ribonucleoside diphosphate reductase subunit M2-2

Overview
Nameribonucleoside diphosphate reductase subunit M2-2 (AFJ24744.1)
Smed IDSMED30010115
Uniprot Best hitRibonucleoside-diphosphate reductase subunit M2 OS=Danio rerio OX=7955 GN=rrm2 PE=1 SV=1 (E=2.36217e-148)
Length (bp)1127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) t-SNE clustered cells

Violin plots show distribution of expression levels for ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ribonucleoside diphosphate reductase subunit M2-2 (SMED30010115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: xFYMtWEa

 

back to top

Expression Details

ribonucleoside diphosphate reductase subunit M2-2 ( RRM2-2 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and RNR M2-2 (green). RNR M2-2 expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express RNR M2-2. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

Anatomical Expression

PAGE et. al., 2020




SMED30010115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 39

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 dd_Smed_v4_2286_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SmWIOct06_040692GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SmWIOct06_034731GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED_00510_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED_00510_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 JX010501.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
X1 cellSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SmedASXL_009993SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X2 cellSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SmedASXL_009993SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 SMED30010115smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
X1 cellSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 CUFF.307465.1be_Smed_v2PMID:22543868FACS sorted cell populationasexual adultRNA-sequencing evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
neoblastSMED30010115SMESG000079368.1 SMESG000044188.1 SMESG000044184.1 AFJ24744.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Homology
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2B (ribonucleotide reductase regulatory TP53 inducible subunit M2B [Source:HGNC Symbol;Acc:HGNC:17296])

HSP 1 Score: 424.091 bits (1089), Expect = 3.621e-148
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 423.705 bits (1088), Expect = 2.114e-147
Identity = 216/305 (70.82%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS E+V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 374          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 423.705 bits (1088), Expect = 2.114e-147
Identity = 216/305 (70.82%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS E+V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   70 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 374          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2B (ribonucleotide reductase regulatory TP53 inducible subunit M2B [Source:HGNC Symbol;Acc:HGNC:17296])

HSP 1 Score: 422.165 bits (1084), Expect = 1.806e-146
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   89 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 393          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 423.32 bits (1087), Expect = 2.392e-146
Identity = 216/305 (70.82%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +ERYFI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS E+V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:  130 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 434          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Match: rnr-2 (Ribonucleoside-diphosphate reductase small chain [Source:UniProtKB/Swiss-Prot;Acc:P42170])

HSP 1 Score: 383.645 bits (984), Expect = 3.682e-132
Identity = 198/315 (62.86%), Postives = 243/315 (77.14%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV---EDKHKFD 1031
            E +L +  +R     +++ DIW  + KA +SFWTV EV+L KD   W+KMN DE+YFI+ +LAFFAASDGIVNENL ERF  EV++ EA  FY FQIAIENIHSEMYS LI++Y+ D   +N LFNA++    ++KKA WALRWISDKK++F  R++AFAAVEGIFFSGSFASIFWLKKRGLMPGL  SNELISRDEGLH DFACL++  L  K + +++ D+IK+AV IE+EFLT+ALPV +IGMN   M +YIEFVAD LLVELGCDK + ++NP DFM+NI IDGKTNFFEKRV EY    V   E + +FD
Sbjct:   62 EPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEKMNGDEQYFISRILAFFAASDGIVNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYIRDETERNTLFNAVDEFEFIKKKADWALRWISDKKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQKKLTQQRIYDIIKDAVAIEQEFLTEALPVDMIGMNCRLMSQYIEFVADHLLVELGCDKLYKSKNPFDFMENISIDGKTNFFEKRVSEYQRPGVMVNEAERQFD 376          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Match: F19G12.2 (pep chromosome:WBcel235:X:1427774:1430871:1 gene:WBGene00017610.1 transcript:F19G12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F19G12.2)

HSP 1 Score: 211.075 bits (536), Expect = 3.648e-62
Identity = 117/206 (56.80%), Postives = 151/206 (73.30%), Query Frame = 3
Query:  384 IAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLH--CDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEY 995
            IA+ENIHSEMY+ L+++Y+ D   +N LFNAI T   ++ KA W LRWISD  + F  R+ AFAAVEGIFFS SFA+IFWLKKRGL+PGL  SNELIS    LH  C F+    +    KP+  ++ ++I E+V +E++F+ ++LP +LIGMN   MC+Y+EFVAD LL ELG  K +NT+NP DFM+NI I+GKTNFFEKRV EY
Sbjct:  445 IAVENIHSEMYAKLLEAYIRDDAERNILFNAITTFKFIKAKADWCLRWISDHNAPFSERLAAFAAVEGIFFSSSFAAIFWLKKRGLLPGLTHSNELISMFL-LHPNCFFSTFNLQR-RRKPAESRITEIINESVLVEQDFVRESLPTNLIGMNQHMMCKYVEFVADLLLEELGYSKRYNTKNPFDFMENISIEGKTNFFEKRVSEY 648          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Fly
Match: RnrS (gene:FBgn0011704 transcript:FBtr0088046)

