TPA_inf: prohormone convertase 2

Overview
NameTPA_inf: prohormone convertase 2 (DAA33932.1)
Smed IDSMED30010096
Length (bp)2542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPA_inf: prohormone convertase 2 (SMED30010096) t-SNE clustered cells

Violin plots show distribution of expression levels for TPA_inf: prohormone convertase 2 (SMED30010096) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TPA_inf: prohormone convertase 2 (SMED30010096) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TPA_inf: prohormone convertase 2 (SMED30010096) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

TPA_inf: prohormone convertase 2 is expressed during Stage 4 in the embryonic digestive system and embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30010096

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30010096SMESG000008070.1 SmedASXL_009486SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
gutSMED30010096SMESG000008070.1 tr5_785mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:29557542
Han et al., 2019
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30010096SMESG000008070.1 dd_Smed_v4_1566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30010096SMESG000008070.1 dd_Smed_v4_1566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
medial muscle cellSMED30010096SMESG000008070.1 dd_Smed_v4_1566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30010096SMESG000008070.1 dd_Smed_v6_1566_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
embryonic pharynx neuronSMED30010096SMESG000008070.1 SMED30010096smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30010096SMESG000008070.1 SMESG000008069.1 DAA33932.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
headSMED30010096SMESG000008070.1 SMESG000008069.1 OX_Smed_1.0.20218ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
photoreceptor neuronSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ventral nerve cordSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
central nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
submuscular nerve plexusSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
pharynx musculatureSMED30010096SMESG000008070.1 dd_Smed_v4_1566_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30010096SMESG000008070.1 dd_Smed_v6_1566_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30010096SMESG000008070.1 dd_Smed_v6_1566_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30010096SMESG000008070.1 dd_Smed_v4_1566_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30010096SMESG000008070.1 SMESG000008069.1 BK007043.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK2 (proprotein convertase subtilisin/kexin type 2 [Source:HGNC Symbol;Acc:HGNC:8744])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 362/603 (60.03%), Postives = 431/603 (71.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   10 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 580          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK2 (proprotein convertase subtilisin/kexin type 2 [Source:HGNC Symbol;Acc:HGNC:8744])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 362/603 (60.03%), Postives = 431/603 (71.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK2 (proprotein convertase subtilisin/kexin type 2 [Source:HGNC Symbol;Acc:HGNC:8744])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 357/603 (59.20%), Postives = 422/603 (69.98%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V +                                    VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELH-KGGEDKARQVAAEHGFGVRK------------------------------------VKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 564          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK1 (proprotein convertase subtilisin/kexin type 1 [Source:HGNC Symbol;Acc:HGNC:8743])

HSP 1 Score: 424.476 bits (1090), Expect = 3.779e-136
Identity = 256/629 (40.70%), Postives = 368/629 (58.51%), Query Frame = 1
Query:  421 MKITWILLFLCEYVVCG-----KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYR-FNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            ++ T  +LF C +         +   N+W   +  P   E+A+ +A+E G+ +L    +  N ++F HK  P  S   ++   K L     V  A+Q     R KR                       L +S      L L  DP+++++WY+++T     +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+ + +N  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++  ++DIYSASWGP DDG+TV+GP     +A   GV +GR+GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+++S+G      D  + + DL+  CT  H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  + W +VPE+  C+    D   R       +I+EI T AC+    + +  LEHVQ   +++ SRRGD+ + LTS  GT++++L+ R + D S  GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT S+P
Sbjct:    8 LQCTAFVLF-CAWCALNSAKAKRQFVNEWAAEI--PGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRS---------------------ALRDSA-----LNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQ-ENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 598          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Match: PCSK1 (proprotein convertase subtilisin/kexin type 1 [Source:HGNC Symbol;Acc:HGNC:8743])

HSP 1 Score: 414.461 bits (1064), Expect = 5.603e-133
Identity = 227/490 (46.33%), Postives = 319/490 (65.10%), Query Frame = 1
Query:  823 LKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYR-FNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            L L  DP+++++WY+++T     +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+ + +N  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++  ++DIYSASWGP DDG+TV+GP     +A   GV +GR+GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+++S+G      D  + + DL+  CT  H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  + W +VPE+  C+    D   R       +I+EI T AC+    + +  LEHVQ   +++ SRRGD+ + LTS  GT++++L+ R + D S  GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT S+P
Sbjct:   71 LNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQ-ENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQP 551          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Neuroendocrine convertase 2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECN9])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 366/663 (55.20%), Postives = 444/663 (66.97%), Query Frame = 1
Query:  427 ITWILLFLCEYVVCGKIV---TNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            +  I +FL  ++  G+ V   TN +HVHL +    E A+++A+  GF        S NE+ F    + H  +  S   H  L     V + +Q++G+ R KRGY+P++++                 ES      +  P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F      + G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    6 VDLICVFLSIFIGIGEAVDVYTNHFHVHLKEGGGLEDAHRIAKRHGFINRGQVAASDNEYHFVQPALVHARTRRSAGHHAKLHNDDEVLHVEQLKGYTRTKRGYRPLEQRL----------------ESQFDFSAVMSPSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGS-QFEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARFQGPGAHA-GTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 648          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Neuroendocrine convertase 2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECN9])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 332/526 (63.12%), Postives = 386/526 (73.38%), Query Frame = 1
Query:  832 PTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F  + P +  G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    3 PSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGSQ-FEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARF--QGPGAHAGTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 523          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: egl-3 (Neuroendocrine convertase 2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECN9])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 332/526 (63.12%), Postives = 386/526 (73.38%), Query Frame = 1
Query:  832 PTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F  + P +  G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    3 PSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGSQ-FEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARF--QGPGAHAGTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 523          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:UniProtKB/Swiss-Prot;Acc:O17798])

HSP 1 Score: 410.994 bits (1055), Expect = 3.413e-132
Identity = 256/603 (42.45%), Postives = 353/603 (58.54%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHL-VKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI-RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIG-HRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            +  TN+W V +     +E AN++A + G++ L   +     ++F        SS  + S     L H   V   +Q     R KRGY+ I++        I ++   G   S +       P DPL++  WY+ R    +D    +D NV  AW  G TGKGV   I+DDG++  HPD+S NY+  +SYD +  D  P PRY     N HGTRCAGE++A  +N +C VG+AY++ I G+RMLD   +TD +EAA++ ++ D IDIYSASWGP DDGRTVDGP   T  A  +G+  GRKGKGSI+VWAS   G  AD CNCDGY  S++T+SI+SAT +G    Y E+CSSTLA+T+S+G     +   + T DL+  CT  H+GTSA+AP AAG+ ALALEAN N+ WRD+QH+ + T+K        R  +WT NG G   +H FGYG++DAG MV++AK W  V E+  C      +         L L++ +D C      ++V+Y+EHVQA V++K+ +RGD+ ++LTSP GT S +L+ R + D S  GFT W FMTTH WGE   G W L +  D  D        +W LVL+GT
Sbjct:   56 RTYTNEWAVRIAGGKVEE-ANRLANKYGYTNLGPIIPGDEYYLFRDDRKKSRSSRKTRSLSANQLQHEEDVMWMEQQVAKRRVKRGYRRIRRH--TDDNDIFEEDDDGTQISKSRNRKHPDPNDPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDNDPMPRYEFSDENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGD-VTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSGATGEKM---ILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAK----PINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCRQFYPSRYKNIPNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRAR-DTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDGWDDAE---LVKWELVLYGT 643          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Match: kpc-1 (Furin-like protease kpc-1 [Source:UniProtKB/Swiss-Prot;Acc:O17798])

HSP 1 Score: 410.994 bits (1055), Expect = 3.413e-132
Identity = 256/603 (42.45%), Postives = 353/603 (58.54%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHL-VKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI-RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIG-HRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            +  TN+W V +     +E AN++A + G++ L   +     ++F        SS  + S     L H   V   +Q     R KRGY+ I++        I ++   G   S +       P DPL++  WY+ R    +D    +D NV  AW  G TGKGV   I+DDG++  HPD+S NY+  +SYD +  D  P PRY     N HGTRCAGE++A  +N +C VG+AY++ I G+RMLD   +TD +EAA++ ++ D IDIYSASWGP DDGRTVDGP   T  A  +G+  GRKGKGSI+VWAS   G  AD CNCDGY  S++T+SI+SAT +G    Y E+CSSTLA+T+S+G     +   + T DL+  CT  H+GTSA+AP AAG+ ALALEAN N+ WRD+QH+ + T+K        R  +WT NG G   +H FGYG++DAG MV++AK W  V E+  C      +         L L++ +D C      ++V+Y+EHVQA V++K+ +RGD+ ++LTSP GT S +L+ R + D S  GFT W FMTTH WGE   G W L +  D  D        +W LVL+GT
Sbjct:   56 RTYTNEWAVRIAGGKVEE-ANRLANKYGYTNLGPIIPGDEYYLFRDDRKKSRSSRKTRSLSANQLQHEEDVMWMEQQVAKRRVKRGYRRIRRH--TDDNDIFEEDDDGTQISKSRNRKHPDPNDPLWTDMWYLNRGEHHSDSTTRMDHNVKEAWDLGYTGKGVVVTILDDGLERTHPDISPNYDERASYDVNDRDNDPMPRYEFSDENRHGTRCAGEVAAIFNNSLCIVGIAYNANIGGIRMLDGD-VTDAVEAASVGHNADYIDIYSASWGPDDDGRTVDGPAKLTRSAFEKGITMGRKGKGSIFVWASGNGGKDADSCNCDGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSGATGEKM---ILTTDLHHACTNMHTGTSASAPLAAGIVALALEANPNLTWRDLQHIVIRTAK----PINLRAGDWTTNGVGRNVSHSFGYGLMDAGAMVKLAKIWKKVDEQHRCRQFYPSRYKNIPNGNRLQLQLYSDGCYGGADENKVSYVEHVQAIVTLKAPKRGDLQIYLTSPSGTKSTLLTKRAR-DTSRSGFTDWAFMTTHNWGEQAAGLWILEIDNDGWDDAE---LVKWELVLYGT 643          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: amon (gene:FBgn0023179 transcript:FBtr0085048)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 381/631 (60.38%), Postives = 451/631 (71.47%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSP-NEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTIN-KKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRF 2361
            + T+ + V          A+ VA + GF  L   + +  +E+ F H+T+PH  S  S +  + L +H  V  A Q  GF R KRG +P        +P I+  K    +GE + I  +   PTDP F  +WY++NTGQ  G   LDLNV +AWAQGITGK VTTAIMDDG+DY+HPDL  NYNAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGE++A RDNGICGVGVAYDSKIAG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV+GVN+GR G G+IYVWASGDGG  DDCNCDGYAASMWTISINSA NDG+ A YDESCSSTLASTFSNG      + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSKRN L D   R +WT+NG GLEFNHLFG+GVLDAG MV ++K+W +VP R+HC AG++ +     + ++L  EI TDACK      VNYLEHVQA +S  +SRRGD+ +FLTSPMGT SMILS R  DDD   GFTKWPFMTTH+WGE P+G WKL   F++      G   EW LVLHGT+  PY  L  S      KL +VK+ H   + 
Sbjct:   39 VFTSSFLVRFRRGVDNSFAHDVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRVKRGLRPA-------VPAIHGMKFDLKVGEGNRIDEE---PTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKG-TDTEVNYLEHVQAVISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQ-TRHGNLLEWSLVLHGTKEAPYRTLHPSSPH--SKLAIVKKAHEDKKM 653          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0301301)

HSP 1 Score: 426.402 bits (1095), Expect = 8.920e-130
Identity = 266/630 (42.22%), Postives = 381/630 (60.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG--YKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR   Y+ +     + L + +++      E  ++      P DPLF ++WY+ N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYKSISLASHSQRM-----EYRDVSSHFIFP-DPLFKEQWYL-NGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 843          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074263)

HSP 1 Score: 420.624 bits (1080), Expect = 1.359e-127
Identity = 269/651 (41.32%), Postives = 383/651 (58.83%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG-----------YKPIKKQGRV---PLP-------TINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR            Y  +++ G     P P       +I+        E  ++      P DPLF ++WY+  +N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074261)

HSP 1 Score: 420.624 bits (1080), Expect = 1.359e-127
Identity = 269/651 (41.32%), Postives = 383/651 (58.83%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG-----------YKPIKKQGRV---PLP-------TINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR            Y  +++ G     P P       +I+        E  ++      P DPLF ++WY+  +N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Match: Fur2 (gene:FBgn0004598 transcript:FBtr0074265)

