R R  FI S  S +  N         +P  SY  LI MAI  +P K +++NDIY W    FPYY+ A  GWKNS+RHNLS+NKCF+K+ +     G+GS W +D
Sbjct:   22 SLRSGKKRGGVEKDRKKDRGRDRGDFIPSVPSPSTSNSKG------KPPHSYATLIAMAIAAAPEKRLSLNDIYTWISDTFPYYSRAGRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYWTMD 139          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000015734.1 (SMESG000015734.1)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 439/441 (99.55%), Postives = 439/441 (99.55%), Query Frame = 1
Query:   19 MKPTILKVYSNFPDIPYDIKKCEDNHLIKISNVENPGIPQFKSEMLTNSFCENAYPVEDSYIDSNKDFSVLEDFYRFQERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTAPASLDHHRIVIGDDHSLDIPQDDTIVFXXXXXXXXXXXXXXXXXEEKPVYSWTDTRLPCDYTVPLSPENCSDASETDYNDWNRAMISLEPIFPVKQHQIKSKFPLNPIVTPPSSFEHNYSIQNLQIIIDDPCAIVRHIFHPVINSNASFCTSSDYNDEEWPRTPSPVPHVAQIEPPQSKLKIVKSGLKRGRPKNSTKRELELKKSQKPQKKLNHNDRINNMYNLNSFINSL 1341
            MKPTILKVYSNFPDI YDIKKCEDNHLIKISNVENPGIPQFKSEMLTNSFCENAYPVEDSYIDSNKDFSVLEDFYRFQERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTA ASLDHHRIVIGDDHSLDIPQDDTIVFSDDSTSSQIQSDLSLILEEKPVYSWTDTRLPCDYTVPLSPENCSDASETDYNDWNRAMISLEPIFPVKQHQIKSKFPLNPIVTPPSSFEHNYSIQNLQIIIDDPCAIVRHIFHPVINSNASFCTSSDYNDEEWPRTPSPVPHVAQIEPPQSKLKIVKSGLKRGRPKNSTKRELELKKSQKPQKKLNHNDRINNMYNLNSFINSL
Sbjct:    1 MKPTILKVYSNFPDISYDIKKCEDNHLIKISNVENPGIPQFKSEMLTNSFCENAYPVEDSYIDSNKDFSVLEDFYRFQERRNAFIDSKKSQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRANVASFNAPSFIIQTASASLDHHRIVIGDDHSLDIPQDDTIVFSDDSTSSQIQSDLSLILEEKPVYSWTDTRLPCDYTVPLSPENCSDASETDYNDWNRAMISLEPIFPVKQHQIKSKFPLNPIVTPPSSFEHNYSIQNLQIIIDDPCAIVRHIFHPVINSNASFCTSSDYNDEEWPRTPSPVPHVAQIEPPQSKLKIVKSGLKRGRPKNSTKRELELKKSQKPQKKLNHNDRINNMYNLNSFINSL 441          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000033244.1 (SMESG000033244.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.358e-31
Identity = 66/139 (47.48%), Postives = 92/139 (66.19%), Query Frame = 1
Query:  223 SVLEDFYRFQERRNAFIDSKK-------SQTQINQ--SNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG---GRGSLWIVDPREKQHLVSTMCRA 603
            S + DF RFQ  RN+  +S +       S T  NQ  S+    + +P+ SYTQLI+MAIE    +AMTVNDIY WCE+N+PYY +    WKNSLRHNLSINK F+++ + GQ    GRG+ W+VD +E+++L+ ++ RA
Sbjct:  125 SNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQQGGPGRGAYWVVDDKERKNLLDSIYRA 263          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000048193.1 (SMESG000048193.1)

HSP 1 Score: 121.709 bits (304), Expect = 1.361e-28
Identity = 69/153 (45.10%), Postives = 90/153 (58.82%), Query Frame = 1
Query:  223 SVLEDFYRFQERRNAFIDSKK------------------------SQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKIT--KMGQGGRGSLWIVDPREKQHLVSTMCRA 603
            S + D+YR+Q  R A  +  +                        S +Q N  +    Y++P FSYT +I+MAIE SP KAMTVNDIY WCE +FPYY  A  GWKNSLRHNLSINK FKKI+    G  GRG+ W+V+PRE+ +L+  + R+
Sbjct:  121 STIADYYRYQAMRAAMTNGHQNGGYRQQHGYLSYSNSSTGIRPNNSGSQHNLCHSVNEYQKPPFSYTHIIFMAIETSPNKAMTVNDIYVWCETHFPYYTQAGVGWKNSLRHNLSINKSFKKISRDGRGGPGRGAYWVVEPRERNNLIDAIRRS 273          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000048193.1 (SMESG000048193.1)

HSP 1 Score: 121.709 bits (304), Expect = 1.502e-28
Identity = 69/153 (45.10%), Postives = 90/153 (58.82%), Query Frame = 1
Query:  223 SVLEDFYRFQERRNAFIDSKK------------------------SQTQINQSNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKIT--KMGQGGRGSLWIVDPREKQHLVSTMCRA 603
            S + D+YR+Q  R A  +  +                        S +Q N  +    Y++P FSYT +I+MAIE SP KAMTVNDIY WCE +FPYY  A  GWKNSLRHNLSINK FKKI+    G  GRG+ W+V+PRE+ +L+  + R+
