TPA_inf: prohormone convertase 2

Overview
NameTPA_inf: prohormone convertase 2 (DAA33932.1)
Smed IDSMED30010096
Uniprot Best hitNeuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1 (E=0)
Length (bp)2542
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPA_inf: prohormone convertase 2 (SMED30010096) t-SNE clustered cells

Violin plots show distribution of expression levels for TPA_inf: prohormone convertase 2 (SMED30010096) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TPA_inf: prohormone convertase 2 (SMED30010096) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TPA_inf: prohormone convertase 2 (SMED30010096) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

TPA_inf: prohormone convertase 2 is expressed during Stage 4 in the embryonic digestive system and temporary embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK2 (proprotein convertase subtilisin/kexin type 2 [Source:HGNC Symbol;Acc:HGNC:8744])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 362/603 (60.03%), Postives = 431/603 (71.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   10 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 580          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK2 (proprotein convertase subtilisin/kexin type 2 [Source:HGNC Symbol;Acc:HGNC:8744])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 362/603 (60.03%), Postives = 431/603 (71.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK2 (proprotein convertase subtilisin/kexin type 2 [Source:HGNC Symbol;Acc:HGNC:8744])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 357/603 (59.20%), Postives = 422/603 (69.98%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V +                                    VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELH-KGGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 564          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK1 (proprotein convertase subtilisin/kexin type 1 [Source:HGNC Symbol;Acc:HGNC:8743])

HSP 1 Score: 424.476 bits (1090), Expect = 1.180e-134
Identity = 256/629 (40.70%), Postives = 368/629 (58.51%), Query Frame = 1
Query:  421 MKITWILLFLCEYVVCG-----KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYR-FNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            ++ T  +LF C +         +   N+W   +  P   E+A+ +A+E G+ +L    +  N ++F HK  P  S   ++   K L     V  A+Q     R KR                       L +S      L L  DP+++++WY+++T     +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+ + +N  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++  ++DIYSASWGP DDG+TV+GP     +A   GV +GR+GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+++S+G      D  + + DL+  CT  H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  + W +VPE+  C+    D   R       +I+EI T AC+    + +  LEHVQ   +++ SRRGD+ + LTS  GT++++L+ R + D S  GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT S+P
Sbjct:    8 LQCTAFVLF-CAWCALNSAKAKRQFVNEWAAEI--PGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRS---------------------ALRDSA-----LNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQ-ENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 598          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK1 (proprotein convertase subtilisin/kexin type 1 [Source:HGNC Symbol;Acc:HGNC:8743])

HSP 1 Score: 414.461 bits (1064), Expect = 1.720e-131
Identity = 227/490 (46.33%), Postives = 319/490 (65.10%), Query Frame = 1
Query:  823 LKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYR-FNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            L L  DP+++++WY+++T     +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+ + +N  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++  ++DIYSASWGP DDG+TV+GP     +A   GV +GR+GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+++S+G      D  + + DL+  CT  H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  + W +VPE+  C+    D   R       +I+EI T AC+    + +  LEHVQ   +++ SRRGD+ + LTS  GT++++L+ R + D S  GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT S+P
Sbjct:   71 LNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQ-ENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 551          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Prohormone convertase 2; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5ECN9])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 366/663 (55.20%), Postives = 444/663 (66.97%), Query Frame = 1
Query:  427 ITWILLFLCEYVVCGKIV---TNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            +  I +FL  ++  G+ V   TN +HVHL +    E A+++A+  GF        S NE+ F    + H  +  S   H  L     V + +Q++G+ R KRGY+P++++                 ES      +  P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F      + G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    6 VDLICVFLSIFIGIGEAVDVYTNHFHVHLKEGGGLEDAHRIAKRHGFINRGQVAASDNEYHFVQPALVHARTRRSAGHHAKLHNDDEVLHVEQLKGYTRTKRGYRPLEQRL----------------ESQFDFSAVMSPSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGS-QFEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARFQGPGAHA-GTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 648          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Prohormone convertase 2; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5ECN9])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 332/526 (63.12%), Postives = 386/526 (73.38%), Query Frame = 1
Query:  832 PTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F  + P +  G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    3 PSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGSQ-FEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARF--QGPGAHAGTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 523          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Prohormone convertase 2; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5ECN9])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 332/526 (63.12%), Postives = 386/526 (73.38%), Query Frame = 1
Query:  832 PTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F  + P +  G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    3 PSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGSQ-FEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARF--QGPGAHAGTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 523          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Prohormone convertase 2; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5ECN9])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 297/474 (62.66%), Postives = 342/474 (72.15%), Query Frame = 1
Query:  988 LHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            LH D   + NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F  + P +  G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:   87 LHND---DENAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGS-QFEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARF--QGPGAHAGTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 552          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:RefSeq peptide;Acc:NP_492974])

HSP 1 Score: 410.994 bits (1055), Expect = 1.036e-130
Identity = 256/603 (42.45%), Postives = 353/603 (58.54%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHL-VKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI-RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIG-HRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            +  TN+W V +     +E AN++A + G++ L   +     ++F        SS  + S     L H   V   +Q     R KRGY+ I++        I ++   G   S +       P DPL++  WY+ R    +D    +D NV  AW  G TGKGV   I+DDG++  HPD+S NY+  +SYD +  D  P PRY     N HGTRCAGE++A  +N +C VG+AY++ I G+RMLD   +TD +EAA++ ++ D IDIYSASWGP DDGRTVDGP   T  A  +G+  GRKGKGSI+VWAS   G  AD CNCDGY  S++T+SI+SAT +G    Y E+CSSTLA+T+S+G     +   + T DL+  CT  H+GTSA+AP AAG+ ALALEAN N+ WRD+QH+ + T+K        R  +WT NG G   +H FGYG++DAG MV++AK W  V E+  C      +         L L++ +D C      ++V+Y+EHVQA V++K+ +RGD+ ++LTSP GT S +L+ R + D S  GFT W FMTTH WGE   G W L +  D  D        +W LVL+GT
Sbjct:   56 RTYTNEWAVRIAGGKVEE-ANRLANKYGYTNLGPIIPGDEYYLFRDDRKKSRSSRKTRSLSANQLQHEEDVMWMEQQVAKRRVKRGYRRIRRH--TDDNDIFEEDDDGTQISKSRNRKHPDPNDPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDNDPMPRYEFSDENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGD-VTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSGATGEKM---ILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAK----PINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCRQFYPSRYKNIPNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRAR-DTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDGWDDAE---LVKWELVLYGT 643          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: amon (amontillado [Source:FlyBase gene name;Acc:FBgn0023179])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 381/631 (60.38%), Postives = 451/631 (71.47%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSP-NEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTIN-KKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRF 2361
            + T+ + V          A+ VA + GF  L   + +  +E+ F H+T+PH  S  S +  + L +H  V  A Q  GF R KRG +P        +P I+  K    +GE + I  +   PTDP F  +WY++NTGQ  G   LDLNV +AWAQGITGK VTTAIMDDG+DY+HPDL  NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNGICGVGVAYDSKIAG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV+GVN+GR G G+IYVWASGDGG  DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG      + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSKRN L D   R +WT+NG GLEFNHLFG+GVLDAG MV ++K+W +VP R+HC AG++ +     + ++L  EI TDACK      VNYLEHVQA +S  +SRRGD+ +FLTSPMGT SMILS R  DDD   GFTKWPFMTTH+WGE P+G WKL   F++      G   EW LVLHGT+  PY  L  S      KL +VK+ H   + 
Sbjct:   39 VFTSSFLVRFRRGVDNSFAHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA-------VPAIHGMKFDLKVGEGNRIDEE---PTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKG-TDTEVNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQ-TRHGNLLEWSLVLHGTKEAPYRTLHPSSPH--SKLAIVKKAHEDKKM 653          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598])