HSP 1 Score: 419.853 bits (1078), Expect = 3.657e-146
Identity = 208/306 (67.97%), Postives = 250/306 (81.70%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            +E LL E+  R     IQY DIW+M+ KA +SFWTV EV+LSKD   W ++ DDER+FI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+EN+HSEMYS+LID+Y+ D   +  LFNAIETMP V++KA WAL WIS K + FG R++AFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFA LMF++L  +P  E+++++I++AV IE+EFLTDALPV+LIGMN + M +YIEFVADRLLVELG  K +NT+NP +FM+ I +DGKTNFFEK+VGEY    V
Sbjct:   73 LEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWHRLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSWISSKSANFGERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLVQRPKRERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYNTKNPFNFMEMISLDGKTNFFEKKVGEYQRMGV 378          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 426.787 bits (1096), Expect = 2.353e-149
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 342          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 426.787 bits (1096), Expect = 2.353e-149
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 342          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 426.017 bits (1094), Expect = 2.386e-149
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 319          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 426.017 bits (1094), Expect = 2.386e-149
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 319          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 427.557 bits (1098), Expect = 3.129e-149
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 424.476 bits (1090), Expect = 6.335e-148
Identity = 215/310 (69.35%), Postives = 254/310 (81.94%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHK 1025
            E LL ++  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +E+YFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E+V+ LI +AV IE+EFLT+ALPV+LIGMN   M +YIEFVADRLL+ELG +K +   NP DFM+NI ++GKTNFFEK+VGEY    V  K K
Sbjct:   61 EPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPFDFMENISLEGKTNFFEKKVGEYQKMGVMSKPK 370          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 422.165 bits (1084), Expect = 7.558e-148
Identity = 215/310 (69.35%), Postives = 254/310 (81.94%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHK 1025
            E LL ++  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +E+YFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E+V+ LI +AV IE+EFLT+ALPV+LIGMN   M +YIEFVADRLL+ELG +K +   NP DFM+NI ++GKTNFFEK+VGEY    V  K K
Sbjct:    5 EPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPFDFMENISLEGKTNFFEKKVGEYQKMGVMSKPK 314          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 422.165 bits (1084), Expect = 1.032e-147
Identity = 215/310 (69.35%), Postives = 254/310 (81.94%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHK 1025
            E LL ++  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +E+YFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E+V+ LI +AV IE+EFLT+ALPV+LIGMN   M +YIEFVADRLL+ELG +K +   NP DFM+NI ++GKTNFFEK+VGEY    V  K K
Sbjct:   12 EPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPFDFMENISLEGKTNFFEKKVGEYQKMGVMSKPK 321          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:NCBI gene;Acc:100144925])