Sbjct:  121 STIADYYRYQAMRAAMTNGHQNGGYRQQHGYLSYSNSSTGIRPNNSGSQHNLCHSVNEYQKPPFSYTHIIFMAIETSPNKAMTVNDIYVWCETHFPYYTQAGVGWKNSLRHNLSINKSFKKISRDGRGGPGRGAYWVVEPRERNNLIDAIRRS 273          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000033244.1 (SMESG000033244.1)

HSP 1 Score: 119.783 bits (299), Expect = 4.358e-28
Identity = 66/164 (40.24%), Postives = 92/164 (56.10%), Query Frame = 1
Query:  223 SVLEDFYRFQERRNAFIDSKK-------SQTQINQ--SNLKRFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWKNSLRHNLSINKCFKKITKMGQG----------------------------GRGSLWIVDPREKQHLVSTMCRA 603
            S + DF RFQ  RN+  +S +       S T  NQ  S+    + +P+ SYTQLI+MAIE    +AMTVNDIY WCE+N+PYY +    WKNSLRHNLSINK F+++ + GQ                             GRG+ W+VD +E+++L+ ++ RA
Sbjct:  125 SNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA 288          
The following BLAST results are available for this feature:
BLAST of Forkhead box protein N3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXN39.584e-2754.44forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928][more]
FOXN35.489e-2554.44forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928][more]
FOXN35.489e-2554.44forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928][more]
FOXN35.489e-2554.44forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928][more]
FOXN35.990e-2554.44forkhead box N3 [Source:HGNC Symbol;Acc:HGNC:1928][more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-23.448e-1845.57ForKHead transcription factor family [Source:UniP... [more]
fkh-66.257e-1646.99ForKHead transcription factor family [Source:UniP... [more]
fkh-101.350e-1543.59ForKHead transcription factor family [Source:UniP... [more]
fkh-101.350e-1543.59ForKHead transcription factor family [Source:UniP... [more]
lin-313.936e-1539.56pep chromosome:WBcel235:II:3982549:3986944:1 gene:... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHES-1-like2.751e-2148.35gene:FBgn0029504 transcript:FBtr0310287[more]
CHES-1-like2.849e-2148.35gene:FBgn0029504 transcript:FBtr0112946[more]
CHES-1-like2.849e-2148.35gene:FBgn0029504 transcript:FBtr0333203[more]
CHES-1-like2.849e-2148.35gene:FBgn0029504 transcript:FBtr0071079[more]
slp13.627e-1843.18gene:FBgn0003430 transcript:FBtr0077499[more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxn34.477e-2653.33forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-3... [more]
foxn32.105e-2554.44forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-3... [more]
FOXN22.873e-2553.33forkhead box N2a [Source:NCBI gene;Acc:100330010][more]
foxn2b3.939e-2349.46forkhead box N2b [Source:ZFIN;Acc:ZDB-GENE-050417-... [more]
foxn2b4.570e-2349.46forkhead box N2b [Source:ZFIN;Acc:ZDB-GENE-050417-... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxn34.101e-2548.65forkhead box N3 [Source:NCBI gene;Acc:549054][more]
foxn35.067e-2548.65forkhead box N3 [Source:NCBI gene;Acc:549054][more]
adgrf37.010e-2252.22adhesion G protein-coupled receptor F3 [Source:Xen... [more]
ptgs11.545e-1946.99prostaglandin-endoperoxide synthase 1 [Source:Xenb... [more]
foxf11.598e-1941.90forkhead box F1 [Source:NCBI gene;Acc:734087][more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxn33.762e-2554.44forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625... [more]
Foxn33.762e-2554.44forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625... [more]