HSP 1 Score: 426.402 bits (1095), Expect = 9.436e-129
Identity = 266/630 (42.22%), Postives = 381/630 (60.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG--YKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR   Y+ +     + L + +++      E  ++      P DPLF ++WY+ N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYKSISLASHSQRM-----EYRDVSSHFIFP-DPLFKEQWYL-NGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 843          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598])

HSP 1 Score: 420.624 bits (1080), Expect = 1.193e-126
Identity = 269/651 (41.32%), Postives = 383/651 (58.83%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG-----------YKPIKKQGRV---PLP-------TINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR            Y  +++ G     P P       +I+        E  ++      P DPLF ++WY+  +N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598])

HSP 1 Score: 420.624 bits (1080), Expect = 1.193e-126
Identity = 269/651 (41.32%), Postives = 383/651 (58.83%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG-----------YKPIKKQGRV---PLP-------TINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR            Y  +++ G     P P       +I+        E  ++      P DPLF ++WY+  +N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598])

HSP 1 Score: 420.624 bits (1080), Expect = 1.193e-126
Identity = 269/651 (41.32%), Postives = 383/651 (58.83%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG-----------YKPIKKQGRV---PLP-------TINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR            Y  +++ G     P P       +I+        E  ++      P DPLF ++WY+  +N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 366/606 (60.40%), Postives = 438/606 (72.28%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHK--TVPHVSSVPSW-SQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
             +T  + V + + A  E A K+A E GF   R  +    E +FH     +P      S   QH  L + H VKN    EGF R+KRGY+ +                       N  V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW+ G TGKGVT AIMDDGIDYLHPDL+ NYNAE+S+DFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A+ W  VPERFHC+AG +   ++      L+L I TDAC+    + V YLEHVQA ++V +SRRGD+ + +TSPMGT S++LS RP+DDD+  GF KWPFMTTHTWGE+PRG W L V F ++  +  G+  EW L+LHGTQS PY
Sbjct:   33 FITGHFLVQMRE-AAPEDAQKLALEHGFESARKAILPFGEDLFHFYPLEMPKTRRKRSLHQQHHRLASDHRVKNVFPQEGFGRQKRGYRDLP----------------------NTDVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWSLGFTGKGVTIAIMDDGIDYLHPDLASNYNAEASFDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAVSNNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDLQHLTVLTSK--RNKLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKLARDWKTVPERFHCVAGSMQDIHKIQSGNKLLLSISTDACQGK-DNFVRYLEHVQAVITVNASRRGDLNINMTSPMGTKSILLSRRPRDDDAKVGFDKWPFMTTHTWGEDPRGPWLLEVGFQSQSDMQSGLLKEWTLMLHGTQSAPY 608          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 365/604 (60.43%), Postives = 437/604 (72.35%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSW-SQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
             +T  + V + + A  E A K+A E GF   R      + F F+   +P      S   QH  L + H VKN    EGF R+KRGY+ +                       N  V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW+ G TGKGVT AIMDDGIDYLHPDL+ NYNAE+S+DFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A+ W  VPERFHC+AG +   ++      L+L I TDAC+    + V YLEHVQA ++V +SRRGD+ + +TSPMGT S++LS RP+DDD+  GF KWPFMTTHTWGE+PRG W L V F ++  +  G+  EW L+LHGTQS PY
Sbjct:   90 FITGHFLVQMRE-AAPEDAQKLALEHGFESARKLPFGEDLFHFYPLEMPKTRRKRSLHQQHHRLASDHRVKNVFPQEGFGRQKRGYRDLP----------------------NTDVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWSLGFTGKGVTIAIMDDGIDYLHPDLASNYNAEASFDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAVSNNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDLQHLTVLTSK--RNKLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKLARDWKTVPERFHCVAGSMQDIHKIQSGNKLLLSISTDACQGK-DNFVRYLEHVQAVITVNASRRGDLNINMTSPMGTKSILLSRRPRDDDAKVGFDKWPFMTTHTWGEDPRGPWLLEVGFQSQSDMQSGLLKEWTLMLHGTQSAPY 663          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:ZFIN;Acc:ZDB-GENE-071009-1])

HSP 1 Score: 436.032 bits (1120), Expect = 2.929e-139
Identity = 261/628 (41.56%), Postives = 378/628 (60.19%), Query Frame = 1
Query:  421 MKITWILLFLCEYV--VCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            M +  +L  +C  V     +   N+W V +  P   ++A  +A E G+ ++R      N ++F         S PS ++     A H+ K   + +     ++ Y+  ++  R PL      G+    E  +  VD KL  DP+++++WY+++T  +  +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+  +SYDF+ NDP PFPRY     N HGTRCAGEI+ + DN  CGVGVAY+SK+ G+RMLD   +TD IEA+++ Y+ D++DIYSASWGP DDG+TV+GP     +A   G+ KGR GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+ +S+G      D  + + DL+ +CT  H+GTSA+AP AAG+FALALE N ++ WRD+QHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  K W +VPE+  CI    D+ ++    KA   + +EI T AC     + V  LEHVQ  VS++ +RRGD+ + LTSP GTT+++L+ R + D S+ GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT  +P
Sbjct:    8 MLLCSVLALVCALVSSAVDRQYLNEWAVEI--PGGVQNARSIADEFGYQLVRQIGALENHYLFKRH------SHPSRTKRS---ADHITKRLSEDDRVSWAEQQYEK-RRAKRAPL------GV----ECKDCSVD-KLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDIYPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY---TDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSE---FDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVR--DETFQPRPLKAAGEISIEIPTKACAGQ-ANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLAERER-DTSSNGFRNWAFMSVHTWGENPTGTWILKITDTSGRMENEGQIISWKLILHGTSEKP 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:ZFIN;Acc:ZDB-GENE-071009-1])