HSP 1 Score: 420.624 bits (1080), Expect = 1.359e-127
Identity = 269/651 (41.32%), Postives = 383/651 (58.83%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNS-PNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRG-----------YKPIKKQGRV---PLP-------TINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYI--RNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQ------CTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKL 2325
            I TN++ V++  PA ++ A+ +A + GF + R  + S  N ++F H  V   S   S      L + + VK  +Q    +RRKR            Y  +++ G     P P       +I+        E  ++      P DPLF ++WY+  +N G  DG   LD+NV  AW +G TGKGV  +I+DDGI   HPDL++NY+ E+S+D + ND  P P+  D+  N HGTRCAGE++A   N  CGVGVAY++ I G+RMLD   + D++EA A+S +  +IDIYSASWGP DDG TVDGP     RA + GV  GR+GKGSI+VWAS   G   D CNCDGY  S++T+SI+SAT  G    Y E CSSTLA+T+S+G      D  V TVD+ G       CT+ H+GTSA+AP AAG+ ALALEAN  + WRDMQ+L V TS+       ++ + WT+NG   +++H FGYG++DAG MV +A++W +VP +  C + +   D++        L   +D + C   I + V YLEHVQ  ++++   RG++ + LTSPMGTTS +L  RP+D   +  F  WPF++ H WGE   G+W L V+   +  ++Q GI S+W L+ +GT ++P  +L S L    P+L
Sbjct:  238 IYTNEFAVNI--PAGKQMADVIATKHGF-INRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKSENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASHSQRMEYRDVSSHFIFP-DPLFKEQWYLVSKNGGAKDG---LDMNVGPAWQKGYTGKGVVVSILDDGIQTNHPDLAQNYDPEASFDINGNDSDPTPQ--DNGDNKHGTRCAGEVAAVAFNNFCGVGVAYNASIGGVRMLDGK-VNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLATTYSSGTPGH--DKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWRDMQYLVVYTSR---PAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTI-NEVRYLEHVQCRITLRFFPRGNLRILLTSPMGTTSTLLFERPRDIVKSN-FDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILSKWQLIFYGTSTQPM-RLKSELLNSSPQL 870          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 365/604 (60.43%), Postives = 437/604 (72.35%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSW-SQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
             +T  + V + + A  E A K+A E GF   R      + F F+   +P      S   QH  L + H VKN    EGF R+KRGY+ +                       N  V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW+ G TGKGVT AIMDDGIDYLHPDL+ NYNAE+S+DFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A+ W  VPERFHC+AG +   ++      L+L I TDAC+    + V YLEHVQA ++V +SRRGD+ + +TSPMGT S++LS RP+DDD+  GF KWPFMTTHTWGE+PRG W L V F ++  +  G+  EW L+LHGTQS PY
Sbjct:   33 FITGHFLVQMRE-AAPEDAQKLALEHGFESARKLPFGEDLFHFYPLEMPKTRRKRSLHQQHHRLASDHRVKNVFPQEGFGRQKRGYRDLP----------------------NTDVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWSLGFTGKGVTIAIMDDGIDYLHPDLASNYNAEASFDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAVSNNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDLQHLTVLTSK--RNKLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKLARDWKTVPERFHCVAGSMQDIHKIQSGNKLLLSISTDACQGK-DNFVRYLEHVQAVITVNASRRGDLNINMTSPMGTKSILLSRRPRDDDAKVGFDKWPFMTTHTWGEDPRGPWLLEVGFQSQSDMQSGLLKEWTLMLHGTQSAPY 606          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:ZFIN;Acc:ZDB-GENE-071009-1])

HSP 1 Score: 436.032 bits (1120), Expect = 9.573e-141
Identity = 261/628 (41.56%), Postives = 378/628 (60.19%), Query Frame = 1
Query:  421 MKITWILLFLCEYV--VCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            M +  +L  +C  V     +   N+W V +  P   ++A  +A E G+ ++R      N ++F         S PS ++     A H+ K   + +     ++ Y+  ++  R PL      G+    E  +  VD KL  DP+++++WY+++T  +  +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+  +SYDF+ NDP PFPRY     N HGTRCAGEI+ + DN  CGVGVAY+SK+ G+RMLD   +TD IEA+++ Y+ D++DIYSASWGP DDG+TV+GP     +A   G+ KGR GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+ +S+G      D  + + DL+ +CT  H+GTSA+AP AAG+FALALE N ++ WRD+QHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  K W +VPE+  CI    D+ ++    KA   + +EI T AC     + V  LEHVQ  VS++ +RRGD+ + LTSP GTT+++L+ R + D S+ GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT  +P
Sbjct:    8 MLLCSVLALVCALVSSAVDRQYLNEWAVEI--PGGVQNARSIADEFGYQLVRQIGALENHYLFKRH------SHPSRTKRS---ADHITKRLSEDDRVSWAEQQYEK-RRAKRAPL------GV----ECKDCSVD-KLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDIYPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY---TDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSE---FDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVR--DETFQPRPLKAAGEISIEIPTKACAGQ-ANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLAERER-DTSSNGFRNWAFMSVHTWGENPTGTWILKITDTSGRMENEGQIISWKLILHGTSEKP 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:ZFIN;Acc:ZDB-GENE-071009-1])

HSP 1 Score: 435.647 bits (1119), Expect = 1.084e-140
Identity = 261/628 (41.56%), Postives = 378/628 (60.19%), Query Frame = 1
Query:  421 MKITWILLFLCEYV--VCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            M +  +L  +C  V     +   N+W V +  P   ++A  +A E G+ ++R      N ++F         S PS ++     A H+ K   + +     ++ Y+  ++  R PL      G+    E  +  VD KL  DP+++++WY+++T  +  +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+  +SYDF+ NDP PFPRY     N HGTRCAGEI+ + DN  CGVGVAY+SK+ G+RMLD   +TD IEA+++ Y+ D++DIYSASWGP DDG+TV+GP     +A   G+ KGR GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+ +S+G      D  + + DL+ +CT  H+GTSA+AP AAG+FALALE N ++ WRD+QHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  K W +VPE+  CI    D+ ++    KA   + +EI T AC     + V  LEHVQ  VS++ +RRGD+ + LTSP GTT+++L+ R + D S+ GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT  +P
Sbjct:    8 MLLCSVLALVCALVSSAVDRQYLNEWAVEI--PGGVQNARSIADEFGYQLVRQIGALENHYLFKRH------SHPSRTKRS---ADHITKRLSEDDRVSWAEQQYEK-RRAKRAPL------GV----ECKDCSVD-KLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDIYPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY---TDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSE---FDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVR--DETFQPRPLKAAGEISIEIPTKACAGQ-ANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLAERER-DTSSNGFRNWAFMSVHTWGENPTGTWILKITDTSGRMENEGQIISWKLILHGTSEKP 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: furina (furin (paired basic amino acid cleaving enzyme) a [Source:ZFIN;Acc:ZDB-GENE-040901-1])

HSP 1 Score: 424.476 bits (1090), Expect = 9.170e-136
Identity = 259/603 (42.95%), Postives = 361/603 (59.87%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFV-FHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQS 2274
            K+ TN W VH+     +E A+++A++  F    NH N   ++  F H+TV   S       H  L     V  A+Q     R+KR                            ++  +   PTDP F+++WY+ N         LDLNV +AW QG+TG+GV  +I+DDGI+  HPDL +NY+ ++SYD +  DP P PRYT    N HGTRCAGE++A  DN ICGVGVAY+++I G+RMLD   +TD++EA ++S +  +IDIYSASWGP DDG+TVDGP      A   GV +GR G+GSI+VWASG+GG     CNCDGY  S++T+SI+S+T +G    Y E+CSSTLAST+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS           ++W ING G   +H +GYG+LDAG +V +AK W NV  +  C+   + +    N+   L++    DAC + + + V+ LEHVQA +++  +RRG++ ++L SP GT S +L  RP  D S+ GF  W FMTTH+W E+PRG+W L +  +       G  +++ LVL+GT S
Sbjct:   28 KVYTNTWAVHIE--GGEEEADRIARKHSFV---NHGNVFGDYYHFRHRTVVKRSLSEHRGTHIRLHTEPQVMWAEQQVVKRRKKR----------------------------DVYYE---PTDPKFAQQWYLYNQDH------LDLNVKNAWKQGVTGQGVVVSILDDGIEKNHPDLVQNYDPDASYDVNDGDPDPQPRYTQLNDNRHGTRCAGEVAAVADNDICGVGVAYNARIGGVRMLDGE-VTDVVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKEAFQRGVIEGRGGRGSIFVWASGNGGRMKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLASTYSSGGV---NEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSN----PAHLTTNDWKINGVGRRVSHSYGYGLLDAGAIVALAKNWTNVGPQHKCVLSLVSEPR--NIGSYLVINKTVDAC-TGMANFVSSLEHVQAQLTLSYNRRGNLAIYLISPQGTRSTLLPPRPH-DYSSEGFNDWAFMTTHSWDEDPRGEWTLEIK-NVAGTSDYGTLTQFTLVLYGTAS 575          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Match: furina (furin (paired basic amino acid cleaving enzyme) a [Source:ZFIN;Acc:ZDB-GENE-040901-1])

HSP 1 Score: 424.476 bits (1090), Expect = 9.170e-136
Identity = 259/603 (42.95%), Postives = 361/603 (59.87%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFV-FHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQS 2274
            K+ TN W VH+     +E A+++A++  F    NH N   ++  F H+TV   S       H  L     V  A+Q     R+KR                            ++  +   PTDP F+++WY+ N         LDLNV +AW QG+TG+GV  +I+DDGI+  HPDL +NY+ ++SYD +  DP P PRYT    N HGTRCAGE++A  DN ICGVGVAY+++I G+RMLD   +TD++EA ++S +  +IDIYSASWGP DDG+TVDGP      A   GV +GR G+GSI+VWASG+GG     CNCDGY  S++T+SI+S+T +G    Y E+CSSTLAST+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS           ++W ING G   +H +GYG+LDAG +V +AK W NV  +  C+   + +    N+   L++    DAC + + + V+ LEHVQA +++  +RRG++ ++L SP GT S +L  RP  D S+ GF  W FMTTH+W E+PRG+W L +  +       G  +++ LVL+GT S
Sbjct:   28 KVYTNTWAVHIE--GGEEEADRIARKHSFV---NHGNVFGDYYHFRHRTVVKRSLSEHRGTHIRLHTEPQVMWAEQQVVKRRKKR----------------------------DVYYE---PTDPKFAQQWYLYNQDH------LDLNVKNAWKQGVTGQGVVVSILDDGIEKNHPDLVQNYDPDASYDVNDGDPDPQPRYTQLNDNRHGTRCAGEVAAVADNDICGVGVAYNARIGGVRMLDGE-VTDVVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKEAFQRGVIEGRGGRGSIFVWASGNGGRMKDSCNCDGYTNSIYTLSISSSTQNGNVPWYSEACSSTLASTYSSGGV---NEKQIVTTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSN----PAHLTTNDWKINGVGRRVSHSYGYGLLDAGAIVALAKNWTNVGPQHKCVLSLVSEPR--NIGSYLVINKTVDAC-TGMANFVSSLEHVQAQLTLSYNRRGNLAIYLISPQGTRSTLLPPRPH-DYSSEGFNDWAFMTTHSWDEDPRGEWTLEIK-NVAGTSDYGTLTQFTLVLYGTAS 575          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100036632])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 366/618 (59.22%), Postives = 440/618 (71.20%), Query Frame = 1
Query:  436 ILLFLCEYVVCG--KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            ++L L   +V     ++T+ + V L +    E A ++A E GFS  R    + + + F+        S  S ++ K L     +    Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   14 LVLHLASVLVSAGRPVLTDHFLVDLREGGEAE-AKQLAAEYGFSGTRKLPFTQSLYHFYGNGKTTSRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 600          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100036632])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 363/603 (60.20%), Postives = 434/603 (71.97%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            ++T+ + V L +    E A ++A E GFS  R    + + + F+        S  S ++ K L     +    Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   17 VLTDHFLVDLREGGEAE-AKQLAAEYGFSGTRKLPFTQSLYHFYGNGKTTSRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 588          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100036632])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 366/618 (59.22%), Postives = 440/618 (71.20%), Query Frame = 1
Query:  436 ILLFLCEYVVCG--KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            ++L L   +V     ++T+ + V L +    E A ++A E GFS  R    + + + F+        S  S ++ K L     +    Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   14 LVLHLASVLVSAGRPVLTDHFLVDLREGGEAE-AKQLAAEYGFSGTRKLPFTQSLYHFYGNGKTTSRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 600          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100036632])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 363/603 (60.20%), Postives = 434/603 (71.97%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            ++T+ + V L +    E A ++A E GFS  R    + + + F+        S  S ++ K L     +    Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   26 VLTDHFLVDLREGGEAE-AKQLAAEYGFSGTRKLPFTQSLYHFYGNGKTTSRSRRSVNKKKHLAMDPKINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 597          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100036632])

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 348/536 (64.93%), Postives = 406/536 (75.75%), Query Frame = 1
Query:  676 LVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            L+    Q EGF R+KRGY+ I                      ++I +++    DPLF+K+WY+ NTGQADG   LDLNV  AW  G TG+GVT AIMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRD+QHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A +W  VPERFHCI G I +  R      LIL + TDAC+    + V YLEHVQA ++V S+RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW L+LHGTQS PY
Sbjct:   72 LINKVVQQEGFHRKKRGYRDI----------------------NDIDINMN---DPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPGLTWRDLQHLTVLTSK--RNQLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMANEWKTVPERFHCIGGAIQEPRRIPSDGKLILTLSTDACEGK-ENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMP-EKGVLKEWTLMLHGTQSAPY 577          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:MGI Symbol;Acc:MGI:97512])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 364/631 (57.69%), Postives = 440/631 (69.73%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     +K A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA   N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + T+AC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY  +   +     KL + K+Q       +
Sbjct:   28 VFTNHFLVELHKDG-EEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:MGI Symbol;Acc:MGI:97511])