HSP 1 Score: 421.779 bits (1083), Expect = 1.788e-147
Identity = 215/311 (69.13%), Postives = 250/311 (80.39%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYS----MSSVED 1016
            E  L ++  R     I Y DIW+M+ KA++SFWT  EV+LSKD  HW+K+  +ER FI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLI++Y+ D   +  LFNAIETMPCV+KKAQWALRWISD+K++FG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLH DFACLMF YL  KP+ E+V ++I  AV IE+EFLT+ALPVSLIGMN   M  YIEFVADRLLVELGC K +  ENP DFM+NI ++GKTNFFEKRV EY     M+  ED
Sbjct:   18 EPFLRKNPQRFVIFPIHYPDIWKMYKKAQASFWTAEEVDLSKDLVHWEKLKPEERNFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIETYIKDPRRREFLFNAIETMPCVRKKAQWALRWISDRKASFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFHYLVKKPTEERVTEIIVNAVRIEQEFLTEALPVSLIGMNCTLMKTYIEFVADRLLVELGCSKAFKAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAHTED 328          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 422.55 bits (1085), Expect = 1.789e-147
Identity = 215/310 (69.35%), Postives = 254/310 (81.94%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHK 1025
            E LL ++  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ +  +E+YFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E+V+ LI +AV IE+EFLT+ALPV+LIGMN   M +YIEFVADRLL+ELG +K +   NP DFM+NI ++GKTNFFEK+VGEY    V  K K
Sbjct:   33 EPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPFDFMENISLEGKTNFFEKKVGEYQKMGVMSKPK 342          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 423.32 bits (1087), Expect = 1.952e-147
Identity = 213/305 (69.84%), Postives = 250/305 (81.97%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KP+ ++V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG +K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 375          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 421.394 bits (1082), Expect = 3.775e-147
Identity = 213/305 (69.84%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS ++V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLL ELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 387.497 bits (994), Expect = 1.299e-134
Identity = 197/270 (72.96%), Postives = 228/270 (84.44%), Query Frame = 3
Query:  201 NEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
             EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS ++V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLL ELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   15 GEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 284          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 290.812 bits (743), Expect = 1.659e-97
Identity = 164/286 (57.34%), Postives = 190/286 (66.43%), Query Frame = 3
Query:  153 DIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRD                                    EF+ D L + L                       G +K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:    2 DIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRD------------------------------------EFVADRLMLEL-----------------------GFNKIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 228          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 254.218 bits (648), Expect = 2.029e-83
Identity = 133/186 (71.51%), Postives = 154/186 (82.80%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGL 653
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL
Sbjct:   40 EPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL 225          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|P79733|RIR2_DANRE (Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio OX=7955 GN=rrm2 PE=1 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 2.362e-148
Identity = 218/305 (71.48%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW  + D+ERYFI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WAL WI DK + +G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V  +I  AV IE+EFLTDALPV LIGMN + M +YIEFVADRLL+ELG DK +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q7LG56|RIR2B_HUMAN (Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B PE=1 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.739e-147
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q5R9G0|RIR2B_PONAB (Ribonucleoside-diphosphate reductase subunit M2 B OS=Pongo abelii OX=9601 GN=RRM2B PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.577e-147
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEG+FFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q4R741|RIR2B_MACFA (Ribonucleoside-diphosphate reductase subunit M2 B OS=Macaca fascicularis OX=9541 GN=RRM2B PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.812e-147
Identity = 215/305 (70.49%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL +   R     IQY DIW+M+ +A++SFWT  EV+LSKD  HW K+  DE+YFI+H+LAFFAASDGIVNENLVERF QEV++PEA  FY FQI IEN+HSEMYSLLID+Y+ D + +  LFNAIETMP V+KKA WALRWI+D+KSTFG RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF+YL +KPS E+V ++I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLLVELG  K +  ENP DFM+NI ++GKTNFFEKRV EY   +V
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAV 336          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Match: sp|Q60561|RIR2_MESAU (Ribonucleoside-diphosphate reductase subunit M2 OS=Mesocricetus auratus OX=10036 GN=RRM2 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 6.114e-147
Identity = 214/305 (70.16%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+ +  DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNAIETMPCV+KKA WALRWI DK++T+G RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L  KPS ++V ++I  AV IE+EFLT+ALPV LIGMN   M +YIEFVADRL++ELG +K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   71 EPLLRENPRRFVVFPIEYHDIWKMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEQRVQEIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFKVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 375          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|20311053 (tr|I1ZI90|I1ZI90_SCHMD Ribonucleoside diphosphate reductase subunit M2-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 1040
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 316          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|21465025 (tr|A0A1W4XEU3|A0A1W4XEU3_AGRPL ribonucleoside-diphosphate reductase subunit M2 B OS=Agrilus planipennis OX=224129 GN=LOC108743458 PE=4 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 4.716e-149
Identity = 222/306 (72.55%), Postives = 252/306 (82.35%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            +E LL E+  R     IQY DIWE + +A +SFWT  EV+LSKD AHW K+++DER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIAIENIHSEMYS LID+Y+ D E K  LFNAIETMPCV+KKA WAL WIS K +TF  RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF Y+  KPS E+V D+I++AV IE+EFLTDALPVSLIGMN + M +YIEFVADRLLVELGCDK +N +NP DFM+ I  DGKTNFFEK+VGEY    V
Sbjct:   56 VEPLLRENPRRFVIFPIQYPDIWEKYKEAEASFWTTEEVDLSKDLAHWDKLSNDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAIENIHSEMYSTLIDTYIFDPEEKEFLFNAIETMPCVKKKADWALHWISSKNATFPERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFSYIVQKPSKERVTDIIRDAVKIEQEFLTDALPVSLIGMNCKLMSQYIEFVADRLLVELGCDKIYNVKNPFDFMNKISTDGKTNFFEKKVGEYQKIGV 361          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|19688027 (tr|W4Z9V7|W4Z9V7_STRPU Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 2.820e-147
Identity = 221/319 (69.28%), Postives = 253/319 (79.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEY--------SMSSVEDKHKF 1028
            E LL E+  R     IQY DIW+ + KA +SFWT  EV+LSKD  HW  + D+ER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIAIENIHSEMYSLLID+Y+ D+  ++ LFNA+ET+PCV KKAQWAL WI    + FGTR+VAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L++KP  E V  +IKEAV IE+EFLTDALP SLIGMNA  M  YIEFVADRLLVELGC K W  ENP DFM+NI ++GKTNFFEKRVGEY        + SS + +H F
Sbjct:   88 EPLLRENARRFVIFPIQYHDIWQFYKKAEASFWTAEEVDLSKDLDHWANLKDEERHFISHVLAFFAASDGIVNENLVERFSQEVQVAEARCFYGFQIAIENIHSEMYSLLIDTYIKDSVQRDFLFNAVETLPCVTKKAQWALNWIGSDSADFGTRIVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLNNKPDEEHVQGIIKEAVAIEQEFLTDALPCSLIGMNAVLMKRYIEFVADRLLVELGCGKIWKVENPFDFMENISLEGKTNFFEKRVGEYQKMGVMSSTNSSTKKQHTF 406          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18253157 (tr|A0A267H4E0|A0A267H4E0_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018616g1 PE=4 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 8.495e-147
Identity = 213/306 (69.61%), Postives = 254/306 (83.01%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            +E LL E+  R   + IQY DIW+M+ KA +SFWTV EV+LSKD   WK++ D+ER+F+++VLAFFAASDGIVNENLVERF QEV+IPEA  FY FQI IENIHSEMYSLLIDSYV D   ++ LFNAIET+P V++KA WAL WIS K++TFG RVVAFAAVEGIFFSGSFA++FWLKKRGLMPGL FSNELISRDEGLH DFACLMF++L   PS +++ ++I++AV IE+ FLT+ALPVSLIGMN  SMC YIEFVADRLL EL C K +N+ENP DFM+NI ++GKTNFFEKRVGEY  + V
Sbjct:   56 LEPLLKENPHRFVIMPIQYHDIWQMYKKAVASFWTVEEVDLSKDLEDWKQLTDNERHFVSYVLAFFAASDGIVNENLVERFAQEVQIPEARCFYGFQIMIENIHSEMYSLLIDSYVRDPAQRDLLFNAIETLPPVRQKADWALNWISHKRATFGERVVAFAAVEGIFFSGSFAAVFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFRHLQRPPSSQRIEEIIRDAVRIEQSFLTEALPVSLIGMNCASMCRYIEFVADRLLTELNCPKAFNSENPFDFMENISLEGKTNFFEKRVGEYQKAGV 361          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18314035 (tr|A0A267GMY6|A0A267GMY6_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006704g2 PE=4 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.485e-146
Identity = 213/305 (69.84%), Postives = 253/305 (82.95%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R   + IQY DIW+M+ KA +SFWTV EV+LSKD   WK++ D+ER+F+++VLAFFAASDGIVNENLVERF QEV+IPEA  FY FQI IENIHSEMYSLLIDSYV D   ++ LFNAIET+P V++KA WAL WIS K++TFG RVVAFAAVEGIFFSGSFA++FWLKKRGLMPGL FSNELISRDEGLH DFACLMF++L   PS +++ ++I++AV IE+ FLT+ALPVSLIGMN  SMC YIEFVADRLL EL C K +N+ENP DFM+NI ++GKTNFFEKRVGEY  + V
Sbjct:   58 EPLLKENPHRFVIMPIQYHDIWQMYKKAVASFWTVEEVDLSKDLEDWKQLTDNERHFVSYVLAFFAASDGIVNENLVERFAQEVQIPEARCFYGFQIMIENIHSEMYSLLIDSYVRDPAQRDLLFNAIETLPPVRQKADWALNWISHKRATFGERVVAFAAVEGIFFSGSFAAVFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFRHLQRPPSSQRIEEIIRDAVRIEQSFLTEALPVSLIGMNCASMCRYIEFVADRLLTELNCPKAFNSENPFDFMENISLEGKTNFFEKRVGEYQKAGV 362          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:103024314])