HSP 1 Score: 435.647 bits (1119), Expect = 3.311e-139
Identity = 261/628 (41.56%), Postives = 378/628 (60.19%), Query Frame = 1
Query:  421 MKITWILLFLCEYV--VCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            M +  +L  +C  V     +   N+W V +  P   ++A  +A E G+ ++R      N ++F         S PS ++     A H+ K   + +     ++ Y+  ++  R PL      G+    E  +  VD KL  DP+++++WY+++T  +  +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+  +SYDF+ NDP PFPRY     N HGTRCAGEI+ + DN  CGVGVAY+SK+ G+RMLD   +TD IEA+++ Y+ D++DIYSASWGP DDG+TV+GP     +A   G+ KGR GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+ +S+G      D  + + DL+ +CT  H+GTSA+AP AAG+FALALE N ++ WRD+QHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  K W +VPE+  CI    D+ ++    KA   + +EI T AC     + V  LEHVQ  VS++ +RRGD+ + LTSP GTT+++L+ R + D S+ GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT  +P
Sbjct:    8 MLLCSVLALVCALVSSAVDRQYLNEWAVEI--PGGVQNARSIADEFGYQLVRQIGALENHYLFKRH------SHPSRTKRS---ADHITKRLSEDDRVSWAEQQYEK-RRAKRAPL------GV----ECKDCSVD-KLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDIYPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY---TDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSE---FDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVR--DETFQPRPLKAAGEISIEIPTKACAGQ-ANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLAERER-DTSSNGFRNWAFMSVHTWGENPTGTWILKITDTSGRMENEGQIISWKLILHGTSEKP 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: furina (furin (paired basic amino acid cleaving enzyme) a [Source:ZFIN;Acc:ZDB-GENE-040901-1])

HSP 1 Score: 424.476 bits (1090), Expect = 2.540e-134
Identity = 259/603 (42.95%), Postives = 361/603 (59.87%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFV-FHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQS 2274
            K+ TN W VH+     +E A+++A++  F    NH N   ++  F H+TV   S       H  L     V  A+Q     R+KR                            ++  +   PTDP F+++WY+ N         LDLNV +AW QG+TG+GV  +I+DDGI+  HPDL +NY+ ++SYD +  DP P PRYT    N HGTRCAGE++A  DN ICGVGVAY+++I G+RMLD   +TD++EA ++S +  +IDIYSASWGP DDG+TVDGP      A   GV +GR G+GSI+VWASG+GG     CNCDGY  S++T+SI+S+T +G    Y E+CSSTLAST+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS           ++W ING G   +H +GYG+LDAG +V +AK W NV  +  C+   + +    N+   L++    DAC + + + V+ LEHVQA +++  +RRG++ ++L SP GT S +L  RP  D S+ GF  W FMTTH+W E+PRG+W L +  +       G  +++ LVL+GT S
Sbjct:   28 KVYTNTWAVHIE--GGEEEADRIARKHSFV---NHGNVFGDYYHFRHRTVVKRSLSEHRGTHIRLHTEPQVMWAEQQVVKRRKKR----------------------------DVYYE---PTDPKFAQQWYLYNQDH------LDLNVKNAWKQGVTGQGVVVSILDDGIEKNHPDLVQNYDPDASYDVNDGDPDPQPRYTQLNDNRHGTRCAGEVAAVADNDICGVGVAYNARIGGVRMLDGE-VTDVVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKEAFQRGVIEGRGGRGSIFVWASGNGGRMKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLASTYSSGGV---NEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSN----PAHLTTNDWKINGVGRRVSHSYGYGLLDAGAIVALAKNWTNVGPQHKCVLSLVSEPR--NIGSYLVINKTVDAC-TGMANFVSSLEHVQAQLTLSYNRRGNLAIYLISPQGTRSTLLPPRPH-DYSSEGFNDWAFMTTHSWDEDPRGEWTLEIK-NVAGTSDYGTLTQFTLVLYGTAS 575          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:Xenbase;Acc:XB-GENE-960013])

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 337/555 (60.72%), Postives = 402/555 (72.43%), Query Frame = 1
Query:  640 SWSQHKVLLAHHLVKNAK-----QVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTD--DWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            S S+  V    HL  + K     Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NY+ + S +F S++ + +P+ TD   WF  HGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   19 SRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYSDDFSANFKSSEVHFYPKATDLQAWFFFHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 543          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:Xenbase;Acc:XB-GENE-960013])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 346/618 (55.99%), Postives = 423/618 (68.45%), Query Frame = 1
Query:  436 ILLFLCEYVVCG--KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            ++L L   +V     ++T+ + V L +    E A ++A E GFS  R    + + + F+        S  S ++ K L     +    Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NY+    Y +    P  +  +   +F SHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   14 LVLHLASVLVSAGRPVLTDHFLVDLREGGEAE-AKQLAAEYGFSGTRKLPFTQSLYHFYGNGKTTSRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYSFSLLYAYKPLQPIAYQSFLLFYF-SHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: furin (furin (paired basic amino acid cleaving enzyme) [Source:Xenbase;Acc:XB-GENE-999035])

HSP 1 Score: 410.609 bits (1054), Expect = 1.443e-129
Identity = 258/621 (41.55%), Postives = 365/621 (58.78%), Query Frame = 1
Query:  427 ITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIA--GLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNV-PERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSR 2277
            + W L  L + +   K+ TN W VH+   + +  A+++A++ GF  + + L   + + F H+ V   S  P  S+  +L     V   +Q     R+KR                            ++  D   PTDP F ++WY+ +T + D      L+V  AW QG TGKG+  +I+DDGI+  HPDL  NY+  +SYD +  DP P PRYT    N HGTRCAGE++A  +NGICGVG+AY++ I   G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV +GR G GSIYVWASG+GG     CNCDGY  S++T+SI+S T  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS           ++W  NG G + +H +GYG+LDAG MV +AK WV V P+R + I    + +   ++ K L +    + C + + + ++ LEHVQA +S+  +RRGD+ ++LTSPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +  +  + G  +++VLVL+GT S 
Sbjct:    1 MLWTLSALVKEITGQKVYTNTWAVHISGGSAE--ADRLAKKYGF--INHGLRFEDYYHFAHRAVMKRSLAPKKSRQVLLKREPQVHWLEQQVAKKRKKR----------------------------DVFTD---PTDPKFMQQWYLLDTNRHD------LHVKEAWEQGFTGKGIVVSILDDGIEKNHPDLQANYDPAASYDVNDQDPDPQPRYTQLNDNRHGTRCAGEVAAAANNGICGVGIAYNANIGGTGVRMLDGE-VTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPAKLAEEAFYRGVTQGRGGLGSIYVWASGNGGREHDSCNCDGYTNSIYTLSISSTTQMGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVQTSN----PAGLNANDWITNGVGRKVSHSYGYGLLDAGAMVALAKDWVTVGPQRKYVIDILSEPK---DIGKRLEVRRKVEPC-AGMSNYISTLEHVQARLSLSYNRRGDLAIYLTSPMGTRSCLLAPRPH-DYSADGFNDWSFMTTHSWDEDPAGEWVLEIE-NVSNNNNYGTLTQFVLVLYGTASE 566          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:Xenbase;Acc:XB-GENE-979058])

