ribonucleoside diphosphate reductase subunit M2-2

Overview
Nameribonucleoside diphosphate reductase subunit M2-2 (AFJ24744.1)
Smed IDSMED30010115
Uniprot Best hitRibonucleoside-diphosphate reductase subunit M2 OS=Danio rerio GN=rrm2 PE=1 SV=1 (E=1.41139e-146)
Length (bp)1127
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) t-SNE clustered cells

Violin plots show distribution of expression levels for ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

ribonucleoside diphosphate reductase subunit M2-2 ( RRM2-2 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast compartment, blastomere and blastomere compartment

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Cell cycle activity is restricted to piwi-1 blastomere

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and RNR M2-2 (green). RNR M2-2 expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express RNR M2-2. Several fluorescent beads used for 3-dimensional reconstruction are visible (red). 

Homology
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2B (ribonucleotide reductase regulatory TP53 inducible subunit M2B [Source:HGNC Symbol;Acc:HGNC:17296])

HSP 1 Score: 424.091 bits (1089), Expect = 2.039e-146
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 423.705 bits (1088), Expect = 1.162e-145
Identity = 216/305 (70.82%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS E+V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 374          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2B (ribonucleotide reductase regulatory TP53 inducible subunit M2B [Source:HGNC Symbol;Acc:HGNC:17296])

HSP 1 Score: 422.165 bits (1084), Expect = 9.760e-145
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   89 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 393          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 423.32 bits (1087), Expect = 1.266e-144
Identity = 216/305 (70.82%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS E+V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:  130 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 434          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 423.32 bits (1087), Expect = 1.266e-144
Identity = 216/305 (70.82%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS E+V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:  130 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 434          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Match: rnr-2 (Ribonucleoside-diphosphate reductase small chain [Source:UniProtKB/Swiss-Prot;Acc:P42170])

HSP 1 Score: 383.645 bits (984), Expect = 1.750e-130
Identity = 198/315 (62.86%), Postives = 243/315 (77.14%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV---EDKHKFD 1031
            E +L +  +R     +++ DIW  + KA +SFWTV EV+L KD   W+KMN DE+YFI+ +LAFFAASDGIVNENL ERF  EV++ EA  FY FQIAIENIHSEMYS LI++Y+ D   +N LFNA++    ++KKA WALRWISDKK++F  R++AFAAVEGIFFSGSFASIFWLKKRGLMPGL  SNELISRDEGLH DFACL++  L  K + +++ D+IK+AV IE+EFLT+ALPV +IGMN   M +YIEFVAD LLVELGCDK + ++NP DFM+NI IDGKTNFFEKRV EY    V   E + +FD
Sbjct:   62 EPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEKMNGDEQYFISRILAFFAASDGIVNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYIRDETERNTLFNAVDEFEFIKKKADWALRWISDKKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQKKLTQQRIYDIIKDAVAIEQEFLTEALPVDMIGMNCRLMSQYIEFVADHLLVELGCDKLYKSKNPFDFMENISIDGKTNFFEKRVSEYQRPGVMVNEAERQFD 376          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Match: F19G12.2 (pep:known chromosome:WBcel235:X:1427774:1430871:1 gene:WBGene00017610 transcript:F19G12.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F19G12.2)