HSP 1 Score: 430.639 bits (1106), Expect = 1.133e-138
Identity = 254/623 (40.77%), Postives = 368/623 (59.07%), Query Frame = 1
Query:  445 FLCEYVVCGKI-----VTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            F C +     +       N+W   +  P  QE+A+ +A+E G+ +L    +  N ++F HK+ P  S   +    K L     V  A+Q      ++R  + ++K                          L L  DP+++++WY+++T     +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+ E+SYDF+ ND  PFPRY     N HGTRCAGEI+ + +N  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++  ++DIYSASWGP DDG+TV+GP     +A   GV +GR+GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+++S+G      D  + + DL+  CT  H+GTSA+AP AAG+FALALEAN N+ WRDMQHL V TS+            W  NGAGL  N  FG+G+L+A  +V +A  + W NVPE+  C+    D  +     KA   +I+EI T AC+    + +  LEHVQ   +++ SRRGD+ + LTS +GT++++L+ R + D S  GF  W FM+ HTWGENP G W L +   +    ++G    W L+LHGT S+P
Sbjct:   15 FFCVWCALNSVKAKRQFVNEWAAEI--PGGQEAASAIAEELGYDLLGQIGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQ---YEKERSKRSVQKDSA-----------------------LDLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY---TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSE---YDPLASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECVVK--DNNFEPRALKANGEVIVEIPTRACEGQ-ENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERER-DTSPNGFKNWDFMSVHTWGENPVGTWTLKITDMSGRMQNEGRIVNWKLILHGTSSQP 598          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 414.075 bits (1063), Expect = 6.700e-132
Identity = 259/604 (42.88%), Postives = 347/604 (57.45%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI----DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            KI TN W VH+  P     A++VAQ+ GF  L       + + F H+ V   S  P   +H  L     VK  +Q     R KR                                  + PTDP F ++WY+       GV   DLNV  AWAQG TG G+  +I+DDGI+  HPDL+ NY+  +S+D +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV++GR G GSI+VWASG+GG     CNCDGY  S++T+SI+SAT  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK           +W  NG G + +H +GYG+LDAG MV +A+ W  V  +  CI   +    D   R  V KA+       AC  +  H +  LEHVQA +++  +RRGD+ + L SPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +T +  + G  +++ LVL+GT
Sbjct:   28 KIFTNTWAVHI--PGGPAVADRVAQKHGFHNLGQIFG--DYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDV-------------------------------YQEPTDPKFPQQWYL------SGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT------ACLGEPNH-ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPAGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 414.075 bits (1063), Expect = 6.700e-132
Identity = 259/604 (42.88%), Postives = 347/604 (57.45%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI----DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            KI TN W VH+  P     A++VAQ+ GF  L       + + F H+ V   S  P   +H  L     VK  +Q     R KR                                  + PTDP F ++WY+       GV   DLNV  AWAQG TG G+  +I+DDGI+  HPDL+ NY+  +S+D +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV++GR G GSI+VWASG+GG     CNCDGY  S++T+SI+SAT  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK           +W  NG G + +H +GYG+LDAG MV +A+ W  V  +  CI   +    D   R  V KA+       AC  +  H +  LEHVQA +++  +RRGD+ + L SPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +T +  + G  +++ LVL+GT
Sbjct:   28 KIFTNTWAVHI--PGGPAVADRVAQKHGFHNLGQIFG--DYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDV-------------------------------YQEPTDPKFPQQWYL------SGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT------ACLGEPNH-ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPAGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Match: Furin (furin (paired basic amino acid cleaving enzyme) [Source:MGI Symbol;Acc:MGI:97513])

HSP 1 Score: 414.075 bits (1063), Expect = 6.700e-132
Identity = 259/604 (42.88%), Postives = 347/604 (57.45%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQI----DKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGT 2268
            KI TN W VH+  P     A++VAQ+ GF  L       + + F H+ V   S  P   +H  L     VK  +Q     R KR                                  + PTDP F ++WY+       GV   DLNV  AWAQG TG G+  +I+DDGI+  HPDL+ NY+  +S+D +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD +EA ++  + ++I IYSASWGP DDG+TVDGP      A   GV++GR G GSI+VWASG+GG     CNCDGY  S++T+SI+SAT  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ AL LEAN N+ WRDMQHL V TSK           +W  NG G + +H +GYG+LDAG MV +A+ W  V  +  CI   +    D   R  V KA+       AC  +  H +  LEHVQA +++  +RRGD+ + L SPMGT S +L+ RP  D S  GF  W FMTTH+W E+P G+W L +  +T +  + G  +++ LVL+GT
Sbjct:   28 KIFTNTWAVHI--PGGPAVADRVAQKHGFHNLGQIFG--DYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDV-------------------------------YQEPTDPKFPQQWYL------SGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDG-EVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGN---QNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSK----PAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVT------ACLGEPNH-ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPH-DYSADGFNDWAFMTTHSWDEDPAGEWVLEIE-NTSEANNYGTLTKFTLVLYGT 573          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt/SwissProt
Match: sp|P28841|NEC2_RAT (Neuroendocrine convertase 2 OS=Rattus norvegicus OX=10116 GN=Pcsk2 PE=1 SV=1)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 366/645 (56.74%), Postives = 443/645 (68.68%), Query Frame = 1
Query:  442 LFLCEYVVCGK---IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            L  C  V       + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     +K A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYN+++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA   N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + T+AC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY  +   +     KL + K+Q       +
Sbjct:   14 LLFCVMVFASAERPVFTNHFLVELHKDG-EEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt/SwissProt
Match: sp|Q5REC2|NEC2_PONAB (Neuroendocrine convertase 2 OS=Pongo abelii OX=9601 GN=PCSK2 PE=2 SV=1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 363/603 (60.20%), Postives = 430/603 (71.31%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH     E A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELHKGGEDE-ARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt/SwissProt
Match: sp|P16519|NEC2_HUMAN (Neuroendocrine convertase 2 OS=Homo sapiens OX=9606 GN=PCSK2 PE=1 SV=2)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 362/603 (60.03%), Postives = 431/603 (71.48%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            + TN + V LH    ++ A +VA E GF V R    +   + F+H  +       S    + L     VK A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN  + WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + TDAC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY
Sbjct:   29 VFTNHFLVELH-KGGEDKARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGVLKEWTLMLHGTQSAPY 599          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt/SwissProt
Match: sp|G5ECN9|NEC2_CAEEL (Neuroendocrine convertase 2 OS=Caenorhabditis elegans OX=6239 GN=egl-3 PE=1 SV=1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 366/663 (55.20%), Postives = 444/663 (66.97%), Query Frame = 1
Query:  427 ITWILLFLCEYVVCGKIV---TNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXX--------------------XXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQH 2346
            +  I +FL  ++  G+ V   TN +HVHL +    E A+++A+  GF        S NE+ F    + H  +  S   H  L     V + +Q++G+ R KRGY+P++++                 ES      +  P+DPL+  +WY++NTGQA G   LDLNV  AWA G TGK +TTAIMDDG+DY+HPD+  N+NAE+SYDFSSNDP+P+PRYTDDWFNSHGTRCAGEI A RDNG+CGVGVAYD K+AG+RMLDQPYMTDLIEA +M ++   I IYSASWGPTDDG+TVDGPRN TMRAIV GVN+GR G GSI+VWASGDGG  DDCNCDGYAASMWTISINSA N+GE A YDESCSSTLASTFSNG    + + GV T DLYG+CT  HSGTSAAAPEAAGVFALALEAN ++ WRD+QHLTVLTS RN                      H       W +NG GLE+NHLFG+GVLDA +MV +A  W   P R+HC AG ID  +       LILEI+TD C       V YLEHVQA VS  S+RRGD T++L SPMGT +MILS RPKDDDS  GFT WPFMTTHTWGENP GKW+L   F      + G   ++ L+LHGT+  PY+ +   + +   KL  V++ H
Sbjct:    6 VDLICVFLSIFIGIGEAVDVYTNHFHVHLKEGGGLEDAHRIAKRHGFINRGQVAASDNEYHFVQPALVHARTRRSAGHHAKLHNDDEVLHVEQLKGYTRTKRGYRPLEQRL----------------ESQFDFSAVMSPSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIKNNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNGGR--NPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGS-QFEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARFQGPGAHA-GTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAH 648          
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt/SwissProt
Match: sp|P21661|NEC2_MOUSE (Neuroendocrine convertase 2 OS=Mus musculus OX=10090 GN=Pcsk2 PE=1 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 364/631 (57.69%), Postives = 440/631 (69.73%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            + TN + V LH    +E A +VA E GF V R    +   + F+H  +       S    + L     +K A Q EGF R+KRGY+ I +                        +D+ +  DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT  IMDDGIDYLHPDL+ NYNA++SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA   N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTD+G+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN ++ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK W  VPERFHC+ G +    +   T  L+L + T+AC+    + V YLEHVQA ++V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+ RG W L + F    P  +G+  EW L+LHGTQS PY  +   +     KL + K+Q       +
Sbjct:   28 VFTNHFLVELHKDG-EEEARQVAAEHGFGV-RKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINE------------------------IDINM-NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLKTNACEGK-ENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAP-QKGLLKEWTLMLHGTQSAPY--IDQVVRDYQSKLAMSKKQELEEELDE 624          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: E3CTL8 (Prohormone convertase 2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1283.47 bits (3320), Expect = 0.000e+0
Identity = 649/649 (100.00%), Postives = 649/649 (100.00%), Query Frame = 1
Query:  421 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ
Sbjct:    1 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 649          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: A0A267GYL1 (P/Homo B domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001076g1 PE=3 SV=1)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 440/652 (67.48%), Postives = 504/652 (77.30%), Query Frame = 1
Query:  436 ILLFLCEYVVCG------KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQH-KVLLAHHLVKNAKQVEGFLRRKRGYKPIKK-QGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            ILL  C  V+         + TN +HV L     +E A +VA++TG  ++R HL    EF + H  VP   SV   S+H + +  H  V    Q+EGF R KRG+KP K  Q R       K+       SD        PTDP+F KEWYI+NTGQA G   LDLNVL AW +G+TG GVTTAIMDDGIDY+HPDL+ NYN E+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGEIS++RDNGICGVGVAY SKIAGLRMLDQPYMTDLIEAAAMSY RD IDIYSASWGPTDDG+TVDGPRNETMRAIVEGVNKGR GKGSI+VWASGDGG  DDCNCDGYAASMWTISINSATNDGETA YDESCSSTLASTFSNGKA  +LDAGV TVDLYG+CTLHHSGTSAAAPEAAGVFALALEANSN+ WRDMQHL VLTSKRNHL+D + +H+WT+N AGLEFNHLFGYGVLDAGD+V+ A+ W  VPERFHCIAG++ + Y FNV  A+ +EIDTDACK D  HR+NY+EHVQAF+++KS+RRGD+T+FLT+P GTTS+ILS RPKD DS  GFT WPFMTTH WGE+PRGKWKL V  D  D    G+ SEWVLV+HGTQ +PY KL S L     K+ V+K+ H    +++
Sbjct:    7 ILLGWCLLVIAAVTSSKESLFTNHFHVTLKS-GNEEVAKRVARDTGLRLVRRHLGKDTEFHYVHDQVPEADSV--LSRHLRSIADHEDVTRVVQLEGFKRVKRGFKPAKATQSR------QKRS----ASSDE-------PTDPMFKKEWYIKNTGQAGGYPGLDLNVLPAWKEGVTGNGVTTAIMDDGIDYMHPDLAHNYNMEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEISSKRDNGICGVGVAYGSKIAGLRMLDQPYMTDLIEAAAMSYKRDIIDIYSASWGPTDDGKTVDGPRNETMRAIVEGVNKGRNGKGSIFVWASGDGGPDDDCNCDGYAASMWTISINSATNDGETALYDESCSSTLASTFSNGKA-STLDAGVATVDLYGKCTLHHSGTSAAAPEAAGVFALALEANSNLTWRDMQHLVVLTSKRNHLYDPNGKHDWTVNSAGLEFNHLFGYGVLDAGDIVKTARDWKTVPERFHCIAGEVKRLYHFNVQNAIEMEIDTDACKDDPKHRINYIEHVQAFITLKSTRRGDVTVFLTAPTGTTSLILSKRPKDADSKVGFTSWPFMTTHMWGESPRGKWKLKVALDATDASVHGVISEWVLVIHGTQEQPYKKLRSGLSS---KIDVIKKIHEKKSYTE 634          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: A0A183K2T7 (P/Homo B domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS9301 PE=3 SV=1)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 430/640 (67.19%), Postives = 502/640 (78.44%), Query Frame = 1
Query:  469 GKIVTNQWHVHLHDPAT-----QESANKVAQETGFSVLRNH-LNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFD--TKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFS 2364
            GKI TNQW V L          + SAN++A+E GF  L  H    PNEFVF H  +P+    PS+  +  L  H  + NA Q+EGF+RRKRGY+P+       L  IN      L + +    +L+  TDPLF  EWY+ N GQADGV  LDLNVL+AW+Q ITG+GV TAIMDDG+DYLHPD++ NY AE+SYDFSSND +P+PRYTDDWFNSHGTRCAGE++A   NG+CGVGVA  SK+AGLRMLDQPYMTDLIEAAAM+Y RD IDIYSASWGPTDDG TVDGPRN+TMRA+V+GVNKGRKGKGS+YVWASGDGG  DDCNCDGYAASMWTISINS TNDG TA YDESC+STLASTFSNGK+ F  DAGVGT+DLYG CTLHHSGTSAAAPEAAGVFALALEA + + WRD+QHLTVLTSKRNHL+DR   HNWTINGAGLEFNHLFG+GVLDAGDMV +AKKW  VPERFHC+AG  + R    + + + LE+DTDAC ++  ++VNYLEHVQAF+++K++RRGDIT+FLTSPM TTSM+L  RPKD D+TRGFTKWPFMTTH W ENPRGKW LT+  D  +KDPL  GI +EW+LV+HGTQ  PY  LS S   I PKLG+VK+QH + RF+
Sbjct:   19 GKIHTNQWLVKLKHNGNDRDELKRSANEIARELGFITLNEHNYGEPNEFVFTHIGLPYARGTPSYIHNHRLNKHPSIDNAIQIEGFVRRKRGYRPLTDDN---LSRINIPKARVLTDKEKELSELRSKTDPLFESEWYLHNIGQADGVPGLDLNVLAAWSQNITGRGVITAIMDDGVDYLHPDIAGNYAAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAIAGNGVCGVGVAPGSKVAGLRMLDQPYMTDLIEAAAMAYARDLIDIYSASWGPTDDGTTVDGPRNQTMRALVDGVNKGRKGKGSLYVWASGDGGENDDCNCDGYAASMWTISINSVTNDGHTAVYDESCASTLASTFSNGKSPFLRDAGVGTIDLYGNCTLHHSGTSAAAPEAAGVFALALEAQNELTWRDIQHLTVLTSKRNHLYDRQHNHNWTINGAGLEFNHLFGFGVLDAGDMVHLAKKWKTVPERFHCVAGTFNGRKIARLGQPIFLELDTDACMNNPINQVNYLEHVQAFITIKATRRGDITLFLTSPMNTTSMLLRRRPKDADNTRGFTKWPFMTTHMWSENPRGKWLLTIGLDSNSKDPLGYGILTEWILVIHGTQQPPYAHLSDSTINIAPKLGIVKKQHETKRFN 655          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: A0A095C5E1 (Neuroendocrine convertase 2 OS=Schistosoma haematobium OX=6185 GN=MS3_05446 PE=3 SV=1)