HSP 1 Score: 419.853 bits (1078), Expect = 3.940e-146
Identity = 210/305 (68.85%), Postives = 247/305 (80.98%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ + D+ERYFI+HVLAFFAASDGIVNENLVERF+QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNA+ET+PCV+KKA WAL WI +K + +G RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS   V  +I  AV IE+EFLT ALPV LIGMN + M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   67 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAASDGIVNENLVERFMQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAVETLPCVKKKADWALNWIGNKNAKYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLMNKPSESTVKKIIMNAVQIEQEFLTQALPVKLIGMNCDLMKQYIEFVADRLMLELGFSKIYKVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:103024314])

HSP 1 Score: 419.853 bits (1078), Expect = 3.940e-146
Identity = 210/305 (68.85%), Postives = 247/305 (80.98%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ KA +SFWT  EV+LSKD  HW+ + D+ERYFI+HVLAFFAASDGIVNENLVERF+QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D++ +  LFNA+ET+PCV+KKA WAL WI +K + +G RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS   V  +I  AV IE+EFLT ALPV LIGMN + M +YIEFVADRL++ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   67 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAASDGIVNENLVERFMQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAVETLPCVKKKADWALNWIGNKNAKYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLMNKPSESTVKKIIMNAVQIEQEFLTQALPVKLIGMNCDLMKQYIEFVADRLMLELGFSKIYKVENPFDFMENISLEGKTNFFEKRVGEYQRMGV 371          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B-like [Source:NCBI gene;Acc:103028967])

HSP 1 Score: 411.764 bits (1057), Expect = 1.562e-143
Identity = 202/305 (66.23%), Postives = 251/305 (82.30%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+K R     IQY DIW+M+ +A++SFWTV EV+LSKD  HW+K+   ER+FI+HVLAFFAASDGIVNENLV+RF QEV++PEA +FY FQI IE++HSEMYS+LI++Y+ D + ++ LFNAIETMPCV++KA WAL+WISD+ STFG R++AFAAVEGIFFSGSFA+I+WLKKRGLMPGL +SNELISRDEGLHC+FACLM+ YL  KPS ++V D+I +AV IE+EFLT+ALPV LIG+N   M +YIEFVADRLL +L   K +  ENP DFM++I ++GKTNFFEKRV EY    V
Sbjct:   30 EPLLRENKRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWEKLKPGERHFISHVLAFFAASDGIVNENLVQRFSQEVQLPEARSFYGFQILIESVHSEMYSMLINTYIRDLKERDYLFNAIETMPCVKRKADWALQWISDRNSTFGERLIAFAAVEGIFFSGSFAAIYWLKKRGLMPGLTYSNELISRDEGLHCNFACLMYSYLVKKPSADRVRDIITKAVSIEQEFLTEALPVDLIGINCSLMKQYIEFVADRLLTDLAMPKVYKAENPFDFMESISLEGKTNFFEKRVAEYQRFGV 334          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Sea Lamprey
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 412.535 bits (1059), Expect = 9.821e-145
Identity = 212/313 (67.73%), Postives = 251/313 (80.19%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDK--HKF 1028
            E LL ++  R     I+Y DIW+M+ KA +SFWT  EV+LSKD  HW+++  +E++FI+HVLAFFAASDGIVNENLVERF QEV+I EA  FY FQIA+ENIHSEMYSLLID+Y+ D   +  LFNAIET+PCV+KKA WALRWISD  +TFG RV+AFAAVEGIFFSGSFASIFWLKKRGLMPGL FSNELISRDEGLHCDFACLMF++L  KP   +V  ++ +AV IE+EFLTDALPV+LIGMN + M +YIEFVADRLL ELGC K +  ENP DFM+NI ++GKTNFFEK+V EY    V  K  H+F
Sbjct:   19 EPLLRDNPRRFVIFPIEYPDIWQMYKKAEASFWTAEEVDLSKDQQHWERLKPEEQHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPTQREFLFNAIETLPCVKKKADWALRWISDSNATFGERVLAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFRHLVHKPEEARVQQIVMDAVIIEQEFLTDALPVNLIGMNCDLMKQYIEFVADRLLGELGCAKVYRAENPFDFMENISLEGKTNFFEKKVAEYQKMGVMSKVDHQF 331          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Match: RNR2 (Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits; RNR2 has a paralog, RNR4, that arose from the whole genome duplication [Source:SGD;Acc:S000003563])