HSP 1 Score: 407.912 bits (1047), Expect = 4.906e-127
Identity = 249/620 (40.16%), Postives = 350/620 (56.45%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPT--DPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALI-LEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDT---KDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKI 2313
            + +N W V +  P   E A ++A + G+  L    N  N + F+H      S+  S   H  L  H  V+  +Q E   R KR                            +++ D  L    DP++   WY+  + ++   +  ++NV+SAW +G TGK V  +I+DDG++  HPDL +NY+  +S+D + +D  P PRY     N HGTRCAGE++A  +N  C VG+AY+++I G+RMLD   +TD++EA ++    D IDIYS+SWGP DDG+TVDGP     +A  +G+ KGRKG GSI+VWAS   G   D C+CDGY  S++TISI+S T +G    Y E C+STLA+T+S+G  +   +  + T DL   CT  H+GTS +AP  AGV ALALEAN  + WRD+QHL V TS+        R  +W  NGAG + +HL+G+G++DA  MV  AKKW  VP +  CI G  D+R RF     LI     T+AC  + GH V YLEHV   V++   RRGD+ ++L SP GT S +L+ R   D S  GF  W FMT H WGE   G+W L +   +   ++P  QG   EW L+ +GT   PY+ + +   +I
Sbjct:   29 VFSNHWAVRI--PGGPEVAAELAAQYGYLSLGQIGNLENYYHFYHSRTIKRSTYASRGTHSFLRMHPKVEWMQQQEVKKRVKR----------------------------HVRTDPNLVNFNDPIWPNMWYLHCSDKSSRCRS-EMNVMSAWQRGYTGKNVVVSILDDGVEKNHPDLIQNYDPHASHDVNGDDQDPSPRYDASNENKHGTRCAGEVAASANNSHCIVGIAYNARIGGIRMLDGD-VTDVVEAKSLGVRPDYIDIYSSSWGPDDDGKTVDGPGPLARKAFEDGIKKGRKGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEECASTLATTYSSGAFY---ERKIVTTDLRQGCTDDHTGTSVSAPMVAGVIALALEANPVLNWRDVQHLLVKTSR----SVHLRAPDWKTNGAGRKVSHLYGFGLVDADAMVVEAKKWRTVPPQHVCI-GASDRRPRFIRAVQLIRTTTQTNACVDNAGHYVAYLEHVVVRVTISHPRRGDLQIYLISPSGTKSQLLAKR-TFDSSNEGFKNWEFMTVHCWGEKAEGEWTLEIHDSSSQLRNPEIQGKLKEWTLIFYGTSEHPYNHIGTQHSRI 607          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:Xenbase;Acc:XB-GENE-983314])

HSP 1 Score: 386.341 bits (991), Expect = 9.532e-123
Identity = 239/596 (40.10%), Postives = 341/596 (57.21%), Query Frame = 1
Query:  436 ILLFLCEYVVCG--KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLK-LPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIA-GLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKALI-LEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTV 2199
            +L  LC+ +  G  K   N+W   +  P   E A  +A E  +  L    +  N ++F HK  P  S   +    K L     V  A+Q     R KR                              + D K L  DPL++++WY+++T     +  LDL++L  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+   +N  CGVGVAY++K+  G+RMLD   +TD  EA+++ ++  ++ IYSASWGP DDG+TV+GP     +A   G+ +GR GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+ +S+G      D  + + DL+ +CT  H+GTSA+AP AAG+FALALE N ++ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  K W  V E+  CI    +   RF  +   + ++I T AC+    H +  LEH+Q   +++ +RRGD+ + LTSP+GT +++L+ R + D S  GF  W FM+ HTWGE+P G W L +
Sbjct:   16 VLSLLCQVLAVGVDKRYMNEWAAEI--PGGPEEAQLLALELDYDYLGQIGSLENHYLFRHKAHPRRSRRSAPHLTKRLADDGRVSWAEQQYSKERNKRS---------------------------AFRQDTKNLFNDPLWNRQWYLQDTRSNPSLPKLDLHLLPVWKKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDNDPFPRYDITNENRHGTRCAGEIAMVANNNKCGVGVAYNAKVGEGIRMLDG-VVTDAKEASSIGFNPQHVHIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGD---YTDQRIISADLHNECTETHTGTSASAPLAAGIFALALEFNPDLTWRDMQHLVVWTSE---YDPLANNAGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWKGVAEKKECIVEDNEFSPRFLRSDGEVTIQIPTKACEGQDNH-IKSLEHLQLEATIEYTRRGDLHITLTSPLGTNTVLLTERER-DTSPYGFKSWDFMSVHTWGEDPAGTWTLKI 573          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:MGI Symbol;Acc:MGI:97512])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 364/631 (57.69%), Postives = 440/631 (69.73%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     +K A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA   N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + T+AC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY  +   +     KL + K+Q       +
Sbjct:   28 VFTNHFLVELHKDG-EEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:MGI Symbol;Acc:MGI:97511])