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 430/651 (66.05%), Postives = 505/651 (77.57%), Query Frame = 1
Query:  436 ILLFLCEYVVCGKIVTNQWHVHLHDPAT-----QESANKVAQETGFSVLRNH-LNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFD--TKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFS 2364
            I+  +   +  GKI TNQW V L          + SAN++A+E GF  L  H    PNEFVF H  +P+    PS+  +  L  H  + NA Q+EGF+RRKRGY+P+       L  IN      L + +    +L+  TDPLF  EWY+ N GQADGV  LDLNVL+AW+Q ITG+GV TAIMDDG+DYLHPD++ NY AE+SYDFSSND +P+PRYTDDWFNSHGTRCAGE++A   NG+CGVGVA  SK+AGLRMLDQPYMTDLIEAAAM+Y RD IDIYSASWGPTDDG TVDGPRN+TMRA+V+GVNKGRKGKGS+YVWASGDGG  DDCNCDGYAASMWTISINS TNDG TA YDESC+STLASTFSNGK+ F  DAGVGT+DLYG CTLHHSGTSAAAPEAAGVFALALEA + + WRD+QHLTVLTSKRNHL+DR   HNWTINGAGLEFNHLFG+GVLDAGDMV +AKKW  VPERFHC+AG  + R    + + + LE+DTDAC ++  ++VNYLEHVQAF+++K++RRGDIT+FLTSPM TTSM+L  RPKD D+TRGFTKWPFMTTH W ENPRGKW LT+  D  +KDPL   I +EW+LV+HGTQ  PY  LS S   I PKLG+VK+QH + RF+
Sbjct:    8 IIYHIITQISYGKIHTNQWLVKLKHNGNDRDELKRSANEIARELGFITLNEHNYGEPNEFVFTHIGLPYARGTPSYIHNHRLNKHPSIDNAIQIEGFVRRKRGYRPLTDDN---LSRINIPKARVLTDKEKELSELRSKTDPLFESEWYLHNIGQADGVPGLDLNVLAAWSQNITGRGVITAIMDDGVDYLHPDIAGNYAAEASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVAAIAGNGVCGVGVAPGSKVAGLRMLDQPYMTDLIEAAAMAYARDLIDIYSASWGPTDDGTTVDGPRNQTMRALVDGVNKGRKGKGSLYVWASGDGGENDDCNCDGYAASMWTISINSVTNDGHTAVYDESCASTLASTFSNGKSPFLRDAGVGTIDLYGNCTLHHSGTSAAAPEAAGVFALALEAQNELTWRDIQHLTVLTSKRNHLYDRQHNHNWTINGAGLEFNHLFGFGVLDAGDMVHLAKKWKTVPERFHCVAGTFNGRKIARLGQPIFLELDTDACMNNPINQVNYLEHVQAFITIKATRRGDITLFLTSPMNTTSMLLRRRPKDADNTRGFTKWPFMTTHMWSENPRGKWLLTIGLDSNSKDPLGYAILTEWILVVHGTQQPPYAHLSDSTINIAPKLGIVKKQHETKRFN 655          
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Match: A0A267GWD6 (P/Homo B domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001076g2 PE=3 SV=1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 438/651 (67.28%), Postives = 501/651 (76.96%), Query Frame = 1
Query:  436 ILLFLCEYVVCG------KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKK-QGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            ILL  C  V+         + TN +HV L     +E A +VA++TG  ++R HL    EF + H  VP   SV S    + +  H  V    Q+EGF R KRG+KP K  Q R       K+       SD        PTDP+F KEWYI+NTGQA G   LDLNVL AW +G+TG GVTTAIMDDGIDY+HPDL+ NYN E+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGEIS++RDNGICGVGVAY SKIAGLRMLDQPYMTDLIEAAAMSY RD IDIYSASWGPTDDG+TVDGPRNETMRAIVEGVNKGR GKGSI+VWASGDGG  DDCNCDGYAASMWTISINSATNDGETA YDESCSSTLASTFSNGKA  +LDAGV TVDLYG+CTLHHSGTSAAAPEAAGVFALALEANSN+ WRDMQHL VLTSKRNHL+D + +H+WT+N AGLEFNHLFGYGVLDAGD+V+ A+ W  VPERFHCIAG++ + Y FNV  A+ +EIDTDACK D  HR+NY+EHVQAF+++KS+RRGD+T+FLT+P GTTS+ILS R KD DS  GFT WPFMTTH WGE+PRGKWKL V  D  D    G+ SEWVLV+HGTQ +PY KL S L     K+ V+K+ H    +++
Sbjct:    7 ILLGWCLLVIAAVTSSKESLFTNHFHVTLK-SGNEEVAKRVARDTGLRLVRRHLGKDTEFHYVHDQVPEADSVLS-RHLRSIADHEDVARVVQLEGFKRVKRGFKPAKATQSR------QKRS----ASSDE-------PTDPMFKKEWYIKNTGQAGGYPGLDLNVLPAWKEGVTGNGVTTAIMDDGIDYMHPDLAHNYNMEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEISSKRDNGICGVGVAYGSKIAGLRMLDQPYMTDLIEAAAMSYKRDIIDIYSASWGPTDDGKTVDGPRNETMRAIVEGVNKGRNGKGSIFVWASGDGGPDDDCNCDGYAASMWTISINSATNDGETALYDESCSSTLASTFSNGKA-STLDAGVATVDLYGKCTLHHSGTSAAAPEAAGVFALALEANSNLTWRDMQHLVVLTSKRNHLYDPNGKHDWTVNSAGLEFNHLFGYGVLDAGDIVKTARDWKTVPERFHCIAGEVKRLYHFNVQNAIEMEIDTDACKDDPKHRINYIEHVQAFITLKSTRRGDVTVFLTAPTGTTSLILSKRQKDADSKVGFTSWPFMTTHMWGESPRGKWKLKVALDATDASVHGVISEWVLVIHGTQEQPYKKLRSGLSS---KIDVIKKIHEKKSYTE 634          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Cavefish
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:103033370])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 367/596 (61.58%), Postives = 429/596 (71.98%), Query Frame = 1
Query:  496 VHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            V LH+ A  E A+++A + GF   R        F F+ +  P      S    + L     VKN    EGF R+KRGY+ I                      ++I V +    DPLFSK+WY+ NTGQADG   LDLNV  AW  G TGKGVT AIMDDGIDYLHPDL+ NYNAE+SYDFSSNDPYP+PRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRDMQHLTVLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++A+ W  VPERFHC+AG + + ++    + L L I TDAC+      V YLEHVQA V+V +SRRGD+ + +TSPMGT S++LS RP+D D+  GF KWPFMTTHTWGE+PRG W L V F    P S G+  EW L+LHGTQS PY
Sbjct:   37 VQLHEGA-DEDAHQLAVDYGFGSARKLPFGERLFHFYPRDTPKTRRKRSLRHRQRLEKDRRVKNVIAQEGFDRQKRGYRDI----------------------NDIDVSM---NDPLFSKQWYLINTGQADGTPGLDLNVAEAWKMGYTGKGVTIAIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAVSNNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLTVLTSK--RNKLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKLAQDWKTVPERFHCVAGSVQEMHKIQSGEKLSLSISTDACQGKENF-VRYLEHVQAVVTVNASRRGDLNINMTSPMGTKSILLSRRPRDADAKVGFDKWPFMTTHTWGEDPRGTWLLEVGFQGDAPQS-GMLKEWTLMLHGTQSAPY 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Cavefish
Match: furina (furin-1-like [Source:NCBI gene;Acc:103024357])

HSP 1 Score: 409.838 bits (1052), Expect = 3.755e-130
Identity = 255/604 (42.22%), Postives = 352/604 (58.28%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFV-FHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQS 2274
            K+ TN W VH+     +E AN++A++  F    NH N   ++  F H+ V   S       H  L     V  A+Q     R+KR                                    P DP F+++WY+ N+   D      LNV  AW QG+TGKGV  +I+DDGI+  HPDL +NY+ ++SYD +  DP P PRYT    N HGTRCAGE++A  +N ICGVGVAY++KI G+RMLD   +TD +EA ++S +  +IDIYSASWGP DDG+TVDGP      A + GV +GR G GSI+VWASG+GG     CNCDGY  S++T+SI+S+T  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS            +W  NG G + +H +GYG+LDA  +V +AK W NV  +  C+   + +    N+   L++  + D+C       V+ LEH QA +++  +RRG++ ++L SP GT S +L+ RP  D S+ GF  W FMTTH+W E+PRG+W L +  + K  LS  G  +++ L+L+GT S
Sbjct:   28 KVYTNTWAVHI--TGGEEEANRLARKHDFI---NHGNIFGDYYHFRHRRVVKRSLSEHRGTHIRLHREPQVSWAEQQVVKRRKKRDI-------------------------------YSEPADPKFAQQWYLYNSNHRD------LNVKEAWKQGVTGKGVVVSILDDGIEMNHPDLERNYDPDASYDVNDGDPDPQPRYTQLNDNRHGTRCAGEVAAVANNDICGVGVAYNAKIGGVRMLDGE-VTDAVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKDAFLRGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSSTQYGNVPWYSEACSSTLATTYSSGGL---NEKQIITTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSN----PAHLTTDDWRTNGVGRKVSHSYGYGLLDAAAIVALAKNWTNVGPQQKCVLSLVSEPK--NIGSHLVISKNVDSCAGKPNF-VSSLEHAQAQLTLSYNRRGNLAIYLISPQGTRSTLLAGRPH-DYSSEGFNDWAFMTTHSWDEDPRGEWTLEI--ENKAGLSDFGTLTQFTLILYGTAS 575          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Cavefish
Match: furina (furin-1-like [Source:NCBI gene;Acc:103024357])