Foxn33.762e-2554.44forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625... [more]
Foxn33.571e-2357.69forkhead box N3 [Source:MGI Symbol;Acc:MGI:1918625... [more]
Foxn28.170e-2350.53forkhead box N2 [Source:MGI Symbol;Acc:MGI:1347478... [more]
back to top
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q33BP8|FOXN3_PIG2.126e-2545.83Forkhead box protein N3 OS=Sus scrofa OX=9823 GN=F... [more]
sp|Q28G71|FOXN3_XENTR2.172e-2448.65Forkhead box protein N3 OS=Xenopus tropicalis OX=8... [more]
sp|Q499D0|FOXN3_MOUSE2.631e-2454.44Forkhead box protein N3 OS=Mus musculus OX=10090 G... [more]
sp|O00409|FOXN3_HUMAN2.877e-2454.44Forkhead box protein N3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q3BJS3|FOXN3_XENLA3.877e-2447.75Forkhead box protein N3 OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Forkhead box protein N3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P2P93.029e-3043.31Forkhead box protein N3 (Fragment) OS=Schistocepha... [more]
A0A0X3PWA13.524e-2839.89Forkhead box protein N3 OS=Schistocephalus solidus... [more]
A0A5K3FM864.361e-2760.44Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183RNV71.063e-2657.43Fork-head domain-containing protein OS=Schistosoma... [more]
A0A4Z2D7P53.604e-2656.31Forkhead box protein I2 OS=Schistosoma japonicum O... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXN25.589e-2550.00forkhead box protein N2 [Source:NCBI gene;Acc:1030... [more]
foxn39.955e-2553.33forkhead box N3 [Source:NCBI gene;Acc:103032353][more]
foxn39.955e-2553.33forkhead box N3 [Source:NCBI gene;Acc:103032353][more]
foxn2b3.256e-2351.11forkhead box protein N2-like [Source:NCBI gene;Acc... [more]
foxn2b3.513e-2351.11forkhead box protein N2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxn32.223e-2546.02forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-3... [more]
foxf2a1.684e-2350.00forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2a2.238e-2350.00forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
ENSPMAT00000004728.14.089e-2239.50pep scaffold:Pmarinus_7.0:GL476947:39389:44169:1 g... [more]
foxg1a5.553e-2036.89forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM13.519e-1340.74Forkhead transcription factor; drives S-phase acti... [more]
FKH22.430e-1232.38Forkhead family transcription factor; rate-limitin... [more]
FHL13.971e-1237.36Regulator of ribosomal protein (RP) transcription;... [more]
FKH18.450e-1239.24Forkhead family transcription factor; rate-limitin... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490849.174e-2752.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468289.963e-2150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478121.283e-1949.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426543.748e-1848.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339007.562e-1846.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXN22.012e-2448.00forkhead box N2 [Source:NCBI gene;Acc:101160261][more]
FOXN22.018e-2448.00forkhead box N2 [Source:NCBI gene;Acc:101160261][more]
ches11.108e-2352.22forkhead box N3 [Source:NCBI gene;Acc:101159152][more]
foxf2a4.528e-2139.13forkhead box protein F2 [Source:NCBI gene;Acc:1011... [more]
foxj21.902e-2041.13forkhead box protein J2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015734.10.000e+099.55SMESG000015734.1[more]
SMESG000033244.13.358e-3147.48SMESG000033244.1[more]
SMESG000048193.11.361e-2845.10SMESG000048193.1[more]
SMESG000048193.11.502e-2845.10SMESG000048193.1[more]