HSP 1 Score: 376.326 bits (965), Expect = 1.013e-129
Identity = 190/309 (61.49%), Postives = 237/309 (76.70%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWK-KMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDK 1019
            E LL EDK R     I+Y +IW+ + +A +SFWT  E++LSKD   W  +MN++ER+FI+ VLAFFAASDGIVNENLVE F  EV+IPEA++FY FQI IENIHSE YSLLID+Y+ D +    LFNAI T+P + +KA+WALRWI D  + FG R+VAFA++EG+FFSGSFASIFWLKKRG+MPGL FSNELI RDEGLH DFACL+F +L +KP P  V  ++ EAV IE+ +  DALPV+L+GMNA+ M +Y+EFVADRLLV  G  K++  ENP DFM+NI + GKTNFFEKRV +Y  + V  K
Sbjct:   76 EPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENISLAGKTNFFEKRVSDYQKAGVMSK 384          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Match: RNR4 (Ribonucleotide-diphosphate reductase (RNR) small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits; relocalizes from nucleus to cytoplasm upon DNA replication stress; RNR4 has a paralog, RNR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003412])

HSP 1 Score: 265.388 bits (677), Expect = 5.425e-87
Identity = 136/305 (44.59%), Postives = 207/305 (67.87%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKN-KLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSS 1007
            EILL E+  R     I+Y +IW  + K  +SFWT  E+ L+KD   ++K+ DD++ +I ++LA   +SD +VN+ L+E F  +++ PE ++FY FQI +ENI+SE+YS+++D++  D   KN  LF  I  +P V+ KA +  RWIS+  S +  R+VAFAA EGIF +G++AS+FWL  + +MPGL  +N  I RD G + DF+CL+F +L +KP+P+ +  +I EAV IEKE+ +++LPV   GM+ +S+  YIEFVAD LL   G +K++N  NP +FM+++   GKT FFEK+V +Y  +S
Sbjct:   25 EILLMENSRRFVMFPIKYHEIWAAYKKVEASFWTAEEIELAKDTEDFQKLTDDQKTYIGNLLALSISSDNLVNKYLIENFSAQLQNPEGKSFYGFQIMMENIYSEVYSMMVDAFFKDP--KNIPLFKEIANLPEVKHKAAFIERWISNDDSLYAERLVAFAAKEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDRGAYTDFSCLLFAHLRTKPNPKIIEKIITEAVEIEKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGFGNEKYYNAVNPFEFMEDVATAGKTTFFEKKVSDYQKAS 327          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Match: YJL026C-A_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; completely overlaps the verified gene YJL026W/RNR2 [Source:SGD;Acc:S000028660])

HSP 1 Score: 61.2326 bits (147), Expect = 1.032e-12
Identity = 34/66 (51.52%), Postives = 40/66 (60.61%), Query Frame = -2
Query:  551 SGDGLLLKYLNIKQAKSQ*SPSSRLINSLLKHNPGINPRFLSQNIDAKLPLKNIPSTAANATTLVP 748
            +G GL  K+ N K AKS   PSS  INSL K  PGI P F +Q ++AK P K  PS  A AT+L P
Sbjct:    2 AGSGLFFKWANNKHAKSVCKPSSLQINSLEKVKPGIIPLFFNQKMEAKEPEKKTPSMEAKATSLSP 67          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO42117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C2])

HSP 1 Score: 420.624 bits (1080), Expect = 1.289e-147
Identity = 219/314 (69.75%), Postives = 251/314 (79.94%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV---EDKHKF 1028
            E LL E+  R   L IQY +IW+M+ KA +SFWT  EV+LSKD   + K+NDDER F++HVLAFFAASDGIVNENLVE F QEV+IPEA  FY FQIAIENIHSEMYSLLI+S + D   K  LFNAIETMPCV KKA WAL WI+ ++++FG R++AFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLM+KYL +KP  E V  +IK+AV IE+EFLT ALPV LIGMN   M +YIEFVADRLLV L C K +N ENP DFM+NI ++GKTNFFEKRVGEY  S V   +D HKF
Sbjct:   22 EPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDDERMFVSHVLAFFAASDGIVNENLVECFSQEVQIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRASFGERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYNVENPFDFMENISLEGKTNFFEKRVGEYQKSGVMSEKDSHKF 335          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO42087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C1])

HSP 1 Score: 420.239 bits (1079), Expect = 7.368e-147
Identity = 218/314 (69.43%), Postives = 251/314 (79.94%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV---EDKHKF 1028
            E LL E+  R   L IQY +IW+M+ KA +SFWT  EV+LSKD   + K+NDDER F++HVLAFFAASDGIVNENLVE F QEV+IPEA  FY FQIAIENIHSEMYSLLI+S + D   K  LFNAIETMPCV KKA WAL WI+ ++++FG R++AFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLM+KYL +KP  E V  +IK+AV IE+EFLT ALPV LIGMN   M +YIEFVADRLLV L C K +N ENP DFM+NI ++GKTNF+EKRVGEY  S V   +D HKF
Sbjct:   65 EPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDDERMFVSHVLAFFAASDGIVNENLVECFCQEVQIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRASFGERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYNVENPFDFMENISLEGKTNFYEKRVGEYQKSGVMSEKDSHKF 378          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO42116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C0])

HSP 1 Score: 419.083 bits (1076), Expect = 2.195e-146
Identity = 218/314 (69.43%), Postives = 250/314 (79.62%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV---EDKHKF 1028
            E LL E+  R   L IQY +IW+M+ KA +SFWT  EV+LSKD   + K+ND ER F++HVLAFFAASDGIVNENLVE F QEV+IPEA  FY FQIAIENIHSEMYSLLI+S + D   K  LFNAIETMPCV KKA WAL WI+ ++++FG R++AFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLM+KYL +KP  E V  +IK+AV IE+EFLT ALPV LIGMN   M +YIEFVADRLLV L C K +N ENP DFM+NI ++GKTNFFEKRVGEY  S V   +D HKF
Sbjct:   65 EPLLRENPHRFVILPIQYTEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDHERMFVSHVLAFFAASDGIVNENLVECFCQEVQIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRASFGERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYNAENPFDFMENISLEGKTNFFEKRVGEYQKSGVMSDKDSHKF 378          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Match: EDO28315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T9])