HSP 1 Score: 409.838 bits (1052), Expect = 3.755e-130
Identity = 255/604 (42.22%), Postives = 352/604 (58.28%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFV-FHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ-GIFSEWVLVLHGTQS 2274
            K+ TN W VH+     +E AN++A++  F    NH N   ++  F H+ V   S       H  L     V  A+Q     R+KR                                    P DP F+++WY+ N+   D      LNV  AW QG+TGKGV  +I+DDGI+  HPDL +NY+ ++SYD +  DP P PRYT    N HGTRCAGE++A  +N ICGVGVAY++KI G+RMLD   +TD +EA ++S +  +IDIYSASWGP DDG+TVDGP      A + GV +GR G GSI+VWASG+GG     CNCDGY  S++T+SI+S+T  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS            +W  NG G + +H +GYG+LDA  +V +AK W NV  +  C+   + +    N+   L++  + D+C       V+ LEH QA +++  +RRG++ ++L SP GT S +L+ RP  D S+ GF  W FMTTH+W E+PRG+W L +  + K  LS  G  +++ L+L+GT S
Sbjct:   28 KVYTNTWAVHI--TGGEEEANRLARKHDFI---NHGNIFGDYYHFRHRRVVKRSLSEHRGTHIRLHREPQVSWAEQQVVKRRKKRDI-------------------------------YSEPADPKFAQQWYLYNSNHRD------LNVKEAWKQGVTGKGVVVSILDDGIEMNHPDLERNYDPDASYDVNDGDPDPQPRYTQLNDNRHGTRCAGEVAAVANNDICGVGVAYNAKIGGVRMLDGE-VTDAVEAQSLSLNPQHIDIYSASWGPEDDGKTVDGPAKLAKDAFLRGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSSTQYGNVPWYSEACSSTLATTYSSGGL---NEKQIITTDLRQKCTDSHTGTSASAPLAAGIIALALEANKNLTWRDMQHLVVRTSN----PAHLTTDDWRTNGVGRKVSHSYGYGLLDAAAIVALAKNWTNVGPQQKCVLSLVSEPK--NIGSHLVISKNVDSCAGKPNF-VSSLEHAQAQLTLSYNRRGNLAIYLISPQGTRSTLLAGRPH-DYSSEGFNDWAFMTTHSWDEDPRGEWTLEI--ENKAGLSDFGTLTQFTLILYGTAS 575          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Cavefish
Match: furinb (furin [Source:NCBI gene;Acc:103043208])

HSP 1 Score: 400.593 bits (1028), Expect = 2.071e-126
Identity = 250/613 (40.78%), Postives = 347/613 (56.61%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEK 2310
            + T+ W VH+     +E A ++A +  F    N     + + F H++V   S       H  L +   V  A+Q     RRKR                                    PTDP F ++WY+ N  + D      L+V  AWAQG TG+GV   I+DDGI+  HPDL++NY+ ++SYD +  DP P PRYT    N HGTRCAGE++A  +NG+CGVGVAY+++I G+RMLD   +TD++EA ++S +  +I IYSASWGP DDG+TVDGP      A ++GV +GR G GSI+VWASG+GG     CNCDGY  S++T+SI+S T  G    Y E+CSSTLA+T+S+G      +  + T DL  +CT  H+GTSA+AP AAG+ ALALEAN N+ WRDMQHL V TS            +W  NG G   +H +GYG+LDA  MV +A+ W +V  +  C+   + +    +V   L+     +AC       V+ LEHVQA +++  S RG++ + L SP+GT S +L  RP+ D+S  GF  W FMTTH W E+PRG+W L +  +       G+ S++ L L+GT S   D  +S   K
Sbjct:   29 LYTDSWAVHIR--GGEEEAQRIAHKHNFIYHGNVFG--DYYHFQHRSVVKRSLSGHRGVHVRLQSEPQVVWAEQQVAKRRRKRDI-------------------------------YSEPTDPKFPQQWYLYNPNRRD------LHVKEAWAQGFTGRGVVITILDDGIEKDHPDLAQNYDPDASYDVNDRDPDPQPRYTQLNDNRHGTRCAGEVAAAANNGVCGVGVAYNARIGGVRMLDGE-VTDVVEAQSLSLNLQHIHIYSASWGPEDDGKTVDGPAKLAKEAFLQGVTEGRGGLGSIFVWASGNGGREKDSCNCDGYTNSIYTLSISSTTQYGNVPWYSEACSSTLATTYSSGNL---NEKQIVTTDLRKKCTDSHTGTSASAPLAAGIIALALEANMNLTWRDMQHLVVRTSH----PAHLITSDWRTNGVGRLVSHSYGYGLLDASAMVALARNWSSVGPQHKCVIDMLTEPR--DVRNHLMFSKSVEACSGQPDF-VSSLEHVQARLTLSYSHRGNLAIHLISPLGTRSTLLHPRPQ-DNSAEGFNDWAFMTTHAWDEDPRGEWTLEIE-NVAGLSDYGVLSQFTLFLYGTGSSATDLSASDFSK 587          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Cavefish
Match: pcsk5a (proprotein convertase subtilisin/kexin type 5a [Source:ZFIN;Acc:ZDB-GENE-060531-130])

HSP 1 Score: 389.808 bits (1000), Expect = 1.839e-121
Identity = 240/609 (39.41%), Postives = 341/609 (55.99%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXX-XXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMF--DTKDPLSQGIFSEWVLVLHGTQSRPYDK 2289
            ++ TN+W V +     QE+A+ +A++ GF  +       + + F H      S+V S   H       L+    +VE +++++  ++ +K+  R                    +    L  DP +S  WYI      D     D+N+ + W +G TG GV  +I+DDG++ LHPDL +NY+A +S+D + ND  P PRY     N HGTRCAG ++A  +N +C VG+AY+++I G+RMLD   MTD++EA ++S  +  IDIYS+SWGP DDG+TVDGP      A+  G+ KGRKG+GSI+VWASG+GG   D         S++TIS+ S T  G    Y E CSSTLA+T+S+G+   S   G+ T DL  +CT  HSGTSA+AP AAG+ AL LEAN  + WRD+QH+ V TS+           +W  NGAG + +HL+G+G++DA  MV+ A+ W  VP +  C    +      +  K L L   +  C +     V Y+EHV   V++   RRGD+++ LTSP GT S +L+ RP +D ST GF KW FMTTH WGE   G W L +      K     G   EW LV +GT S PY +
Sbjct:   28 RLFTNRWAVRIR--GGQENADLIAEKYGFLNMGQIGGLKDHYNFLHPGGMKRSTVESRGNHS------LISTESEVE-WIQQQMVHRRVKRTERAS------------------QTHSTLFNDPKWSSMWYI----HCDHNCLTDMNIKAVWRRGYTGNGVVVSILDDGVERLHPDLKQNYDARASHDVNGNDSDPTPRYDATNENKHGTRCAGVVAAAANNSLCMVGIAYNARIGGVRMLDGD-MTDMVEAQSLSLRQQYIDIYSSSWGPDDDGKTVDGPGPLARLALENGIRKGRKGRGSIFVWASGNGGQRKDHCSCDGYTNSIFTISLGSTTQSGRKPWYLEECSSTLATTYSSGE---SQGLGIVTTDLRQRCTDEHSGTSASAPIAAGIIALTLEANPLLTWRDVQHIIVKTSR----RGHLSAPDWQSNGAGYDVSHLYGFGLMDAEAMVKEAETWREVPTQHVCEERTVQNARVISPEKVLRLLYKSSGCSAQRTQHVAYVEHVIIRVTITHPRRGDLSIALTSPAGTKSQLLALRP-NDHSTDGFVKWEFMTTHCWGEKAAGDWILEIRDSPSLKRNTRPGKLMEWALVFYGTSSHPYQR 596          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Sea Lamprey
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 254.218 bits (648), Expect = 1.472e-77
Identity = 169/350 (48.29%), Postives = 206/350 (58.86%), Query Frame = 1
Query: 1354 KGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVL-----TSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLS-------QGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            +GR GKGS+YVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+     +AGV T DLYG CTL HSGTSAAAPEAAGVFALA+EA   + W      +V       S+ +           T + A   F      G L       + K+        H  A + +          L+L +DTDAC+    H V YLEHVQ  V+V ++RRGD+T+ LTSPMGT S++L  RP+D DS  GF +WPFMTTHTWGE+PRG+W L V F               G+ SEW L+LHGT S PY  +   +     KL + +RQ       +
Sbjct:    1 QGRGGKGSVYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-KDPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALAIEAK-GVEWLHNTSASVSLLPHSRSQSHPETAPCIARRTTTSDANRAFFVTKSRGFLGICHDFHLQKQPTT-----HLTAFRGEDVCAVPGQGRLVLTVDTDACEGRADH-VRYLEHVQVVVTVNATRRGDLTLNLTSPMGTRSLLLGRRPRDSDSRVGFHRWPFMTTHTWGEDPRGRWTLEVGFADGAEGPAAAAAARSGVLSEWTLMLHGTHSPPY--VGQVVHDSGSKLAMSRRQELEQELGE 340          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Sea Lamprey
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:ZFIN;Acc:ZDB-GENE-090608-1])

HSP 1 Score: 145.591 bits (366), Expect = 2.341e-38
Identity = 72/144 (50.00%), Postives = 92/144 (63.89%), Query Frame = 1
Query: 1933 LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLS-------QGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQ 2343
            L+L +DTDAC+    H V YLEHVQ  V+V ++RRGD+T+ LTSPMGT S++L  RP+D DS  GF +WPFMTTHTWGE+PRG+W L V F               G+ SEW L+LHGT S PY  +   +     KL + +RQ
Sbjct:  215 LVLTVDTDACEGRADH-VRYLEHVQVVVTVNATRRGDLTLNLTSPMGTRSLLLGRRPRDSDSRVGFHRWPFMTTHTWGEDPRGRWTLEVGFADGAEGPAAAAAARSGVLSEWTLMLHGTHSPPY--VGQVVHDSGSKLAMSRRQ 355          

HSP 2 Score: 137.502 bits (345), Expect = 1.314e-35
Identity = 87/108 (80.56%), Postives = 94/108 (87.04%), Query Frame = 1
Query: 1354 KGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEAN 1677
            +GR GKGS+YVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+     +AGV T DLYG CTL HSGTSAAAPEAAGVFALA+EAN
Sbjct:    1 QGRGGKGSVYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKK-DPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALAIEAN 107          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Sea Lamprey
Match: pcsk7 (proprotein convertase subtilisin/kexin type 7 [Source:ZFIN;Acc:ZDB-GENE-030131-7293])

HSP 1 Score: 137.117 bits (344), Expect = 3.976e-36
Identity = 100/219 (45.66%), Postives = 135/219 (61.64%), Query Frame = 1
Query:  742 KQGRVPLPTINKKGIPGLGESDNIKVDLKLP-TDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS 1395
            +Q R  L ++ +KG+         +V   LP  DP F K+W+++      G   +DLNV   W +G+TGKGV  A++DDG+++  PDL  NY AE SYD +  D  P P  T D  + HGTRCAGEI+A  +N +CGVG AYDS++AG+R+LD P +TD +EA A +       IYS SWGP DDG+TVDGP      A+  GV  GR+G G+I+V AS
Sbjct:   54 RQHRSVLWSVEQKGLR--------RVKRSLPFNDPKFPKQWHLQRNTHTPG---MDLNVTGVWERGVTGKGVVVAVVDDGVEHTLPDLQSNYCAEGSYDLTDGDQDPRPG-TGDQESRHGTRCAGEIAAVANNSLCGVGAAYDSRVAGIRLLDGP-LTDHMEATAFNTHYQLNHIYSCSWGPDDDGKTVDGPHVLGQSALQRGVVGGRRGFGTIFVVAS 259          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001746.1 (pep scaffold:Pmarinus_7.0:GL481393:30496:45513:1 gene:ENSPMAG00000001582.1 transcript:ENSPMAT00000001746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 1.315e-21
Identity = 42/82 (51.22%), Postives = 58/82 (70.73%), Query Frame = 1
Query:  832 PTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTD 1077
            PTDP +  +WY+ N+   D      LNVL+AW+QG++G+GV  +I+DDGI+  HPDL  NY+  +SYD +SNDP P PRYT+
Sbjct:  115 PTDPKYLLQWYLHNSVHHD------LNVLAAWSQGVSGRGVVVSILDDGIEKNHPDLVSNYDPMASYDVNSNDPDPQPRYTE 190          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Yeast
Match: KEX2 (Kexin, a subtilisin-like protease (proprotein convertase); a calcium-dependent serine protease involved in the activation of proproteins of the secretory pathway [Source:SGD;Acc:S000005182])