HSP 1 Score: 211.075 bits (536), Expect = 3.175e-61
Identity = 117/206 (56.80%), Postives = 151/206 (73.30%), Query Frame = 3
Query:  384 IAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLH--CDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEY 995
            IA+ENIHSEMY+ L+++Y+ D   +N LFNAI T   ++ KA W LRWISD  + F  R+ AFAAVEGIFFS SFA+IFWLKKRGL+PGL  SNELIS    LH  C F+    +    KP+  ++ ++I E+V +E++F+ ++LP +LIGMN   MC+Y+EFVAD LL ELG  K +NT+NP DFM+NI I+GKTNFFEKRV EY
Sbjct:  445 IAVENIHSEMYAKLLEAYIRDDAERNILFNAITTFKFIKAKADWCLRWISDHNAPFSERLAAFAAVEGIFFSSSFAAIFWLKKRGLLPGLTHSNELISMFL-LHPNCFFSTFNLQR-RRKPAESRITEIINESVLVEQDFVRESLPTNLIGMNQHMMCKYVEFVADLLLEELGYSKRYNTKNPFDFMENISIEGKTNFFEKRVSEY 648          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Fly
Match: RnrS (Ribonucleoside diphosphate reductase small subunit [Source:FlyBase gene name;Acc:FBgn0011704])

HSP 1 Score: 419.853 bits (1078), Expect = 2.148e-144
Identity = 208/306 (67.97%), Postives = 250/306 (81.70%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            +E LL E+  R     IQY DIW+M+ KA +SFWTV EV+LSKD   W ++ DDER+FI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+EN+HSEMYS+LID+Y+ D   +  LFNAIETMP V++KA WAL WIS K + FG R++AFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFA LMF++L  +P  E+++++I++AV IE+EFLTDALPV+LIGMN + M +YIEFVADRLLVELG  K +NT+NP +FM+ I +DGKTNFFEK+VGEY    V
Sbjct:   73 LEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWHRLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSWISSKSANFGERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLVQRPKRERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYNTKNPFNFMEMISLDGKTNFFEKKVGEYQRMGV 378          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-25])

HSP 1 Score: 427.172 bits (1097), Expect = 1.219e-147
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   39 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 343          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-25])

HSP 1 Score: 427.172 bits (1097), Expect = 1.219e-147
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   39 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 343          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-25])

HSP 1 Score: 426.787 bits (1096), Expect = 1.230e-147
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 342          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-25])

HSP 1 Score: 426.017 bits (1094), Expect = 1.260e-147
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 319          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:ZFIN;Acc:ZDB-GENE-990415-25])

HSP 1 Score: 427.557 bits (1098), Expect = 1.613e-147
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:Xenbase;Acc:XB-GENE-970633])

HSP 1 Score: 420.624 bits (1080), Expect = 1.220e-145
Identity = 215/311 (69.13%), Postives = 250/311 (80.39%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYS----MSSVED 1016
            E  L ++  R     I Y DIW+M+ KA++SFWT  EV+LSKD  HW+K+  +ER FI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLI++Y+ D   +  LFNAIETMPCV+KKAQWALRWISD+K++FG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLH DFACLMF YL  KP+ E+V ++I  AV IE+EFLT+ALPVSLIGMN   M  YIEFVADRLLVELGC K +  ENP DFM+NI ++GKTNFFEKRV EY     M+  ED
Sbjct:   27 EPFLRKNPQRFVIFPIHYPDIWKMYKKAQASFWTAEEVDLSKDLVHWEKLKPEERNFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIETYIKDPRRREFLFNAIETMPCVRKKAQWALRWISDRKASFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFHYLVKKPTEERVTEIIVNAVRIEQEFLTEALPVSLIGMNCTLMKTYIEFVADRLLVELGCSKAFKAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAHTED 337          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:Xenbase;Acc:XB-GENE-947052])

HSP 1 Score: 410.223 bits (1053), Expect = 6.804e-141
Identity = 209/313 (66.77%), Postives = 253/313 (80.83%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYS----MSSVEDKH 1022
            E LL ++  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +E+YFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA+WALRWISD+++ F  R+VAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLH DFACL+FK++  KPS ++V ++I +AV IE+EFLT+ALPV LIGMN + M +YIEFVADRLL+ELG  K + +ENP DFM+NI ++GKTNFFEK+V EY     MS   DK 
Sbjct:   67 EPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRWISDREAPFCERIVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVVHKPSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCKLMKQYIEFVADRLLLELGFKKIFKSENPFDFMENISLEGKTNFFEKKVAEYQKMGVMSKATDKQ 379          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:Xenbase;Acc:XB-GENE-947052])