HSP 1 Score: 244.588 bits (623), Expect = 3.863e-80
Identity = 129/222 (58.11%), Postives = 166/222 (74.77%), Query Frame = 3
Query:   90 IMEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWK-KMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQ 752
            ++E +L E+K R     I++ DIWE + K  +SFWT  E++L +D   W  K+N+DE+YFI H+LAFFAASDGIVNENL E F+ EV+  EA+ FY FQI +ENIHSE YSLLID+YV D   K+KLF+AIE  P +++KA+WAL+WI  +  +F  R++AFAAVEGIFFSG+F SIFWLKKRGLMPGL FSNELISRDEG+HCDFA  +  +      P++
Sbjct:    3 VVEPILQENKDRFVIFPIKHHDIWEWYKKMEASFWTAEEIDLHQDITDWNTKLNEDEKYFIKHILAFFAASDGIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKDEVEKDKLFHAIEVFPAIKRKAEWALKWI--ESDSFAERLIAFAAVEGIFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGVHCDFAVHIHNHHLINKVPKE 222          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: RRM2 (ribonucleoside-diphosphate reductase subunit M2-like [Source:NCBI gene;Acc:101166844])

HSP 1 Score: 425.246 bits (1092), Expect = 1.858e-148
Identity = 212/305 (69.51%), Postives = 249/305 (81.64%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     +QY DIW+M+ KA +SFWT  EV+LSKD  HW+ + DDER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV++KA WAL WI +K + +G RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V ++I+ AV IE+EFLT+ALPV LIGMN E M +YIEFVADRLL+ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   60 EPLLKENPRRFVIFPVQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNWIGNKHAAYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPFDFMENISLEGKTNFFEKRVGEYQRMGV 364          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: ENSORLT00000025443.2 (ribonucleoside-diphosphate reductase subunit M2 [Source:NCBI gene;Acc:101158912])

HSP 1 Score: 402.905 bits (1034), Expect = 6.273e-141
Identity = 202/282 (71.63%), Postives = 236/282 (83.69%), Query Frame = 3
Query:  165 MFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            M+ KA +SFWT  EV+LSKD  HW+ + DDER+FI+HVLAFFAASDGIVNENLVERF QEV++ EA  FY FQIA+ENIHSEMYSLLID+Y+ D + +  LFNAIET+PCV++KA WAL WI +K + +G RVVAFAAVEGIFFSGSFA+IFWLKKRGLMPGL FSNELISRDEGLHCDFACLMFK+L +KPS E V ++I+ AV IE+EFLT+ALPV LIGMN E M +YIEFVADRLL+ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:    1 MYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNWIGNKHAAYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPFDFMENISLEGKTNFFEKRVGEYQRMGV 282          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B [Source:NCBI gene;Acc:101164326])

HSP 1 Score: 380.948 bits (977), Expect = 2.106e-131
Identity = 199/305 (65.25%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ +A++SFWTV EV+LSKD  HW ++  DE++FI++VLAFFAASDGIVNENLV+RF  EV++PEA +FYSFQI IE +HSEMYSLLI++Y+ D + ++ LFNAI+TMPCV++KA WAL WI+D KSTFG R+VAFAAVEGIFFSGSFA+I+WLKKRGL+PGL +SNELISRDEGLHC+FACL++ YL  KPS ++V  +I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLL +L  DK +  ENP DFM++I ++GKTNFFEKRV EY    V
Sbjct:   33 EPLLRENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAASDGIVNENLVQRFSLEVQVPEARSFYSFQILIETVHSEMYSLLINTYIRDLKERDYLFNAIQTMPCVKRKADWALEWINDNKSTFGERLVAFAAVEGIFFSGSFAAIYWLKKRGLLPGLTYSNELISRDEGLHCNFACLLYSYLVKKPSEDRVRGIITKAVCIEQEFLTEALPVDLIGMNCCLMKQYIEFVADRLLADLDLDKVYKVENPFDFMESISLEGKTNFFEKRVAEYQRFGV 337          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B [Source:NCBI gene;Acc:101164326])

HSP 1 Score: 380.178 bits (975), Expect = 4.946e-131
Identity = 199/305 (65.25%), Postives = 248/305 (81.31%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            E LL E+  R     IQY DIW+M+ +A++SFWTV EV+LSKD  HW ++  DE++FI++VLAFFAASDGIVNENLV+RF  EV++PEA +FYSFQI IE +HSEMYSLLI++Y+ D + ++ LFNAI+TMPCV++KA WAL WI+D KSTFG R+VAFAAVEGIFFSGSFA+I+WLKKRGL+PGL +SNELISRDEGLHC+FACL++ YL  KPS ++V  +I +AV IE+EFLT+ALPV LIGMN   M +YIEFVADRLL +L  DK +  ENP DFM++I ++GKTNFFEKRV EY    V
Sbjct:   35 EPLLRENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAASDGIVNENLVQRFSLEVQVPEARSFYSFQILIETVHSEMYSLLINTYIRDLKERDYLFNAIQTMPCVKRKADWALEWINDNKSTFGERLVAFAAVEGIFFSGSFAAIYWLKKRGLLPGLTYSNELISRDEGLHCNFACLLYSYLVKKPSEDRVRGIITKAVCIEQEFLTEALPVDLIGMNCCLMKQYIEFVADRLLADLDLDKVYKVENPFDFMESISLEGKTNFFEKRVAEYQRFGV 339          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Match: ENSORLT00000040809.1 (ribonucleoside-diphosphate reductase subunit M2 [Source:NCBI gene;Acc:101158912])