HSP 1 Score: 311.227 bits (796), Expect = 7.860e-94
Identity = 194/509 (38.11%), Postives = 290/509 (56.97%), Query Frame = 1
Query:  742 KQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHG 2265
            K+  VP P ++   +P     D + ++     DPLF ++W++ N          D+NVL  W   ITG GV  AI+DDG+DY + DL  N+ AE S+DF+ N   P PR +DD+   HGTRCAGEI+A++ N  CGVGV Y++KI+G+R+L     T+  EAA++ Y  D  DIYS SWGP DDGR + GP +   +A+V+GV +GR  KG+IYV+AS   G   D+CN DGY  S+++I+I +  +      Y E CS+ +A T+S+G   +     + + D+ G+C+  H GTSAAAP AAGV+ L LEAN N+ WRD+Q+L++L++      +++   +W  +  G +++H +G+G +DA  ++ ++K W NV  +       +      N T+  +  + T + KS        +EHV   V + +  RG  T+ L SP G  S +   RP+ D S+ GF  W FM+   WGEN  G WK+ V   T +   +  F  W L L G
Sbjct:  108 KRLPVPAPPMDSSLLPVKEAEDKLSIN-----DPLFERQWHLVNPS----FPGSDINVLDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY---HGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTE-DEAASLIYGLDVNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSEGCSAVMAVTYSSGSGEY-----IHSSDINGRCSNSHGGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSA---VGLEKNADGDWRDSAMGKKYSHRYGFGKIDAHKLIEMSKTWENVNAQTWFYLPTLYVSQSTNSTEETLESVITISEKSLQDANFKRIEHVTVTVDIDTEIRGTTTVDLISPAGIISNLGVVRPR-DVSSEGFKDWTFMSVAHWGENGVGDWKIKVK--TTENGHRIDFHSWRLKLFG 592          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Nematostella
Match: EDO47748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT1])

HSP 1 Score: 423.705 bits (1088), Expect = 2.827e-138
Identity = 256/607 (42.17%), Postives = 355/607 (58.48%), Query Frame = 1
Query:  472 KIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAK--KWVNVPERFHCIAGQIDKRYR-FNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            ++ TN W +H++     E A +VA+  GF  +         +   H + P  S   +  +   L  H  V   +Q    +R KRG+   +   R  +P                        DPL+  +WY+ +  +     DLD++V+  W +GI+GKGV   I+DDGI++ H DL KNY+  +S+D +  D  PFPRY     N HGTRCAGE++AE +N  CGVGVA++++I G+RMLD   +TD +EA ++S +   IDIYSASWGP+DDG TV+GP      A + G+ KGR G GSI+VWAS   G   D CNCDGY  S++T+SI+SA++ GE+  Y ESCSSTLA+TFS+G      +  + T DL+  CT  H+GTSA+AP AAG+FALALE N  + WRDMQH+ V TS            +W+ NG  L  N  FG+G+L A  +V +A    +V VPE+  C  GQI++  + F   K L +++    C S  G  + YLEHVQ  VS+   RRGD+ ++LTSPMGT S +LS R K+D S  GF+KWPFMTTH+WGE+PRG W L +     +  + G   EW L+LHGT+ +P
Sbjct:   39 RVYTNGWAIHVN--GGIEEAKEVAKAHGFEKVEPIGTLEGYYHLEHPSHPSRSRRSAEDRTDQLRQHRHVTWVEQQHEKVREKRGFYHDRMVARGIVPRFK---------------------DPLWDAQWYLDDKRKD---TDLDIHVIPVWKKGISGKGVVVTILDDGIEHNHTDLIKNYDPNASWDVNDGDNDPFPRYDPTNENKHGTRCAGEVAAEANNTKCGVGVAFNARIGGVRMLDG-RVTDKVEAESLSLNPQYIDIYSASWGPSDDGATVEGPGTLATAAFLNGIQKGRGGLGSIFVWASGNGGRHGDSCNCDGYTDSIYTLSISSASDHGESPWYSESCSSTLATTFSSGA---HGEKRIVTTDLHNTCTERHTGTSASAPLAAGIFALALEVNPKLTWRDMQHIVVHTSN---HLPLKHDQDWSKNGIDLMVNRKFGFGLLVAEKIVDMANPATYVTVPEKRFC-RGQINQDAKVFKWDKPLTIQLPATGC-SGTGDEIRYLEHVQLMVSLDYVRRGDLVIYLTSPMGTKSCLLSPR-KEDSSNEGFSKWPFMTTHSWGEDPRGTWTLEIKDLGDNKANHGTLREWQLILHGTKDKP 609          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Nematostella
Match: EDO47326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RME4])

HSP 1 Score: 405.216 bits (1040), Expect = 2.016e-131
Identity = 251/619 (40.55%), Postives = 340/619 (54.93%), Query Frame = 1
Query:  457 YVVCGK-IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXX-XXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAK--KWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSS 2301
            +V+  K + TN W ++      QE  + +A + GF   R+       ++  H+                 L    V  AKQ +   R+KRG+                                    DPLF+ +WY+ N GQ  G K LD+NVL  W + ITGK V   I+DDGI+Y HPDL +NY+ E+SYD++  D  PFPRY+ D  N HGTRCAGE++A + N  CGVGVAY+++I G+RMLD   +TD++E  ++S     IDIYS+SWGP DDGRTVDGP     RA  +G+ KGR+G GSI+VWA+G+GG  +  CNCDGY  S++TISI +  + G++  Y E+C STL  T+S+G+     D  + T DL+ +CT  H+GTSAAAP AAG+FAL LEAN  + WRD+QHL V TSK            W  NGAG   N+ +G+GVLD+  +V +A+  KW    E+  C                L L +D   C S   + V  LEHV+ +V+++  RRG I++ L SP GT S +L  R K D S  GF  WPFMT  +W ENP GKWKL V        + G F  W +   GT  RP   +++S
Sbjct:   20 FVLASKPLYTNTWVIYTD--KGQEYVDNLAAKHGFKSHRDGGGLEGFYILEHQRTSKRMRRSLVHHSTNFLRDPHVSYAKQQKILRRQKRGF-----------------------------------VDPLFNDQWYLNNYGQTPGPKGLDINVLPVWRKNITGKNVVVTILDDGIEYTHPDLQQNYDKEASYDYNHYDSDPFPRYSPDNINKHGTRCAGEVAAIK-NTHCGVGVAYNARIGGIRMLDGD-VTDIVEGKSLSLKTGYIDIYSSSWGPDDDGRTVDGPGPMAKRAFRDGIKKGRRGLGSIFVWATGNGGRYNDYCNCDGYITSIYTISIGAINDKGKSPWYAENCPSTLGVTYSSGQT-NGPDLQIVTTDLHHKCTKEHTGTSAAAPLAAGIFALVLEANPKLTWRDLQHLVVNTSK----KTDAGDSEWITNGAGHHVNNKYGFGVLDSAALVELAQSPKWRTAEEQHVCREPGSSSSQEIPKNGELTLTLDATGC-SGKSNCVTRLEHVRVYVTLRHDRRGAISIVLISPSGTRSDLLKQRSK-DFSNNGFKNWPFMTVFSWNENPVGKWKLVVR---NHASTAGTFDRWFIKFFGTCQRPRKNITAS 589          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Nematostella
Match: EDO38852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU1])

HSP 1 Score: 388.652 bits (997), Expect = 6.292e-125
Identity = 235/586 (40.10%), Postives = 322/586 (54.95%), Query Frame = 1
Query:  481 TNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXX-XXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQ--IDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQ 2229
            TN W V +  P  ++   ++++  GF+++    N    +   H  V  ++   +  +   LL    V+ A+Q +  L R R                 K GI               PTDP+F++ WY+ NTGQ  G   +D+NV+  W +GITG+GV   ++DDG+D+ HPDL  NY   +S+DF+ ND  P PR  D   N HGTRCAGEI+A  ++ ICG GVAY++KI G+RMLD    TD +EA ++ +     D+YS  WGP DDG+T   P     +A+  G  KGR GKG+I+VWA+G+GG  DD         S++T+SI    + G +A Y E CSSTLA TF+ G      +  + T DL G+CT    GTS+AAP AAG+ AL LE N ++ WRD+QH+ V T+K            W  NGAGL FNH FG+G LDA  MV  ++ W NVP +  C              V  +L ++I T  C   I   +N+LEHV   VS    RRGD+++ LTSP GT + +LS R + DDS  G  KW FMT H WGENPRG WKL V+    +PL++
Sbjct:    6 TNTWAVEIEHPFEEKYVREISKRHGFTIIGKIGNLKGHYHLRHDDVDELNKEHNRDKTDRLLLEDNVRWAEQ-QKILHRVR-----------------KDGI---------------PTDPMFTEMWYLMNTGQTGGPVGVDINVIPVWKRGITGRGVVVTVLDDGMDHNHPDLKPNYEPCASHDFNDNDQDPAPRDIDP-DNCHGTRCAGEIAAVANDSICGAGVAYNAKIGGVRMLDGK-ATDALEACSLGFANQVTDVYSNCWGPKDDGKTFGKPGPLAAKALKSGAEKGRGGKGNIFVWATGNGGLTDDDCNCDGYTTSIYTVSIGCIGDHGLSAYYTELCSSTLAVTFNGGAHREKEENKMITTDLKGKCTEQFKGTSSAAPLAAGMVALMLEQNPSLTWRDVQHIIVHTAK----MTSPVDDGWRTNGAGLHFNHKFGFGRLDADAMVEKSRVWKNVPVQRTCTGASSVTGDEKDIPVGGSLDIQIPTGGCMGTIA-EINHLEHVVLTVSFIHRRRGDVSLLLTSPSGTKNEMLSTR-RYDDSKEGLDKWSFMTVHCWGENPRGFWKLNVI---DNPLNE 547          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Nematostella
Match: EDO32292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH1])

HSP 1 Score: 377.481 bits (968), Expect = 8.137e-123
Identity = 219/465 (47.10%), Postives = 300/465 (64.52%), Query Frame = 1
Query:  838 DPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPER---FHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP 2220
            DPLF ++W++       G +  D +VL  W  G+ GK V  +I+DDGI+Y H DL +NY+  +SYDF+SND  P PRYT +  N HGTRCAGE++A+ +N +CGVGVA  +K+ G+RMLD   +TD +EA ++S +  +IDIYSASWGP DDG+TVDGP     +A  +G+ KGR GKGSIYVWAS   G  +D+CNCDGY  S++T+SI+S T  G +  Y E+CSSTLAS FS+G +W   +  + TVD+  +CT  H+GTSA+AP AAG+ A+ALE N N+ WRDMQH+ V T   + L+  D       NG G   +H FGYG+LDA  +V++A+ W  VP +   F  I  +I          AL +  +   C +   + + YLEHV+  +S+ S +RGDI+++LTSP GT S +L  R + D+S  GF  W FMTTH+W ENP G W L + F+ K P
Sbjct:    1 DPLFEEQWHLA------GYEAFDHHVLPVWQMGVYGKDVVVSILDDGIEYTHDDLKENYDKLASYDFNSNDADPAPRYTWNDENRHGTRCAGEVAAQMNNSVCGVGVAPKAKVGGVRMLDGD-VTDAVEAGSLSLNPQHIDIYSASWGPDDDGKTVDGPARLARKAFTDGIEKGRGGKGSIYVWASGNGGRTSDNCNCDGYTNSIYTLSISSVTEIGNSPWYSEACSSTLASAFSSG-SWN--NRKIVTVDVRNRCTKTHTGTSASAPLAAGILAMALEVNRNLTWRDMQHIVVRTCTMDKLNMHDV----VTNGVGRLVSHTFGYGLLDATRLVKLARVWRTVPPQRVSFLFIYRKIPD------DGALTVRTEATGC-TGTANEIRYLEHVECIISLDSVKRGDISIYLTSPRGTRSTLLGKRIR-DNSQNGFHDWAFMTTHSWEENPTGTWTLEI-FNEKTP 442          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Nematostella
Match: EDO38851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBU0])