HSP 1 Score: 409.838 bits (1052), Expect = 9.634e-141
Identity = 209/313 (66.77%), Postives = 253/313 (80.83%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYS----MSSVEDKH 1022
            E LL ++  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI++VLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA+WALRWISD+++ F  R+VAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLH DFACL+FK++  KPS ++V ++I +AV IE+EFLT+ALPV LIGMN + M +YIEFVADRLL+ELG  K + +ENP DFM+NI ++GKTNFFEK+V EY     MS   DK 
Sbjct:   67 EPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRWISDREAPFCERIVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVVHKPSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCKLMKQYIEFVADRLLLELGFKKIFKSENPFDFMENISLEGKTNFFEKKVAEYQKMGVMSKATDKQ 379          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2.1 (ribonucleotide reductase M2, gene 1 [Source:Xenbase;Acc:XB-GENE-947052])

HSP 1 Score: 407.527 bits (1046), Expect = 5.561e-140
Identity = 209/313 (66.77%), Postives = 254/313 (81.15%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYS----MSSVEDKH 1022
            E LL ++  R   L I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI++VLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA+WALRWISD+++ F  R+VAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLH DFACL+FK++  KPS ++V ++I +AV IE+EFLT+ALPV LIGMN + M +YIEFVADRLL+ELG  K + +ENP DFM+NI ++GKTNFFEK+V EY     MS   DK 
Sbjct:   59 EPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKAEWALRWISDREAPFCERIVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVVHKPSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCKLMKQYIEFVADRLLLELGFKKIFKSENPFDFMENISLEGKTNFFEKKVAEYQKMGVMSKATDKQ 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 423.32 bits (1087), Expect = 1.030e-145
Identity = 213/305 (69.84%), Postives = 250/305 (81.97%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KP+ ++V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG +K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 375          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 421.394 bits (1082), Expect = 2.022e-145
Identity = 213/305 (69.84%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS ++V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLL ELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 387.497 bits (994), Expect = 6.362e-133
Identity = 197/270 (72.96%), Postives = 228/270 (84.44%), Query Frame = 3
Query:  201 NEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
             EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS ++V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLL ELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   15 GEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 284          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 290.812 bits (743), Expect = 5.494e-96
Identity = 164/286 (57.34%), Postives = 190/286 (66.43%), Query Frame = 3
Query:  153 DIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRD                                    EF+ D L + L                       G +K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:    2 DIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRD------------------------------------EFVADRLMLEL-----------------------GFNKIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 228          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 254.218 bits (648), Expect = 5.487e-82
Identity = 133/186 (71.51%), Postives = 154/186 (82.80%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGL 653
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL
Sbjct:   40 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL 225          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|P79733|RIR2_DANRE (Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio GN=rrm2 PE=1 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.411e-146
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q7LG56|RIR2B_HUMAN (Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens GN=RRM2B PE=1 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.048e-145
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q5R9G0|RIR2B_PONAB (Ribonucleoside-diphosphate reductase subunit M2 B OS=Pongo abelii GN=RRM2B PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.551e-145
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q4R741|RIR2B_MACFA (Ribonucleoside-diphosphate reductase subunit M2 B OS=Macaca fascicularis GN=RRM2B PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.692e-145
Identity = 215/305 (70.49%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q60561|RIR2_MESAU (Ribonucleoside-diphosphate reductase subunit M2 OS=Mesocricetus auratus GN=RRM2 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 3.608e-145
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS ++V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG +K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWKMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEQRVQEIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFKVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 375          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: tr|I1ZI90|I1ZI90_SCHMD (Ribonucleoside diphosphate reductase subunit M2-2 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 1040
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 316          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: tr|W4Z9V7|W4Z9V7_STRPU (Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Rrm2_1 PE=4 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 7.104e-146
Identity = 221/319 (69.28%), Postives = 253/319 (79.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEY--------SMSSVEDKHKF 1028
            E LL E+  R     IQY DIW+ + KA +SFWT  EV+LSKD  HW  + D+ER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIAIENIHSEMYSLLID+Y+ D+  ++ LFNA+ET+PCV KKAQWAL WI    + FGTR+VAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L++KP  E V  +IKEAV IE+EFLTDALP SLIGMNA  M  YIEFVADRLLVELGC K W  ENP DFM+NI ++GKTNFFEKRVGEY        + SS + +H F
Sbjct:   88 EPLLRENARRFVIFPIQYHDIWQFYKKAEASFWTAEEVDLSKDLDHWANLKDEERHFISHVLAFFAASDGIVNENLVERFSQEVQVAEARCFYGFQIAIENIHSEMYSLLIDTYIKDSVQRDFLFNAVETLPCVTKKAQWALNWIGSDSADFGTRIVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLNNKPDEEHVQGIIKEAVAIEQEFLTDALPCSLIGMNAVLMKRYIEFVADRLLVELGCGKIWKVENPFDFMENISLEGKTNFFEKRVGEYQKMGVMSSTNSSTKKQHTF 406          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: tr|F6TAK8|F6TAK8_CIOIN (Uncharacterized protein OS=Ciona intestinalis GN=LOC100175066 PE=4 SV=2)