HSP 1 Score: 157.532 bits (397), Expect = 5.440e-47
Identity = 74/108 (68.52%), Postives = 87/108 (80.56%), Query Frame = 3
Query:  687 GLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSV 1010
            GLHCDFACLMFK+L +KPS E V ++I+ AV IE+EFLT+ALPV LIGMN E M +YIEFVADRLL+ELG  K +  ENP DFM+NI ++GKTNFFEKRVGEY    V
Sbjct:   17 GLHCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPFDFMENISLEGKTNFFEKRVGEYQRMGV 124          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000079368.1 (SMESG000079368.1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 1040
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 316          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000044188.1 (SMESG000044188.1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 3
Query:   93 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 1040
            MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN
Sbjct:    1 MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 316          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000044184.1 (SMESG000044184.1)

HSP 1 Score: 258.455 bits (659), Expect = 4.442e-86
Identity = 124/127 (97.64%), Postives = 125/127 (98.43%), Query Frame = 3
Query:  660 SNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 1040
            +NELISRDEGLHCDFACLMFKYLSSKPS EQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKR GEYSMSSVEDKHKFDDVN
Sbjct:   34 NNELISRDEGLHCDFACLMFKYLSSKPSSEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRCGEYSMSSVEDKHKFDDVN 160          

HSP 2 Score: 55.0694 bits (131), Expect = 6.757e-9
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 3
Query:  243 MNDDERYFITHVLAFFAASDGIVNE 317
            MNDDERYFITHVLAFFAASDGIVNE
Sbjct:    1 MNDDERYFITHVLAFFAASDGIVNE 25          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000044184.1 (SMESG000044184.1)

HSP 1 Score: 259.61 bits (662), Expect = 4.152e-85
Identity = 124/126 (98.41%), Postives = 124/126 (98.41%), Query Frame = 3
Query:  663 NELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGEYSMSSVEDKHKFDDVN 1040
            NELISRDEGLHCDFACLMFKYLSSKPS EQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKR GEYSMSSVEDKHKFDDVN
Sbjct:  137 NELISRDEGLHCDFACLMFKYLSSKPSSEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRCGEYSMSSVEDKHKFDDVN 262          
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Match: SMESG000014842.1 (SMESG000014842.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.584e-17
Identity = 65/278 (23.38%), Postives = 127/278 (45.68%), Query Frame = 3
Query:   96 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLF-NAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEXXXXXXXXXXXXWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENP 926
            E LL  ++ R     IQY DI+  +    S F+   +     +      +   ER  I  +L +++  +    ++L+ +   +++IPEA  F+ FQI  +  H E++S+L+ S       K+ L  N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++  +KP+  +   +IK+ V  E EFL + +  S+   N   + E+++F AD++       + +  ENP
Sbjct:   24 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGEREIIERILLYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS----VNYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENP 280          
The following BLAST results are available for this feature:
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRM2B3.621e-14870.16ribonucleotide reductase regulatory TP53 inducible... [more]
RRM22.114e-14770.82ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM22.114e-14770.82ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM2B1.806e-14670.16ribonucleotide reductase regulatory TP53 inducible... [more]
RRM22.392e-14670.82ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnr-23.682e-13262.86Ribonucleoside-diphosphate reductase small chain ... [more]
F19G12.23.648e-6256.80pep chromosome:WBcel235:X:1427774:1430871:1 gene:W... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RnrS3.657e-14667.97gene:FBgn0011704 transcript:FBtr0088046[more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrm22.353e-14971.48ribonucleotide reductase M2 polypeptide [Source:NC... [more]
rrm22.353e-14971.48ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm22.386e-14971.48ribonucleotide reductase M2 polypeptide [Source:NC... [more]
rrm22.386e-14971.48ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm23.129e-14971.48ribonucleotide reductase M2 polypeptide [Source:NC... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col6a66.335e-14869.35collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
col6a67.558e-14869.35collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
col6a61.032e-14769.35collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
rrm2b1.788e-14769.13ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
col6a61.789e-14769.35collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rrm21.952e-14769.84ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm2b3.775e-14769.84ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm2b1.299e-13472.96ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm21.659e-9757.34ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm22.029e-8371.51ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P79733|RIR2_DANRE2.362e-14871.48Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|Q7LG56|RIR2B_HUMAN1.739e-14770.16Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q5R9G0|RIR2B_PONAB2.577e-14770.16Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q4R741|RIR2B_MACFA2.812e-14770.49Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q60561|RIR2_MESAU6.114e-14770.16Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203110530.000e+0100.00tr|I1ZI90|I1ZI90_SCHMD Ribonucleoside diphosphate ... [more]
gnl|BL_ORD_ID|214650254.716e-14972.55tr|A0A1W4XEU3|A0A1W4XEU3_AGRPL ribonucleoside-diph... [more]
gnl|BL_ORD_ID|196880272.820e-14769.28tr|W4Z9V7|W4Z9V7_STRPU Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|182531578.495e-14769.61tr|A0A267H4E0|A0A267H4E0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183140351.485e-14669.84tr|A0A267GMY6|A0A267GMY6_9PLAT Uncharacterized pro... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rrm23.940e-14668.85ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm23.940e-14668.85ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm2b1.562e-14366.23ribonucleoside-diphosphate reductase subunit M2 B-... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrm29.821e-14567.73ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RNR21.013e-12961.49Ribonucleotide-diphosphate reductase (RNR), small ... [more]
RNR45.425e-8744.59Ribonucleotide-diphosphate reductase (RNR) small s... [more]
YJL026C-A_mRNA1.032e-1251.52Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO421171.289e-14769.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420877.368e-14769.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421162.195e-14669.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283153.863e-8058.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRM21.858e-14869.51ribonucleoside-diphosphate reductase subunit M2-li... [more]
ENSORLT00000025443.26.273e-14171.63ribonucleoside-diphosphate reductase subunit M2 [S... [more]
rrm2b2.106e-13165.25ribonucleoside-diphosphate reductase subunit M2 B ... [more]
rrm2b4.946e-13165.25ribonucleoside-diphosphate reductase subunit M2 B ... [more]
ENSORLT00000040809.15.440e-4768.52ribonucleoside-diphosphate reductase subunit M2 [S... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079368.10.000e+0100.00SMESG000079368.1[more]
SMESG000044188.10.000e+0100.00SMESG000044188.1[more]
SMESG000044184.14.442e-8697.64SMESG000044184.1[more]
SMESG000044184.14.152e-8598.41SMESG000044184.1[more]
SMESG000014842.11.584e-1723.38SMESG000014842.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010115
GenBankAFJ24744.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010115 ID=SMED30010115|Name=ribonucleoside diphosphate reductase subunit M2-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1127bp
GTTTTTAATGAACTGAATCAGGTTTAATGCAAAATAGTCATTTTAATTTC
TAGATAAATTAACAGTAATTCTTTCGAGATTAGATATTTATTATGGAGAT
TTTATTAACAGAAGATAAAAGTCGAATAGGATTTCTTAATATACAATATG
AAGATATATGGGAAATGTTTAATAAAGCTCGATCTTCATTTTGGACTGTA
AATGAAGTTAATTTATCAAAAGATTTTGCTCACTGGAAAAAAATGAATGA
CGATGAACGGTATTTCATTACTCACGTTCTTGCATTTTTTGCTGCCAGTG
ATGGAATTGTCAATGAAAATCTCGTCGAAAGATTCATTCAAGAAGTGAAA
ATTCCCGAAGCTGAGGCATTTTACAGTTTTCAAATTGCAATTGAAAACAT
TCATTCAGAAATGTATTCTCTATTAATCGATTCTTATGTTACTGATACAG
AAACAAAGAATAAATTATTTAATGCCATCGAAACTATGCCATGCGTTCAG
AAAAAAGCTCAATGGGCATTGCGTTGGATTAGCGATAAAAAATCCACTTT
TGGAACTAGAGTTGTTGCATTTGCTGCTGTCGAGGGAATATTTTTCAGTG
GTAGTTTTGCATCGATATTTTGGCTTAAAAAGCGTGGATTAATGCCCGGA
TTATGTTTCAGCAACGAATTAATTAGCCGAGATGAAGGACTTCATTGCGA
TTTTGCTTGTTTGATGTTTAAATATTTAAGTAGCAAACCGTCACCTGAAC
AAGTTTTGGATTTGATCAAAGAAGCTGTCGGAATCGAGAAGGAATTTCTC
ACCGACGCATTGCCGGTTTCATTGATTGGCATGAACGCTGAATCGATGTG
TGAGTATATTGAATTTGTGGCCGACCGGCTGCTGGTTGAATTGGGCTGTG
ACAAGTTCTGGAACACAGAGAACCCGTTGGATTTCATGGATAATATTTGC
ATCGATGGGAAAACTAACTTCTTTGAGAAACGAGTCGGTGAATATTCCAT
GTCGAGCGTTGAGGACAAACACAAATTTGATGATGTCAATTTCGATATTG
ATTTTTGAGGGATTCCGTTTTTTGGCGCCAGTGTGCATTTAATGTGTTTT
GGTTGTAATTGGCTATTTTTGTTTGTT
back to top