HSP 1 Score: 371.318 bits (952), Expect = 4.480e-118
Identity = 232/588 (39.46%), Postives = 326/588 (55.44%), Query Frame = 1
Query:  475 IVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXX-XXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGI 2235
            + TN W V L D A  E+A+++A + GF+ L   + S   + +H K V      P     + L  H   +   Q +  L  +R +   + +  +                        +P DP F  +WY+ N GQ+ G   +D++V+ AW + ITG+GV  +I+DDG+D+ HPDL  N++ ++SYDF+  DP P PR +D   N HGTRCAGE++A  +N +CGVGVAY++ I G+RMLD    TD++E +++S+    IDIYS  WGP DDG+T   P      A+++G  KGR G+G+IYVWA+G+GG  DD         S++TISI    + G +A Y E CSSTL  TF+ G      +  + T DL+ +CT    GTS+AAP AAG+ AL LEAN N+ WRD+QHL V T++            W  NGAG  FNH FG+G LDA  MV+ AK W +V  +  C       +        L + IDT AC S     +  LEHV   VS +  RRGD+++ L SP GT + +LS R + DDS  G   W FMT H WGENP+G+W + V  D    L++G+
Sbjct:    1 MFTNSWAVQL-DSAEVEAADRIAAKHGFTNL-GQVGSLKGY-YHFKHV----HKPGNRARRELHVHEKTRLLMQEDEVLWAQRQHVLARTRKYI------------------------VPHDPKFHDQWYLFNDGQSTGPAGVDIDVVPAWNRNITGRGVVVSILDDGVDHTHPDLRDNFDQKASYDFNDMDPDPRPRDSDP-DNCHGTRCAGEVAAA-NNDVCGVGVAYNANIGGVRMLDG-QATDVLEGSSLSFQSAYIDIYSNCWGPKDDGKTFGKPGKLAQEALMQGALKGRGGRGNIYVWATGNGGLTDDDCNCDGYTTSIYTISIGCIGDHGLSAYYTELCSSTLGVTFNGGSHREREENKMVTTDLHHKCTEEFKGTSSAAPLAAGMIALVLEANPNLSWRDVQHLVVETAQ----VTSPVDEGWMKNGAGYHFNHKFGFGRLDADAMVKRAKTWKSVAPQRICHGPSSSTQQEIPTGGTLSITIDTIAC-SGTDKMLTKLEHVTLTVSFQHRRRGDVSIDLFSPSGTRNEMLSTR-RYDDSKNGLHDWTFMTVHNWGENPKGEWVMNVT-DNLSALNKGV 547          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Medaka
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100049241])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 369/615 (60.00%), Postives = 446/615 (72.52%), Query Frame = 1
Query:  439 LLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            LLF  E      ++T    V LH+ A Q+ A+++A + GF   R        F F+ +      S  S    + L  +  VKN  + EGF R+KRGY+ I                      ++I+V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT AIMDDGIDYLHPDL+ NYNA++SYDFSSNDP+PFPRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRDMQHL+VLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK+W  VPERFHC+AG I + ++      L+L I+T+AC+    + V YLEHVQA V+V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW ++LHGTQS PY
Sbjct:   20 LLFATE--AAEGVLTEHLLVQLHEDA-QDEAHQLAAQHGFQSARKLPFGDGLFHFYPQDTSKRRSKRSARIKQWLQNNRRVKNVIEQEGFRRQKRGYRNI----------------------NDIEVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLASNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPHKIQSGNKLVLAINTEACEGK-DNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFQGDQP-QRGVLKEWTVMLHGTQSAPY 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Medaka
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100049241])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 369/615 (60.00%), Postives = 446/615 (72.52%), Query Frame = 1
Query:  439 LLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            LLF  E      ++T    V LH+ A Q+ A+++A + GF   R        F F+ +      S  S    + L  +  VKN  + EGF R+KRGY+ I                      ++I+V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT AIMDDGIDYLHPDL+ NYNA++SYDFSSNDP+PFPRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRDMQHL+VLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK+W  VPERFHC+AG I + ++      L+L I+T+AC+    + V YLEHVQA V+V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW ++LHGTQS PY
Sbjct:   20 LLFATE--AAEGVLTEHLLVQLHEDA-QDEAHQLAAQHGFQSARKLPFGDGLFHFYPQDTSKRRSKRSARIKQWLQNNRRVKNVIEQEGFRRQKRGYRNI----------------------NDIEVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLASNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPHKIQSGNKLVLAINTEACEGK-DNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFQGDQP-QRGVLKEWTVMLHGTQSAPY 601          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Medaka
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100049241])

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 354/563 (62.88%), Postives = 423/563 (75.13%), Query Frame = 1
Query:  595 FVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            F F+ +      S  S    + L  +  VKN  + EGF R+KRGY+ I                      ++I+V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT AIMDDGIDYLHPDL+ NYNA++SYDFSSNDP+PFPRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRDMQHL+VLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK+W  VPERFHC+AG I + ++      L+L I+T+AC+    + V YLEHVQA V+V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW ++LHGTQS PY
Sbjct:    9 FHFYPQDTSKRRSKRSARIKQWLQNNRRVKNVIEQEGFRRQKRGYRNI----------------------NDIEVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLASNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPHKIQSGNKLVLAINTEACEGK-DNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFQGDQP-QRGVLKEWTVMLHGTQSAPY 541          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Medaka
Match: pcsk2 (proprotein convertase subtilisin/kexin type 2 [Source:NCBI gene;Acc:100049241])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 356/615 (57.89%), Postives = 429/615 (69.76%), Query Frame = 1
Query:  439 LLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPY 2283
            LLF  E      ++T    V LH+ A Q+ A+++A + GF   R                                    VKN  + EGF R+KRGY+ I                      ++I+V++   +DPLF+K+WY+ NTGQADG   LDLNV  AW  G TGKGVT AIMDDG   L   L+   NA++SYDFSSNDP+PFPRYTDDWFNSHGTRCAGE+SA  +N ICGVGVAY+SK+AG+RMLDQP+MTD+IEA+++S+    IDIYSASWGPTDDG+TVDGPR  T++A+ +GVNKGR GKGSIYVWASGDGG+ DDCNCDGYA+SMWTISINSA NDG TA YDESCSSTLASTFSNG+   + +AGV T DLYG CTL HSGTSAAAPEAAGVFALALEAN N+ WRDMQHL+VLTSK       D  H W  NG GLEFNHLFGYGVLDAG MV++AK+W  VPERFHC+AG I + ++      L+L I+T+AC+    + V YLEHVQA V+V ++RRGD+ + +TSPMGT S++LS RP+DDDS  GF KWPFMTTHTWGE+PRG W L V F    P  +G+  EW ++LHGTQS PY
Sbjct:   20 LLFATE--AAEGVLTEHLLVQLHEDA-QDEAHQLAAQHGFQSARK-----------------------------------VKNVIEQEGFRRQKRGYRNI----------------------NDIEVNM---SDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGEWRLVVTLT---NADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK-RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK--RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEPHKIQSGNKLVLAINTEACEGK-DNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSLLLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFQGDQP-QRGVLKEWTVMLHGTQSAPY 563          
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Medaka
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:NCBI gene;Acc:101174018])

HSP 1 Score: 424.091 bits (1089), Expect = 3.490e-136
Identity = 247/605 (40.83%), Postives = 364/605 (60.17%), Query Frame = 1
Query:  484 NQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVA--KKWVNVPERFHCIAGQIDKRYRFNVTKA---LILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRP 2280
            N+W V +  P    +A  +A+E  + ++R      + ++  H+  PH              A H+ +   + +  L  ++ Y+  +          NK+ +  + E  +  VD KL  DP+++++WY+++T  +  +  LDL+V+  W +GITGKGV   ++DDG+++ H D+  NY+A +SYDF+ NDP PFPRY     N HGTRCAGEI+ + DN  CGVGVAY+SK+ G+RMLD   +TD IEA+++ ++ +++DIYSASWGP DDG+TV+GP     +A   G+ KGR GKGSI+VWAS   G   D+C+CDGY  S++TISI+SA+  G +  Y E CSSTLA+ +S+G      D  + + DL+ +CT  H+GTSA+AP AAG+FALALE N N+ WRD+QH+ V TS+            W  NGAGL  N  FG+G+L+A  +V +A    W +VPE+  CI    D  ++    KA   + +EI T AC     + V  LEH+Q   S++ +RRGD+ + LTSP GTT+++L+ R + D S  GF  W FM+ HTWGE+P G W L +   +    ++G    W L+LHGT  +P
Sbjct:   35 NEWAVEI--PGGLSAAEAIARELDYELVRQIGALDDHYLLKHRRHPH---------RMKRSADHITRQLSEDDRVLWAEQQYEKRR----------NKRAV--IRECRDCSVD-KLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYSNYDAAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGGIRMLDG-IVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY---TDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPNLTWRDLQHIIVWTSE---FDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPATWKHVPEKKICIVR--DDSFQPRELKAAGEITIEIPTKACAGQ-ENAVRSLEHLQVEASIEYTRRGDLHITLTSPAGTTTVLLAERER-DTSANGFRNWDFMSVHTWGEDPAGTWTLKITDTSGRMENKGRILSWKLILHGTSEKP 604          
BLAST of TPA_inf: prohormone convertase 2 vs. Planmine SMEST
Match: SMESG000008070.1 (SMESG000008070.1)

HSP 1 Score: 1283.47 bits (3320), Expect = 0.000e+0
Identity = 649/649 (100.00%), Postives = 649/649 (100.00%), Query Frame = 1
Query:  421 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 2367
            MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ
Sbjct:    1 MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLRNHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRKRGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ 649          
BLAST of TPA_inf: prohormone convertase 2 vs. Planmine SMEST
Match: SMESG000049794.1 (SMESG000049794.1)

HSP 1 Score: 379.022 bits (972), Expect = 1.523e-120
Identity = 222/510 (43.53%), Postives = 314/510 (61.57%), Query Frame = 1
Query:  811 IKVDLKLPTDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSSNDPYPFPRY-----TDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWAS-XXXXXXXXXXXXXXXXSMWTISINSATNDGETASYDESCSSTLASTFSNGKAWFSLDA-GVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHC--IAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVM-FDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSSSLEK 2310
            ++V   +  DP + K WY+         K+  +N++SAW +G  G+ V  +I+DDGI+  HPDL +NY+  +SYD  SND  P PRY     T    N HGTRCAG+++A  +N ICGVGVAY + I G+RMLD   ++D +E+ ++     +IDIYSASWGP DDG+TVDGP      A  +G+ KGR G GSI+VWAS   G   D+CNCDGY  S++T+ +N+ +  G+   Y E CSSTLA T+S+G    S+D   + T D+  +CT  HSGTSA+AP AAG+ ALAL AN  + WRDMQHL V+T++        R  +W+ N AG E++H FG+G++DAG MV +A  W  VPE+  C  +A               +L I TDAC  +   RV YLEHVQA +S++S++RG++ ++L SP  +TS +L+ R ++D ++ GF  WPFM+ H WGE   G WKLT+  +D +  L       W L+L+GT + P  + +S+  K
Sbjct:   99 VRVKRHIVNDPKWYKMWYLNKMN-----KENSMNIISAWKKGYRGQNVVVSILDDGIEKDHPDLKENYDPNASYDIISNDNNPEPRYISSNNTKIKDNHHGTRCAGQVAATANNRICGVGVAYKANIGGIRMLDGE-VSDSVESHSLRLFYQHIDIYSASWGPEDDGKTVDGPGELAKIAFEDGILKGRNGLGSIFVWASGNGGKNHDNCNCDGYTNSIFTLGVNAVSEIGDAPWYAEKCSSTLAVTYSSG----SMDERAIITTDVNHECTEQHSGTSASAPFAAGICALALSANRFLTWRDMQHLVVITAR----KANLRAVDWSTNAAGKEYSHSFGFGLMDAGAMVDLALNWTTVPEQHICHYVAPMQGGPISLKPYANEVLSITTDACSDNSKKRVRYLEHVQAKISLRSTKRGEVELWLISPSRSTSKLLTKR-RNDVASAGFHHWPFMSVHFWGEEAPGTWKLTIYSYDAEVTLIN-----WSLILYGTDTLPSHRQNSTHTK 588          
BLAST of TPA_inf: prohormone convertase 2 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 348.977 bits (894), Expect = 6.550e-110
Identity = 203/495 (41.01%), Postives = 297/495 (60.00%), Query Frame = 1
Query:  835 TDPLFSKEWYIRNTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRG---FTKWPFMTTHTWGENPRGKWKLTV-MFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSS 2298
            +DPLF K+WY+  +      K +D+NV  AW  G TGKGVT +I+DDGIDY H DL +NY+ E+S+D +   NDP P  + T+   N HGTRCAGE+SA+ +N  CGVG+AY+S+I  +RMLD   +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP      A  +G+  GR G G+IYVWASG+GG   D       AS       S+ ++      Y ESC+STLAST+S+G  +   +  + + DL  +C   H+GTSA+AP AAG+ AL +EANSN+ WRD+Q++ VLTS            N+ +NGA  + ++L+G+G++D+G +VR+ + W  +P    C      K+        + L + TD C     ++VNY+EHV  ++ +   +RGD+ + L SP GT S IL +RP   D  RG   F  WP M+   WGE   G+W + +  + TK   S G++S + L ++GT+  P   +S+
Sbjct:    9 SDPLFKKQWYLIRS--QFNTKLVDMNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 486          
BLAST of TPA_inf: prohormone convertase 2 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 333.569 bits (854), Expect = 1.670e-104
Identity = 194/471 (41.19%), Postives = 283/471 (60.08%), Query Frame = 1
Query:  907 LNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRG---FTKWPFMTTHTWGENPRGKWKLTV-MFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSS 2298
            +NV  AW  G TGKGVT +I+DDGIDY H DL +NY+ E+S+D +   NDP P  + T+   N HGTRCAGE+SA+ +N  CGVG+AY+S+I  +RMLD   +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP      A  +G+  GR G G+IYVWASG+GG   D       AS       S+ ++      Y ESC+STLAST+S+G  +   +  + + DL  +C   H+GTSA+AP AAG+ AL +EANSN+ WRD+Q++ VLTS            N+ +NGA  + ++L+G+G++D+G +VR+ + W  +P    C      K+        + L + TD C     ++VNY+EHV  ++ +   +RGD+ + L SP GT S IL +RP   D  RG   F  WP M+   WGE   G+W + +  + TK   S G++S + L ++GT+  P   +S+
Sbjct:    1 MNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 456          
BLAST of TPA_inf: prohormone convertase 2 vs. Planmine SMEST
Match: SMESG000018546.1 (SMESG000018546.1)