HSP 1 Score: 428.328 bits (1100), Expect = 5.849e-145
Identity = 215/308 (69.81%), Postives = 255/308 (82.79%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDK 1019
            E LL E+  R     IQY DIW+M+ KA +SFWTV EV+LSKD  HW+ +  +ER FI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIAIENIHSEMYSLLI++Y+ DT  +  LFNAIET+PCV+KKA+WAL+WISD +ST+  R++AFA+VEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS  +V++++K+AV IE+EFLTDALPV+LIGMN + M +YIEFVADRLLVELGC K +  ENP DFM+ I ++GKTNFFEKRVGEY  + V  K
Sbjct:   48 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDMVHWEALKPNERKFISHVLAFFAASDGIVNENLVERFAQEVQITEARFFYGFQIAIENIHSEMYSLLINTYIRDTHEREFLFNAIETLPCVRKKAEWALKWISDSESTYAERIIAFASVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLLHKPSEARVVEIVKDAVTIEQEFLTDALPVALIGMNNKLMKQYIEFVADRLLVELGCSKVFKVENPFDFMELISLEGKTNFFEKRVGEYQKAGVMAK 355          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: tr|G3WZC8|G3WZC8_SARHA (Uncharacterized protein OS=Sarcophilus harrisii GN=RRM2B PE=4 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 6.422e-145
Identity = 216/305 (70.82%), Postives = 252/305 (82.62%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV+IPEA  FY FQI IENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV++KA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF YL +KPS E+V ++I  AV IE+EFLTDALPV LIG+N   M +YIEFVADRLLVELG  K ++++NP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQIPEARCFYGFQILIENIHSEMYSLLIDTYIKDPQKREFLFNAIETMPCVKRKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVNKPSEERVKEIIIHAVEIEQEFLTDALPVGLIGINCTLMKQYIEFVADRLLVELGFSKIFHSDNPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: tr|K7IUI1|K7IUI1_NASVI (Uncharacterized protein OS=Nasonia vitripennis GN=LOC100114323 PE=4 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 7.735e-145
Identity = 213/302 (70.53%), Postives = 251/302 (83.11%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYS 998
            +E LL E+  R     IQ+ DIW M+ KA +SFWTV EV+LSKD A W ++ND+ER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQ+AIENIHSEMYSLLID+Y++D   +  LFNAIET+PCV KKA WAL WIS   +TF  RV+AFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK++  KPS E+V+ +IK+AV IE+EFLTDALPV +IGMN   MC+YIEFVADRLL ELGC K +N+ENP DFM++I ++GKTNFFEK+VGEY 
Sbjct:   66 LEPLLKENPGRFVLFPIQWPDIWHMYKKAEASFWTVEEVDLSKDMADWNRLNDNERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQVAIENIHSEMYSLLIDTYISDASQRQFLFNAIETLPCVAKKANWALNWISHDSATFAERVIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHIVQKPSEERVISIIKDAVTIEQEFLTDALPVEMIGMNCRLMCQYIEFVADRLLGELGCPKVYNSENPFDFMEHISLEGKTNFFEKKVGEYQ 367          
The following BLAST results are available for this feature:
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
RRM2B2.039e-14670.16ribonucleotide reductase regulatory TP53 inducible... [more]
RRM21.162e-14570.82ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM2B9.760e-14570.16ribonucleotide reductase regulatory TP53 inducible... [more]
RRM21.266e-14470.82ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM21.266e-14470.82ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 2