SMESG000033244.14.358e-2840.24SMESG000033244.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010118 ID=SMED30010118|Name=Forkhead box protein N3|organism=Schmidtea mediterranea sexual|type=transcript|length=1785bp
TATATAAATCTTATATGAATGAAACCTACTATACTAAAGGTATATTCAAA
TTTTCCTGATATTCCTTATGATATTAAAAAGTGTGAAGATAATCATTTGA
TTAAAATTTCAAATGTTGAAAATCCTGGAATTCCACAATTTAAATCAGAA
ATGCTTACAAATTCATTCTGCGAAAATGCATATCCTGTTGAAGACAGTTA
TATTGATTCCAATAAAGATTTTAGTGTTTTAGAAGATTTTTATCGGTTTC
AAGAACGTAGAAATGCTTTCATTGATTCGAAAAAATCTCAAACACAAATT
AATCAGTCAAACTTGAAACGCTTTTACGAAAGACCGAGTTTTAGTTATAC
GCAATTAATATATATGGCTATAGAAAATTCGCCGGGTAAAGCAATGACAG
TGAACGATATTTATAATTGGTGTGAATTAAATTTTCCTTATTATGCTAAC
GCGATTCACGGTTGGAAAAATTCTTTAAGACACAATTTGTCCATTAACAA
ATGTTTTAAAAAAATTACTAAAATGGGTCAAGGAGGCAGAGGGTCTCTAT
GGATTGTAGATCCTCGTGAGAAACAACATTTAGTTTCAACCATGTGTCGG
GCAAATGTGGCTTCCTTTAATGCTCCATCGTTTATAATTCAAACCGCTCC
AGCATCACTCGACCATCATCGAATTGTTATTGGTGATGATCACTCATTAG
ATATTCCACAGGATGATACAATTGTTTTCTCTGACGATTCTACATCGTCT
CAAATACAGTCTGATTTATCATTAATTCTTGAGGAAAAGCCTGTGTATAG
CTGGACAGATACGCGCTTACCTTGTGACTATACCGTTCCTTTGTCACCTG
AAAATTGTTCTGATGCATCAGAGACCGATTACAACGATTGGAATAGAGCA
ATGATTTCTTTAGAACCTATTTTCCCTGTCAAACAGCACCAGATCAAATC
AAAATTTCCTTTAAATCCCATCGTGACACCTCCGAGTTCTTTTGAACATA
ATTATTCAATCCAGAACCTACAGATAATTATCGACGATCCGTGCGCCATT
GTACGGCATATATTTCACCCAGTAATCAACTCAAACGCCTCATTTTGTAC
ATCCAGTGATTATAATGACGAAGAATGGCCTCGAACACCTTCTCCAGTGC
CTCACGTTGCTCAAATCGAACCGCCACAATCTAAACTGAAAATCGTCAAA
TCGGGATTAAAGCGCGGACGGCCTAAAAACTCGACAAAACGAGAATTGGA
ATTGAAAAAATCTCAAAAGCCTCAGAAAAAACTCAATCACAACGACCGGA
TCAATAATATGTACAATTTGAATAGTTTCATCAACTCGTTGTGATATACC
AGTCAAAATCTCACGTCGCCTCTTTATTTTTGTGGAATTGTAAATAGAAT
GGTTTATTGATTTCGTTTCGCTGTTTATTTCATATCTCGAGTCCAGCACC
ACCGGTTAGCATATCTCTTGTATTTACTTCCATAATTTGGTAACTTGGCC
TCTAATATCATTTATTATTATTATTTACCATCATGGAACTTATACACTTT
CATTTTCCCCTAACCAACCAATGGGGTTTTGTCAAATTGTGCCTCGATTT
TGATTTGCCGATTTCTAGGTCAACTTGAAGCTCTAATTTTTATAATTACG
TAAATAGGCTATTCATGATTTTGATGTTTTAATTGATTTGTGGTATTATC
AAATATTTTCCTGTGAATTGTACATGATTTATCTTTGTTATTGATTATTT
GGAAACGTTACGTCTCGGAATATGAGCATTTAAAT
back to top

protein sequence of SMED30010118-orf-1

>SMED30010118-orf-1 ID=SMED30010118-orf-1|Name=SMED30010118-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MKPTILKVYSNFPDIPYDIKKCEDNHLIKISNVENPGIPQFKSEMLTNSF
CENAYPVEDSYIDSNKDFSVLEDFYRFQERRNAFIDSKKSQTQINQSNLK
RFYERPSFSYTQLIYMAIENSPGKAMTVNDIYNWCELNFPYYANAIHGWK
NSLRHNLSINKCFKKITKMGQGGRGSLWIVDPREKQHLVSTMCRANVASF
NAPSFIIQTAPASLDHHRIVIGDDHSLDIPQDDTIVFSDDSTSSQIQSDL
SLILEEKPVYSWTDTRLPCDYTVPLSPENCSDASETDYNDWNRAMISLEP
IFPVKQHQIKSKFPLNPIVTPPSSFEHNYSIQNLQIIIDDPCAIVRHIFH
PVINSNASFCTSSDYNDEEWPRTPSPVPHVAQIEPPQSKLKIVKSGLKRG
RPKNSTKRELELKKSQKPQKKLNHNDRINNMYNLNSFINSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 105..118
score: 53.12
coord: 149..166
score: 66.67
coord: 126..143
score: 38.54
IPR001766Fork head domainSMARTSM00339forkneu4coord: 103..193
e-value: 2.8E-35
score: 133.2
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 104..187
e-value: 2.9E-30
score: 104.4
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 105..182
score: 26.904
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 89..196
e-value: 6.1E-33
score: 114.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 402..420
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 398..420
NoneNo IPR availablePANTHERPTHR13962FAMILY NOT NAMEDcoord: 86..201
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 149..155
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 104..191