HSP 1 Score: 430.639 bits (1106), Expect = 3.512e-137
Identity = 254/623 (40.77%), Postives = 368/623 (59.07%), Query Frame = 1
Query:  445 FLCEYVVCGKI-----VTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            F C +     +       N+W   +  P  QE+A+ +A+E G+ +L    +  N ++F HK+ P  S   +    K L     V  A+Q      ++R  + ++K                          L L  DP+++++WY+++T     +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+ + +N  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++  ++DIYSASWGP DDG+TV+GP     +A   GV +GR+GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+++S+G      D  + + DL+  CT  H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  + W NVPE+  C+    D  +     KA   +I+EI T AC+    + +  LEHVQ   +++ SRRGD+ + LTS +GT++++L+ R + D S  GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT S+P
Sbjct:   15 FFCVWCALNSVKAKRQFVNEWAAEI--PGGQEAASAIAEELGYDLLGQIGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQ---YEKERSKRSVQKDSA-----------------------LDLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECVVK--DNNFEPRALKANGEVIVEIPTRACEGQ-ENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPVGTWTLKITDMSGRMQNEGRIVNWKLILHGTSSQP 598          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 414.075 bits (1063), Expect = 1.841e-130
Identity = 259/604 (42.88%), Postives = 347/604 (57.45%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI----DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            KI TN W VH+  P     A++VAQ+ GF  L       + + F H+ V   S  P   +H  L     VK  +Q     R KR                                  + PTDP F ++WY+       GV   DLNV  AWAQG TG G+  +I+DDGI+  HPDL+ NY+  +S+D +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV++GR G GSI+VWASG+GG     CNCDGY  S++T+SI+SAT  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK           +W  NG G + +H +GYG+LDAG MV +A+ W  V  +  CI   +    D   R  V KA+       AC  +  H +  LEHVQA +++  +RRGD+ + L SPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +T +  + G  +++ LVL+GT
Sbjct:   28 KIFTNTWAVHI--PGGPAVADRVAQKHGFHNLGQIFG--DYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDV-------------------------------YQEPTDPKFPQQWYL------SGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT------ACLGEPNH-ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPAGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 414.075 bits (1063), Expect = 1.841e-130
Identity = 259/604 (42.88%), Postives = 347/604 (57.45%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI----DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            KI TN W VH+  P     A++VAQ+ GF  L       + + F H+ V   S  P   +H  L     VK  +Q     R KR                                  + PTDP F ++WY+       GV   DLNV  AWAQG TG G+  +I+DDGI+  HPDL+ NY+  +S+D +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV++GR G GSI+VWASG+GG     CNCDGY  S++T+SI+SAT  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK           +W  NG G + +H +GYG+LDAG MV +A+ W  V  +  CI   +    D   R  V KA+       AC  +  H +  LEHVQA +++  +RRGD+ + L SPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +T +  + G  +++ LVL+GT
Sbjct:   28 KIFTNTWAVHI--PGGPAVADRVAQKHGFHNLGQIFG--DYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDV-------------------------------YQEPTDPKFPQQWYL------SGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT------ACLGEPNH-ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPAGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 414.075 bits (1063), Expect = 1.841e-130
Identity = 259/604 (42.88%), Postives = 347/604 (57.45%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI----DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            KI TN W VH+  P     A++VAQ+ GF  L       + + F H+ V   S  P   +H  L     VK  +Q     R KR                                  + PTDP F ++WY+       GV   DLNV  AWAQG TG G+  +I+DDGI+  HPDL+ NY+  +S+D +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV++GR G GSI+VWASG+GG     CNCDGY  S++T+SI+SAT  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK           +W  NG G + +H +GYG+LDAG MV +A+ W  V  +  CI   +    D   R  V KA+       AC  +  H +  LEHVQA +++  +RRGD+ + L SPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +T +  + G  +++ LVL+GT
Sbjct:   28 KIFTNTWAVHI--PGGPAVADRVAQKHGFHNLGQIFG--DYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDV-------------------------------YQEPTDPKFPQQWYL------SGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT------ACLGEPNH-ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPAGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt
Match: sp|P28841|NEC2_RAT (Neuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 366/645 (56.74%), Postives = 443/645 (68.68%), Query Frame = 1
Query:  442 LFLCEYVVCGK---IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            L  C  V       + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     +K A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA   N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + T+AC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY  +   +     KL + K+Q       +
Sbjct:   14 LLFCVMVFASAERPVFTNHFLVELHKDG-EEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt
Match: sp|Q5REC2|NEC2_PONAB (Neuroendocrine convertase 2 OS=Pongo abelii GN=PCSK2 PE=2 SV=1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 363/603 (60.20%), Postives = 430/603 (71.31%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH     E A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELHKGGEDE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt
Match: sp|P16519|NEC2_HUMAN (Neuroendocrine convertase 2 OS=Homo sapiens GN=PCSK2 PE=2 SV=2)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 362/603 (60.03%), Postives = 431/603 (71.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt
Match: sp|P21661|NEC2_MOUSE (Neuroendocrine convertase 2 OS=Mus musculus GN=Pcsk2 PE=1 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 364/631 (57.69%), Postives = 440/631 (69.73%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     +K A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA   N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + T+AC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY  +   +     KL + K+Q       +
Sbjct:   28 VFTNHFLVELHKDG-EEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt
Match: sp|Q03333|NEC2_PIG (Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2 PE=2 SV=1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 365/617 (59.16%), Postives = 431/617 (69.85%), Query Frame = 1
Query:  442 LFLCEYVVCGK---IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            L  C  V       + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+      V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G   EW L+LHG+QS PY
Sbjct:   15 LLFCVTVFASAERPVFTNHFLVELH-KGGEEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENF-VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGAVKEWTLMLHGSQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: tr|E3CTL8|E3CTL8_SCHMD (Prohormone convertase 2 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 1283.47 bits (3320), Expect = 0.000e+0
Identity = 649/649 (100.00%), Postives = 649/649 (100.00%), Query Frame = 1
Query:  421 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ
Sbjct:    1 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 649          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: tr|A0A183K2T7|A0A183K2T7_9TREM (Uncharacterized protein OS=Schistosoma curassoni PE=3 SV=1)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 430/640 (67.19%), Postives = 502/640 (78.44%), Query Frame = 1
Query:  469 GKIVTNQWHVHLHDPAT-----QESANKVAQETGFSVLRNH-LNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFD--TKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFS 2364
            GKI TNQW V L          + SAN++A+E GF  L  H    PNEFVF H  +P+    PS+  +  L  H  + NA Q+EGF+RRKRGY+P+       L  IN      L + +    +L+  TDPLF  EWY+ N GQADGV  LDLNVL+AW+Q ITG+GV TAIMDDG+DYLHPD++ NY AE+SYDFSSND +P+PRYTDDWFNSHGTRCAGE++A   NG+CGVGVA  SK+AGLRMLDQPYMTDLIEAAAM+Y RD IDIYSASWGPTDDG TVDGPRN+TMRA+V+GVNKGRKGKGS+YVWASGDGG  DDCNCDGYAASMWTISINS TNDG TA YDESC+STLASTFSNGK+ F  DAGVGT+DLYG CTLHHSGTSAAAPEAAGVFALALEA + + WRD+QHLTVLTSKRNHL+DR   HNWTINGAGLEFNHLFG+GVLDAGDMV +AKKW  VPERFHC+AG  + R    + + + LE+DTDAC ++  ++VNYLEHVQAF+++K++RRGDIT+FLTSPM TTSM+L  RPKD D+TRGFTKWPFMTTH W ENPRGKW LT+  D  +KDPL  GI +EW+LV+HGTQ  PY  LS S   I PKLG+VK+QH + RF+
Sbjct:   19 GKIHTNQWLVKLKHNGNDRDELKRSANEIARELGFITLNEHNYGEPNEFVFTHIGLPYARGTPSYIHNHRLNKHPSIDNAIQIEGFVRRKRGYRPLTDDN---LSRINIPKARVLTDKEKELSELRSKTDPLFESEWYLHNIGQADGVPGLDLNVLAAWSQNITGRGVITAIMDDGVDYLHPDIAGNYAAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAIAGNGVCGVGVAPGSKVAGLRMLDQPYMTDLIEAAAMAYARDLIDIYSASWGPTDDGTTVDGPRNQTMRALVDGVNKGRKGKGSLYVWASGDGGENDDCNCDGYAASMWTISINSVTNDGHTAVYDESCASTLASTFSNGKSPFLRDAGVGTIDLYGNCTLHHSGTSAAAPEAAGVFALALEAQNELTWRDIQHLTVLTSKRNHLYDRQHNHNWTINGAGLEFNHLFGFGVLDAGDMVHLAKKWKTVPERFHCVAGTFNGRKIARLGQPIFLELDTDACMNNPINQVNYLEHVQAFITIKATRRGDITLFLTSPMNTTSMLLRRRPKDADNTRGFTKWPFMTTHMWSENPRGKWLLTIGLDSNSKDPLGYGILTEWILVIHGTQQPPYAHLSDSTINIAPKLGIVKKQHETKRFN 655          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: tr|A0A095C5E1|A0A095C5E1_SCHHA (Neuroendocrine convertase 2 OS=Schistosoma haematobium GN=MS3_05446 PE=3 SV=1)