Match NameE-valueIdentityDescription
rnr-21.750e-13062.86Ribonucleoside-diphosphate reductase small chain ... [more]
F19G12.23.175e-6156.80pep:known chromosome:WBcel235:X:1427774:1430871:1 ... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 1
Match NameE-valueIdentityDescription
RnrS2.148e-14467.97Ribonucleoside diphosphate reductase small subunit... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
rrm21.219e-14771.48ribonucleotide reductase M2 polypeptide [Source:ZF... [more]
rrm21.219e-14771.48ribonucleotide reductase M2 polypeptide [Source:ZF... [more]
rrm21.230e-14771.48ribonucleotide reductase M2 polypeptide [Source:ZF... [more]
rrm21.260e-14771.48ribonucleotide reductase M2 polypeptide [Source:ZF... [more]
rrm21.613e-14771.48ribonucleotide reductase M2 polypeptide [Source:ZF... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 4
Match NameE-valueIdentityDescription
rrm2b1.220e-14569.13ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
rrm2.16.804e-14166.77ribonucleotide reductase M2, gene 1 [Source:Xenbas... [more]
rrm2.19.634e-14166.77ribonucleotide reductase M2, gene 1 [Source:Xenbas... [more]
rrm2.15.561e-14066.77ribonucleotide reductase M2, gene 1 [Source:Xenbas... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Rrm21.030e-14569.84ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm2b2.022e-14569.84ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm2b6.362e-13372.96ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm25.494e-9657.34ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm25.487e-8271.51ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P79733|RIR2_DANRE1.411e-14671.48Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|Q7LG56|RIR2B_HUMAN1.048e-14570.16Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q5R9G0|RIR2B_PONAB1.551e-14570.16Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q4R741|RIR2B_MACFA1.692e-14570.49Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q60561|RIR2_MESAU3.608e-14570.16Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|I1ZI90|I1ZI90_SCHMD0.000e+0100.00Ribonucleoside diphosphate reductase subunit M2-2 ... [more]
tr|W4Z9V7|W4Z9V7_STRPU7.104e-14669.28Uncharacterized protein OS=Strongylocentrotus purp... [more]
tr|F6TAK8|F6TAK8_CIOIN5.849e-14569.81Uncharacterized protein OS=Ciona intestinalis GN=L... [more]
tr|G3WZC8|G3WZC8_SARHA6.422e-14570.82Uncharacterized protein OS=Sarcophilus harrisii GN... [more]
tr|K7IUI1|K7IUI1_NASVI7.735e-14570.53Uncharacterized protein OS=Nasonia vitripennis GN=... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020153Vaccinia virus, F-OrfBPRODOMPD058601coord: 2..47
e-value: 6.0E-9
score: 139.0
NoneNo IPR availableTMHMMTMhelixcoord: 4..22
IPR000358Ribonucleotide reductase small subunitPFAMPF00268Ribonuc_red_smcoord: 16..281
e-value: 1.5E-115
score: 385.3
IPR012348Ribonucleotide reductase-relatedGENE3DG3DSA:1.10.620.20coord: 5..288
e-value: 3.4E-119
score: 397.3
IPR030475Ribonucleotide reductase small subunit, acitve sitePROSITEPS00368RIBORED_SMALLcoord: 103..119
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 5..306