protein sequence of SMED30010115-orf-1

>SMED30010115-orf-1 ID=SMED30010115-orf-1|Name=SMED30010115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MEILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKK
MNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAI
ENIHSEMYSLLIDSYVTDTETKNKLFNAIETMPCVQKKAQWALRWISDKK
STFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGL
HCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAE
SMCEYIEFVADRLLVELGCDKFWNTENPLDFMDNICIDGKTNFFEKRVGE
YSMSSVEDKHKFDDVNFDIDF*
back to top
Aliases
The feature 'ribonucleoside diphosphate reductase subunit M2-2' has the following synonyms
Synonym
RRM2-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0004517blastomere
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR033909RNR_small
IPR020153Vaccinia_virus_F-OrfBB
IPR000358RNR_small_fam
IPR012348RNR-like
IPR030475RNR_small_AS
IPR009078Ferritin-like_SF
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0009186deoxyribonucleoside diphosphate metabolic process
GO:0009263deoxyribonucleotide biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000008Stage 8
PLANA:0000003Stage 3
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000358Ribonucleotide reductase small subunit familyPFAMPF00268Ribonuc_red_smcoord: 13..278
e-value: 1.9E-114
score: 381.9
IPR000358Ribonucleotide reductase small subunit familyPANTHERPTHR23409RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAINcoord: 2..321
IPR012348Ribonucleotide reductase-likeGENE3DG3DSA:1.10.620.20coord: 1..303
e-value: 6.2E-133
score: 444.7
NoneNo IPR availablePANTHERPTHR23409:SF19RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2 Bcoord: 2..321
NoneNo IPR availableTMHMMTMhelixcoord: 156..178
IPR030475Ribonucleotide reductase small subunit, acitve sitePROSITEPS00368RIBORED_SMALLcoord: 100..116
IPR033909Ribonucleotide reductase small subunitCDDcd01049RNRR2coord: 16..286
e-value: 1.24082E-125
score: 359.246
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 2..303