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 430/651 (66.05%), Postives = 505/651 (77.57%), Query Frame = 1
Query:  436 ILLFLCEYVVCGKIVTNQWHVHLHDPAT-----QESANKVAQETGFSVLRNH-LNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFD--TKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFS 2364
            I+  +   +  GKI TNQW V L          + SAN++A+E GF  L  H    PNEFVF H  +P+    PS+  +  L  H  + NA Q+EGF+RRKRGY+P+       L  IN      L + +    +L+  TDPLF  EWY+ N GQADGV  LDLNVL+AW+Q ITG+GV TAIMDDG+DYLHPD++ NY AE+SYDFSSND +P+PRYTDDWFNSHGTRCAGE++A   NG+CGVGVA  SK+AGLRMLDQPYMTDLIEAAAM+Y RD IDIYSASWGPTDDG TVDGPRN+TMRA+V+GVNKGRKGKGS+YVWASGDGG  DDCNCDGYAASMWTISINS TNDG TA YDESC+STLASTFSNGK+ F  DAGVGT+DLYG CTLHHSGTSAAAPEAAGVFALALEA + + WRD+QHLTVLTSKRNHL+DR   HNWTINGAGLEFNHLFG+GVLDAGDMV +AKKW  VPERFHC+AG  + R    + + + LE+DTDAC ++  ++VNYLEHVQAF+++K++RRGDIT+FLTSPM TTSM+L  RPKD D+TRGFTKWPFMTTH W ENPRGKW LT+  D  +KDPL   I +EW+LV+HGTQ  PY  LS S   I PKLG+VK+QH + RF+
Sbjct:    8 IIYHIITQISYGKIHTNQWLVKLKHNGNDRDELKRSANEIARELGFITLNEHNYGEPNEFVFTHIGLPYARGTPSYIHNHRLNKHPSIDNAIQIEGFVRRKRGYRPLTDDN---LSRINIPKARVLTDKEKELSELRSKTDPLFESEWYLHNIGQADGVPGLDLNVLAAWSQNITGRGVITAIMDDGVDYLHPDIAGNYAAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAIAGNGVCGVGVAPGSKVAGLRMLDQPYMTDLIEAAAMAYARDLIDIYSASWGPTDDGTTVDGPRNQTMRALVDGVNKGRKGKGSLYVWASGDGGENDDCNCDGYAASMWTISINSVTNDGHTAVYDESCASTLASTFSNGKSPFLRDAGVGTIDLYGNCTLHHSGTSAAAPEAAGVFALALEAQNELTWRDIQHLTVLTSKRNHLYDRQHNHNWTINGAGLEFNHLFGFGVLDAGDMVHLAKKWKTVPERFHCVAGTFNGRKIARLGQPIFLELDTDACMNNPINQVNYLEHVQAFITIKATRRGDITLFLTSPMNTTSMLLRRRPKDADNTRGFTKWPFMTTHMWSENPRGKWLLTIGLDSNSKDPLGYAILTEWILVVHGTQQPPYAHLSDSTINIAPKLGIVKKQHETKRFN 655          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: tr|A0A183MNB8|A0A183MNB8_9TREM (Uncharacterized protein OS=Schistosoma margrebowiei PE=3 SV=1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 429/640 (67.03%), Postives = 502/640 (78.44%), Query Frame = 1
Query:  469 GKIVTNQWHVHLHDPAT-----QESANKVAQETGFSVLRNH-LNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFD--TKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFS 2364
            GKI TNQW V L          + SAN++A+E GF  L  H    PNEFVF H  +P+    PS+  +  L  H  + NA Q+EGF+RRKRGY+P+       L  IN      L + +    +L+  TDPLF  EWY+ N GQADGV  LDLNVL+AW+Q ITG+GV TAIMDDG+DYLHPD++ NY AE+SYDFSSND +P+PRYTDDWFNSHGTRCAGE++A   NG+CGVGVA  SK+AGLRMLDQPYMTDLIEAAAM+Y RD IDIYSASWGPTDDG TVDGPRN+TMRA+V+GVNKGRKGKGS+YVWASGDGG  DDCNCDGYAASMWTISINS TNDG TA YDESC+STLASTFSNGK+ F  DAGVGT+DLYG CTLHHSGTSAAAPEAAGVFALALEA + + WRD+QHLTVLTSKRNHL+DR   HNWTINGAGLEFNHLFG+GVLDAGDMV +AKKW  VPERFHC+AG  + R    + + ++LE+DTDAC ++  ++VNYLEHVQAF+++K++RRGDIT+FLTSPM TTSM+L  RPKD D+TRGFTKWPFMTTH W ENPRGKW LT+  D  +KDPL   I +EW+LV+HGTQ  PY  LS S   I PKLG+VK+QH + RF+
Sbjct:   19 GKIHTNQWLVKLKHNGNDRDELKRSANEIARELGFITLNEHNYGEPNEFVFTHIGLPYARGTPSYIHNHRLNKHPSIDNAIQIEGFVRRKRGYRPLTDDN---LSRINIPKARILTDKEKELSELRSKTDPLFESEWYLHNVGQADGVPGLDLNVLAAWSQNITGRGVITAIMDDGVDYLHPDIAGNYAAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAIAGNGVCGVGVAPGSKVAGLRMLDQPYMTDLIEAAAMAYARDLIDIYSASWGPTDDGTTVDGPRNQTMRALVDGVNKGRKGKGSLYVWASGDGGENDDCNCDGYAASMWTISINSVTNDGHTAVYDESCASTLASTFSNGKSPFLRDAGVGTIDLYGNCTLHHSGTSAAAPEAAGVFALALEAQNELTWRDIQHLTVLTSKRNHLYDRQHNHNWTINGAGLEFNHLFGFGVLDAGDMVHLAKKWKTVPERFHCVAGTFNGRKIARLGQPIVLELDTDACMNNPINQVNYLEHVQAFITIKATRRGDITLFLTSPMNTTSMLLRRRPKDADNTRGFTKWPFMTTHMWSENPRGKWLLTIGLDSNSKDPLGYAILTEWILVVHGTQQPPYAHLSDSTINIAPKLGIVKKQHETKRFN 655          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: tr|A0A183P164|A0A183P164_9TREM (Uncharacterized protein OS=Schistosoma mattheei PE=3 SV=1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 429/640 (67.03%), Postives = 501/640 (78.28%), Query Frame = 1
Query:  469 GKIVTNQWHVHLHDPAT-----QESANKVAQETGFSVLRNH-LNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFD--TKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFS 2364
            GKI TNQW V L          + SAN++A+E GF  L  H    PNEFVF H  +P+    PS+  +  L  H  + NA Q+EGF+RRKRGY+P+       L  IN      L + +    +L+  TDPLF  EWY+ N GQADGV  LDLNVL+AW+Q ITG+GV TAIMDDG+DYLHPD++ NY AE+SYDFSSND +P+PRYTDDWFNSHGTRCAGE++A   NG+CGVGVA  SK+AGLRMLDQPYMTDLIEAAAM+Y RD IDIYSASWGPTDDG TVDGPRN+TMRA+V+GVNKGRKGKGS+YVWASGDGG  DDCNCDGYAASMWTISINS TNDG TA YDESC+STLASTFSNGK+ F  DAGVGT+DLYG CTLHHSGTSAAAPEAAGVFALALEA + + WRD+QHLTVLTSKRNHL+DR   HNWTINGAGLEFNHLFG+GVLDAGDMV +AKKW  VPERFHC+AG  + R    + + + LE+DTDAC ++  ++VNYLEHVQAF+++K++RRGDIT+FLTSPM TTSM+L  RPKD D+TRGFTKWPFMTTH W ENPRGKW LT+  D  +KDPL   I +EW+LV+HGTQ  PY  LS S   I PKLG+VK+QH + RF+
Sbjct:   19 GKIHTNQWLVKLKHNGNDRDELKRSANEIARELGFITLNEHNYGEPNEFVFTHIGLPYARGTPSYIHNHRLNKHPSIDNAIQIEGFVRRKRGYRPLTDDN---LSRINIPKARVLTDKEKELSELRSKTDPLFESEWYLHNIGQADGVPGLDLNVLAAWSQNITGRGVITAIMDDGVDYLHPDIAGNYAAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAIAGNGVCGVGVAPGSKVAGLRMLDQPYMTDLIEAAAMAYARDLIDIYSASWGPTDDGTTVDGPRNQTMRALVDGVNKGRKGKGSLYVWASGDGGENDDCNCDGYAASMWTISINSVTNDGHTAVYDESCASTLASTFSNGKSPFLRDAGVGTIDLYGNCTLHHSGTSAAAPEAAGVFALALEAQNELTWRDIQHLTVLTSKRNHLYDRQHNHNWTINGAGLEFNHLFGFGVLDAGDMVHLAKKWKTVPERFHCVAGTFNGRKIARLGQPIFLELDTDACMNNPINQVNYLEHVQAFITIKATRRGDITLFLTSPMNTTSMLLRRRPKDADNTRGFTKWPFMTTHMWSENPRGKWLLTIGLDSNSKDPLGYAILTEWILVVHGTQQPPYAHLSDSTINIAPKLGIVKKQHETKRFN 655          
The following BLAST results are available for this feature:
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PCSK20.000e+060.03proprotein convertase subtilisin/kexin type 2 [Sou... [more]
PCSK20.000e+060.03proprotein convertase subtilisin/kexin type 2 [Sou... [more]
PCSK20.000e+059.20proprotein convertase subtilisin/kexin type 2 [Sou... [more]
PCSK11.180e-13440.70proprotein convertase subtilisin/kexin type 1 [Sou... [more]
PCSK11.720e-13146.33proprotein convertase subtilisin/kexin type 1 [Sou... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
egl-30.000e+055.20Prohormone convertase 2; Uncharacterized protein ... [more]
egl-30.000e+063.12Prohormone convertase 2; Uncharacterized protein ... [more]
egl-30.000e+063.12Prohormone convertase 2; Uncharacterized protein ... [more]
egl-30.000e+062.66Prohormone convertase 2; Uncharacterized protein ... [more]
kpc-11.036e-13042.45Furin-like protease kpc-1 [Source:RefSeq peptide;... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
amon0.000e+060.38amontillado [Source:FlyBase gene name;Acc:FBgn0023... [more]
Fur29.436e-12942.22Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598][more]
Fur21.193e-12641.32Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598][more]
Fur21.193e-12641.32Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598][more]
Fur21.193e-12641.32Furin 2 [Source:FlyBase gene name;Acc:FBgn0004598][more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk20.000e+060.40proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+060.43proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk12.929e-13941.56proprotein convertase subtilisin/kexin type 1 [Sou... [more]
pcsk13.311e-13941.56proprotein convertase subtilisin/kexin type 1 [Sou... [more]
furina2.540e-13442.95furin (paired basic amino acid cleaving enzyme) a ... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk20.000e+060.72proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+055.99proprotein convertase subtilisin/kexin type 2 [Sou... [more]
furin1.443e-12941.55furin (paired basic amino acid cleaving enzyme) [S... [more]
pcsk64.906e-12740.16proprotein convertase subtilisin/kexin type 6 [Sou... [more]
pcsk19.532e-12340.10proprotein convertase subtilisin/kexin type 1 [Sou... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Pcsk20.000e+057.69proprotein convertase subtilisin/kexin type 2 [Sou... [more]
Pcsk13.512e-13740.77proprotein convertase subtilisin/kexin type 1 [Sou... [more]
Furin1.841e-13042.88furin (paired basic amino acid cleaving enzyme) [S... [more]
Furin1.841e-13042.88furin (paired basic amino acid cleaving enzyme) [S... [more]
Furin1.841e-13042.88furin (paired basic amino acid cleaving enzyme) [S... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28841|NEC2_RAT0.000e+056.74Neuroendocrine convertase 2 OS=Rattus norvegicus G... [more]
sp|Q5REC2|NEC2_PONAB0.000e+060.20Neuroendocrine convertase 2 OS=Pongo abelii GN=PCS... [more]
sp|P16519|NEC2_HUMAN0.000e+060.03Neuroendocrine convertase 2 OS=Homo sapiens GN=PCS... [more]
sp|P21661|NEC2_MOUSE0.000e+057.69Neuroendocrine convertase 2 OS=Mus musculus GN=Pcs... [more]
sp|Q03333|NEC2_PIG0.000e+059.16Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|E3CTL8|E3CTL8_SCHMD0.000e+0100.00Prohormone convertase 2 OS=Schmidtea mediterranea ... [more]
tr|A0A183K2T7|A0A183K2T7_9TREM0.000e+067.19Uncharacterized protein OS=Schistosoma curassoni P... [more]
tr|A0A095C5E1|A0A095C5E1_SCHHA0.000e+066.05Neuroendocrine convertase 2 OS=Schistosoma haemato... [more]
tr|A0A183MNB8|A0A183MNB8_9TREM0.000e+067.03Uncharacterized protein OS=Schistosoma margrebowie... [more]
tr|A0A183P164|A0A183P164_9TREM0.000e+067.03Uncharacterized protein OS=Schistosoma mattheei PE... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015500Peptidase S8, subtilisin-relatedPRINTSPR00723SUBTILISINcoord: 399..415
score: 60.03
coord: 221..234
score: 50.58
coord: 175..194
score: 46.32
IPR032815Peptidase S8, pro-domainPFAMPF16470S8_pro-domaincoord: 23..101
e-value: 6.0E-12
score: 46.1
IPR032815Peptidase S8, pro-domainGENE3DG3DSA:3.30.70.850coord: 17..101
e-value: 1.9E-14
score: 53.2
IPR000209Peptidase S8/S53 domainGENE3DG3DSA:3.40.50.200coord: 137..477
e-value: 4.0E-100
score: 334.3
IPR000209Peptidase S8/S53 domainPFAMPF00082Peptidase_S8coord: 175..452
e-value: 2.8E-42
score: 144.9
IPR000209Peptidase S8/S53 domainSUPERFAMILYSSF52743Subtilisin-likecoord: 137..479
IPR002884Proprotein convertase, PPFAMPF01483P_proproteincoord: 525..612
e-value: 2.2E-24
score: 85.2
IPR008979Galactose-binding domain-likeGENE3DG3DSA:2.60.120.260coord: 478..621
e-value: 9.2E-43
score: 144.5
IPR008979Galactose-binding domain-likeSUPERFAMILYSSF49785Galactose-binding domain-likecoord: 473..621
IPR023827Peptidase S8, subtilisin, Asp-active sitePROSITEPS00136SUBTILASE_ASPcoord: 180..191
IPR023828Peptidase S8, subtilisin, Ser-active sitePROSITEPS00138SUBTILASE_SERcoord: 400..410
IPR022398Peptidase S8, subtilisin, His-active sitePROSITEPS00137SUBTILASE_HIScoord: 225..235
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.78
NoneNo IPR availableTMHMMTMhelixcoord: 19..41
NoneNo IPR availableTMHMMTMhelixcoord: 2..21
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.518
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR009020Proteinase propeptide inhibitorSUPERFAMILYSSF54897Protease propeptides/inhibitorscoord: 21..92