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020153Vaccinia_virus_F-OrfBB
IPR000358RNR_small
IPR012348RNR-rel
IPR030475RNR_small_AS
IPR009078Ferritin-like_SF
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0009186deoxyribonucleoside diphosphate metabolic process
GO:0009263deoxyribonucleotide biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast compartment
PLANA:0004517blastomere
PLANA:0000212blastomere compartment
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000003Stage 3
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010115 ID=SMED30010115|Name=ribonucleoside diphosphate reductase subunit M2-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1127bp
GTTTTTAATGAACTGAATCAGGTTTAATGCAAAATAGTCATTTTAATTTC
TAGATAAATTAACAGTAATTCTTTCGAGATTAGATATTTATTATGGAGAT
TTTATTAACAGAAGATAAAAGTCGAATAGGATTTCTTAATATACAATATG
AAGATATATGGGAAATGTTTAATAAAGCTCGATCTTCATTTTGGACTGTA
AATGAAGTTAATTTATCAAAAGATTTTGCTCACTGGAAAAAAATGAATGA
CGATGAACGGTATTTCATTACTCACGTTCTTGCATTTTTTGCTGCCAGTG
ATGGAATTGTCAATGAAAATCTCGTCGAAAGATTCATTCAAGAAGTGAAA
ATTCCCGAAGCTGAGGCATTTTACAGTTTTCAAATTGCAATTGAAAACAT
TCATTCAGAAATGTATTCTCTATTAATCGATTCTTATGTTACTGATACAG
AAACAAAGAATAAATTATTTAATGCCATCGAAACTATGCCATGCGTTCAG
AAAAAAGCTCAATGGGCATTGCGTTGGATTAGCGATAAAAAATCCACTTT
TGGAACTAGAGTTGTTGCATTTGCTGCTGTCGAGGGAATATTTTTCAGTG
GTAGTTTTGCATCGATATTTTGGCTTAAAAAGCGTGGATTAATGCCCGGA
TTATGTTTCAGCAACGAATTAATTAGCCGAGATGAAGGACTTCATTGCGA
TTTTGCTTGTTTGATGTTTAAATATTTAAGTAGCAAACCGTCACCTGAAC
AAGTTTTGGATTTGATCAAAGAAGCTGTCGGAATCGAGAAGGAATTTCTC
ACCGACGCATTGCCGGTTTCATTGATTGGCATGAACGCTGAATCGATGTG
TGAGTATATTGAATTTGTGGCCGACCGGCTGCTGGTTGAATTGGGCTGTG
ACAAGTTCTGGAACACAGAGAACCCGTTGGATTTCATGGATAATATTTGC
ATCGATGGGAAAACTAACTTCTTTGAGAAACGAGTCGGTGAATATTCCAT
GTCGAGCGTTGAGGACAAACACAAATTTGATGATGTCAATTTCGATATTG
ATTTTTGAGGGATTCCGTTTTTTGGCGCCAGTGTGCATTTAATGTGTTTT
GGTTGTAATTGGCTATTTTTGTTTGTT
back to top

protein sequence of SMED30010115-orf-1

>SMED30010115-orf-1 ID=SMED30010115-orf-1|Name=SMED30010115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKK
MNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAI
ENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKK
STFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGL
HCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAE
SMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGE
YSMSSVEDKHKFDDVNFDIDF*
back to top
Aliases
The feature 'ribonucleoside diphosphate reductase subunit M2-2' has the following synonyms
Synonym
RRM2-2
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010115
GenBankAFJ24744.1