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR015500Peptidase_S8_subtilisin-rel
IPR032815S8_pro-domain
IPR000209Peptidase_S8/S53_dom
IPR002884PrprotnconvertsP
IPR008979Galactose-bd-like
IPR023827Peptidase_S8_Asp-AS
IPR023828Peptidase_S8_Ser-AS
IPR022398Peptidase_S8_His-AS
IPR009020Propept_inh
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000058embryonic digestive system
PLANA:0000023temporary embryonic pharynx
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010096 ID=SMED30010096|Name=TPA_inf: prohormone convertase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2542bp
CTTTGTTTGTAACCAGACTGAAACTGGATATTGTTGTCATAAAAAAATGA
AAATTTTGAACCAATTAAATTCCATTGAGTAACTGAAAACAAGATAAAAA
CTAGGAAAATCGTTTTTATCGTGAACGAACAAACAAAACAGATCATTCAT
TGTGCCCCTTTACAATTCATTCTCACTTTGCCCTTGTGTCTGTGCGTGTG
TGTACGCGCGCGCGTGATGACGTCAGCACAAATAATTGATGCTCCTGAAG
AAATAATATCGATCGATTCTCTCACCGAGTCCAGAGCATGCATATTATTT
CTGCAAACATAAAGAATTATGTGTAGGTGGGATGCAGATAAAATACAAAC
AACGACTTTCTATAAAATTTCTGGAAAATTTCTATCGAATCTACTTTTTC
ATTAGATTTGCTATTTTTAGATGAAGATTACATGGATCCTTTTGTTTCTA
TGCGAATATGTAGTTTGTGGAAAAATTGTCACCAATCAATGGCATGTCCA
CCTTCATGATCCTGCAACTCAAGAATCGGCAAATAAAGTAGCTCAGGAAA
CTGGTTTCTCGGTCTTACGAAACCATCTGAATTCTCCAAATGAATTTGTT
TTCCATCACAAAACCGTTCCTCACGTTAGTTCAGTTCCAAGTTGGAGTCA
ACACAAAGTTCTATTGGCTCACCATCTTGTTAAAAACGCAAAACAAGTTG
AAGGGTTTTTGAGACGAAAGAGAGGCTATAAGCCAATTAAAAAACAAGGT
CGTGTCCCACTGCCAACGATTAATAAAAAAGGAATTCCCGGCCTGGGAGA
GTCTGACAACATTAAAGTGGATTTGAAATTACCTACTGATCCTCTATTTT
CTAAAGAATGGTACATCAGAAATACCGGTCAAGCTGATGGAGTGAAAGAT
CTTGATCTTAATGTATTATCAGCGTGGGCTCAAGGTATAACCGGCAAAGG
GGTCACGACTGCAATCATGGATGATGGAATAGACTATCTTCACCCGGATT
TATCAAAAAATTATAACGCAGAAAGCAGTTATGATTTCAGTAGCAATGAC
CCTTACCCGTTCCCTCGATATACTGACGATTGGTTTAACAGTCACGGAAC
AAGATGTGCCGGTGAGATTTCCGCCGAACGTGATAATGGCATTTGTGGTG
TTGGAGTGGCATACGATTCCAAAATCGCTGGGTTGCGCATGCTAGATCAA
CCATATATGACAGATCTCATTGAGGCAGCAGCTATGAGTTATGATCGAGA
CAATATTGACATTTACTCTGCTAGCTGGGGACCCACGGATGATGGAAGAA
CTGTAGATGGGCCGAGAAATGAAACGATGCGCGCTATTGTTGAAGGTGTA
AATAAGGGACGCAAAGGCAAAGGAAGCATTTACGTTTGGGCATCTGGTGA
CGGTGGAGCAGCTGACGATTGTAATTGCGATGGATATGCTGCCAGCATGT
GGACAATAAGTATTAATTCAGCAACCAATGATGGAGAAACCGCAAGCTAT
GATGAATCCTGTTCTTCAACACTTGCGTCGACATTTTCTAATGGTAAGGC
ATGGTTTAGCCTTGACGCCGGTGTCGGAACTGTGGATTTATATGGCCAAT
GTACTCTACATCATTCGGGAACTTCTGCTGCTGCTCCAGAAGCAGCTGGA
GTGTTTGCTCTTGCTCTTGAAGCCAATTCGAATATTGGCTGGAGAGATAT
GCAGCATTTGACAGTGCTTACGAGTAAACGAAATCATTTGCATGACAGAG
ATCGACGCCATAATTGGACCATTAATGGAGCGGGTTTGGAATTCAATCAT
CTTTTTGGATACGGAGTACTCGATGCTGGTGACATGGTCCGAGTTGCTAA
AAAGTGGGTGAATGTACCAGAACGATTTCACTGCATTGCCGGACAAATCG
ATAAGCGTTATCGATTCAATGTAACAAAAGCTTTAATATTGGAAATTGAT
ACTGACGCGTGCAAATCAGATATAGGTCATCGAGTGAATTATCTTGAGCA
TGTCCAGGCTTTTGTTTCAGTTAAATCTAGTCGACGAGGAGACATAACAA
TGTTTTTAACGAGCCCCATGGGTACGACTTCTATGATTCTCAGCCATCGA
CCAAAGGATGACGATTCCACAAGAGGATTCACCAAATGGCCATTTATGAC
CACTCATACATGGGGAGAAAACCCTCGCGGAAAATGGAAACTGACAGTAA
TGTTCGACACGAAAGATCCATTAAGTCAAGGAATATTTTCTGAATGGGTG
CTCGTGCTTCATGGAACACAGAGTCGACCCTATGACAAATTGTCTAGTTC
ACTAGAGAAAATCATTCCTAAACTCGGTGTAGTAAAGAGACAACATGCCT
CTAACAGATTTTCACAATAGTTGTTGAACTTGATCTTTATTTAGTATTGA
TAATATTTTTTGTCTTTGACCGCGACTAAGCAGTGCTACTGCAGATTTTG
TGATCGTATTTTTGTAAACTTTTGTCCAGTAAGATTGTCGTATCTTATTG
TTATTATTAATTTCACTATCATTTCATCAACAGGATTAATAA
back to top

protein sequence of SMED30010096-orf-1

>SMED30010096-orf-1 ID=SMED30010096-orf-1|Name=SMED30010096-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=650bp
MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLR
NHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRK
RGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFN
VTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP
LSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010096
GenBankDAA33932.1