HSP 1 Score: 333.569 bits (854), Expect = 1.929e-104
Identity = 194/471 (41.19%), Postives = 283/471 (60.08%), Query Frame = 1
Query:  907 LNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNAESSYDFSS--NDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDSKIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRNETMRAIVEGVNKGRKGKGSIYVWASXXXXXXXXXXXXXXXXSMWTISINSATNDGETAS-YDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSGTSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKXXXXXXXXXXXXWTINGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFNVTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPMGTTSMILSHRPKDDDSTRG---FTKWPFMTTHTWGENPRGKWKLTV-MFDTKDPLSQGIFSEWVLVLHGTQSRPYDKLSS 2298
            +NV  AW  G TGKGVT +I+DDGIDY H DL +NY+ E+S+D +   NDP P  + T+   N HGTRCAGE+SA+ +N  CGVG+AY+S+I  +RMLD   +TD +EA A+S+ + +IDIYS SWGP D+G+ V+GP      A  +G+  GR G G+IYVWASG+GG   D       AS       S+ ++      Y ESC+STLAST+S+G  +   +  + + DL  +C   H+GTSA+AP AAG+ AL +EANSN+ WRD+Q++ VLTS            N+ +NGA  + ++L+G+G++D+G +VR+ + W  +P    C      K+        + L + TD C     ++VNY+EHV  ++ +   +RGD+ + L SP GT S IL +RP   D  RG   F  WP M+   WGE   G+W + +  + TK   S G++S + L ++GT+  P   +S+
Sbjct:    1 MNVKEAWELGYTGKGVTISILDDGIDYRHDDLKENYDPEASFDINGDDNDPLPNLKSTE---NRHGTRCAGEVSAKANNSKCGVGIAYNSRIGAVRMLDGD-VTDRVEAEALSFKQQHIDIYSGSWGPDDNGQKVEGPAILAKSAFKKGIRYGRNGLGNIYVWASGNGGKKSDSCACDGYASSIYTISISSVSENNRKPWYLESCASTLASTYSSGDGY---EQKIISTDLNNKCAFDHTGTSASAPLAAGIIALLIEANSNLTWRDVQYIIVLTSN----PHPFIDGNFIVNGANKKVSNLYGFGLMDSGKLVRIGRLWHKLPSHHFCKISYNGKKISLKDKFTVKLSVKTDGCPGK--NKVNYVEHVILYLKLDYDKRGDLRIILISPSGTRSEILPYRPH--DFARGPSTFDIWPLMSVQFWGEKASGEWSVEINNYGTKFSKSNGVWSNFELKIYGTEKWPIRLISA 456          
The following BLAST results are available for this feature:
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCSK20.000e+060.03proprotein convertase subtilisin/kexin type 2 [Sou... [more]
PCSK20.000e+060.03proprotein convertase subtilisin/kexin type 2 [Sou... [more]
PCSK20.000e+059.20proprotein convertase subtilisin/kexin type 2 [Sou... [more]
PCSK13.779e-13640.70proprotein convertase subtilisin/kexin type 1 [Sou... [more]
PCSK15.603e-13346.33proprotein convertase subtilisin/kexin type 1 [Sou... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-30.000e+055.20Neuroendocrine convertase 2 [Source:UniProtKB/Swi... [more]
egl-30.000e+063.12Neuroendocrine convertase 2 [Source:UniProtKB/Swi... [more]
egl-30.000e+063.12Neuroendocrine convertase 2 [Source:UniProtKB/Swi... [more]
kpc-13.413e-13242.45Furin-like protease kpc-1 [Source:UniProtKB/Swiss... [more]
kpc-13.413e-13242.45Furin-like protease kpc-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amon0.000e+060.38gene:FBgn0023179 transcript:FBtr0085048[more]
Fur28.920e-13042.22gene:FBgn0004598 transcript:FBtr0301301[more]
Fur21.359e-12741.32gene:FBgn0004598 transcript:FBtr0074263[more]
Fur21.359e-12741.32gene:FBgn0004598 transcript:FBtr0074261[more]
Fur21.359e-12741.32gene:FBgn0004598 transcript:FBtr0074265[more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk20.000e+060.43proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk19.573e-14141.56proprotein convertase subtilisin/kexin type 1 [Sou... [more]
pcsk11.084e-14041.56proprotein convertase subtilisin/kexin type 1 [Sou... [more]
furina9.170e-13642.95furin (paired basic amino acid cleaving enzyme) a ... [more]
furina9.170e-13642.95furin (paired basic amino acid cleaving enzyme) a ... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk20.000e+059.22proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+060.20proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+059.22proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+060.20proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+064.93proprotein convertase subtilisin/kexin type 2 [Sou... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcsk20.000e+057.69proprotein convertase subtilisin/kexin type 2 [Sou... [more]
Pcsk11.133e-13840.77proprotein convertase subtilisin/kexin type 1 [Sou... [more]
Furin6.700e-13242.88furin (paired basic amino acid cleaving enzyme) [S... [more]
Furin6.700e-13242.88furin (paired basic amino acid cleaving enzyme) [S... [more]
Furin6.700e-13242.88furin (paired basic amino acid cleaving enzyme) [S... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28841|NEC2_RAT0.000e+056.74Neuroendocrine convertase 2 OS=Rattus norvegicus O... [more]
sp|Q5REC2|NEC2_PONAB0.000e+060.20Neuroendocrine convertase 2 OS=Pongo abelii OX=960... [more]
sp|P16519|NEC2_HUMAN0.000e+060.03Neuroendocrine convertase 2 OS=Homo sapiens OX=960... [more]
sp|G5ECN9|NEC2_CAEEL0.000e+055.20Neuroendocrine convertase 2 OS=Caenorhabditis eleg... [more]
sp|P21661|NEC2_MOUSE0.000e+057.69Neuroendocrine convertase 2 OS=Mus musculus OX=100... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3CTL80.000e+0100.00Prohormone convertase 2 OS=Schmidtea mediterranea ... [more]
A0A267GYL10.000e+067.48P/Homo B domain-containing protein OS=Macrostomum ... [more]
A0A183K2T70.000e+067.19P/Homo B domain-containing protein OS=Schistosoma ... [more]
A0A095C5E10.000e+066.05Neuroendocrine convertase 2 OS=Schistosoma haemato... [more]
A0A267GWD60.000e+067.28P/Homo B domain-containing protein OS=Macrostomum ... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk20.000e+061.58proprotein convertase subtilisin/kexin type 2 [Sou... [more]
furina3.755e-13042.22furin-1-like [Source:NCBI gene;Acc:103024357][more]
furina3.755e-13042.22furin-1-like [Source:NCBI gene;Acc:103024357][more]
furinb2.071e-12640.78furin [Source:NCBI gene;Acc:103043208][more]
pcsk5a1.839e-12139.41proprotein convertase subtilisin/kexin type 5a [So... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pcsk21.472e-7748.29proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk22.341e-3850.00proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk73.976e-3645.66proprotein convertase subtilisin/kexin type 7 [Sou... [more]
ENSPMAT00000001746.11.315e-2151.22pep scaffold:Pmarinus_7.0:GL481393:30496:45513:1 g... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KEX27.860e-9438.11Kexin, a subtilisin-like protease (proprotein conv... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477482.827e-13842.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473262.016e-13140.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388526.292e-12540.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322928.137e-12347.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388514.480e-11839.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcsk20.000e+060.00proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+060.00proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+062.88proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk20.000e+057.89proprotein convertase subtilisin/kexin type 2 [Sou... [more]
pcsk13.490e-13640.83proprotein convertase subtilisin/kexin type 1 [Sou... [more]
back to top
BLAST of TPA_inf: prohormone convertase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008070.10.000e+0100.00SMESG000008070.1[more]
SMESG000049794.11.523e-12043.53SMESG000049794.1[more]
SMESG000018546.16.550e-11041.01SMESG000018546.1[more]
SMESG000018546.11.670e-10441.19SMESG000018546.1[more]
SMESG000018546.11.929e-10441.19SMESG000018546.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010096
GenBankDAA33932.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010096 ID=SMED30010096|Name=TPA_inf: prohormone convertase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2542bp
CTTTGTTTGTAACCAGACTGAAACTGGATATTGTTGTCATAAAAAAATGA
AAATTTTGAACCAATTAAATTCCATTGAGTAACTGAAAACAAGATAAAAA
CTAGGAAAATCGTTTTTATCGTGAACGAACAAACAAAACAGATCATTCAT
TGTGCCCCTTTACAATTCATTCTCACTTTGCCCTTGTGTCTGTGCGTGTG
TGTACGCGCGCGCGTGATGACGTCAGCACAAATAATTGATGCTCCTGAAG
AAATAATATCGATCGATTCTCTCACCGAGTCCAGAGCATGCATATTATTT
CTGCAAACATAAAGAATTATGTGTAGGTGGGATGCAGATAAAATACAAAC
AACGACTTTCTATAAAATTTCTGGAAAATTTCTATCGAATCTACTTTTTC
ATTAGATTTGCTATTTTTAGATGAAGATTACATGGATCCTTTTGTTTCTA
TGCGAATATGTAGTTTGTGGAAAAATTGTCACCAATCAATGGCATGTCCA
CCTTCATGATCCTGCAACTCAAGAATCGGCAAATAAAGTAGCTCAGGAAA
CTGGTTTCTCGGTCTTACGAAACCATCTGAATTCTCCAAATGAATTTGTT
TTCCATCACAAAACCGTTCCTCACGTTAGTTCAGTTCCAAGTTGGAGTCA
ACACAAAGTTCTATTGGCTCACCATCTTGTTAAAAACGCAAAACAAGTTG
AAGGGTTTTTGAGACGAAAGAGAGGCTATAAGCCAATTAAAAAACAAGGT
CGTGTCCCACTGCCAACGATTAATAAAAAAGGAATTCCCGGCCTGGGAGA
GTCTGACAACATTAAAGTGGATTTGAAATTACCTACTGATCCTCTATTTT
CTAAAGAATGGTACATCAGAAATACCGGTCAAGCTGATGGAGTGAAAGAT
CTTGATCTTAATGTATTATCAGCGTGGGCTCAAGGTATAACCGGCAAAGG
GGTCACGACTGCAATCATGGATGATGGAATAGACTATCTTCACCCGGATT
TATCAAAAAATTATAACGCAGAAAGCAGTTATGATTTCAGTAGCAATGAC
CCTTACCCGTTCCCTCGATATACTGACGATTGGTTTAACAGTCACGGAAC
AAGATGTGCCGGTGAGATTTCCGCCGAACGTGATAATGGCATTTGTGGTG
TTGGAGTGGCATACGATTCCAAAATCGCTGGGTTGCGCATGCTAGATCAA
CCATATATGACAGATCTCATTGAGGCAGCAGCTATGAGTTATGATCGAGA
CAATATTGACATTTACTCTGCTAGCTGGGGACCCACGGATGATGGAAGAA
CTGTAGATGGGCCGAGAAATGAAACGATGCGCGCTATTGTTGAAGGTGTA
AATAAGGGACGCAAAGGCAAAGGAAGCATTTACGTTTGGGCATCTGGTGA
CGGTGGAGCAGCTGACGATTGTAATTGCGATGGATATGCTGCCAGCATGT
GGACAATAAGTATTAATTCAGCAACCAATGATGGAGAAACCGCAAGCTAT
GATGAATCCTGTTCTTCAACACTTGCGTCGACATTTTCTAATGGTAAGGC
ATGGTTTAGCCTTGACGCCGGTGTCGGAACTGTGGATTTATATGGCCAAT
GTACTCTACATCATTCGGGAACTTCTGCTGCTGCTCCAGAAGCAGCTGGA
GTGTTTGCTCTTGCTCTTGAAGCCAATTCGAATATTGGCTGGAGAGATAT
GCAGCATTTGACAGTGCTTACGAGTAAACGAAATCATTTGCATGACAGAG
ATCGACGCCATAATTGGACCATTAATGGAGCGGGTTTGGAATTCAATCAT
CTTTTTGGATACGGAGTACTCGATGCTGGTGACATGGTCCGAGTTGCTAA
AAAGTGGGTGAATGTACCAGAACGATTTCACTGCATTGCCGGACAAATCG
ATAAGCGTTATCGATTCAATGTAACAAAAGCTTTAATATTGGAAATTGAT
ACTGACGCGTGCAAATCAGATATAGGTCATCGAGTGAATTATCTTGAGCA
TGTCCAGGCTTTTGTTTCAGTTAAATCTAGTCGACGAGGAGACATAACAA
TGTTTTTAACGAGCCCCATGGGTACGACTTCTATGATTCTCAGCCATCGA
CCAAAGGATGACGATTCCACAAGAGGATTCACCAAATGGCCATTTATGAC
CACTCATACATGGGGAGAAAACCCTCGCGGAAAATGGAAACTGACAGTAA
TGTTCGACACGAAAGATCCATTAAGTCAAGGAATATTTTCTGAATGGGTG
CTCGTGCTTCATGGAACACAGAGTCGACCCTATGACAAATTGTCTAGTTC
ACTAGAGAAAATCATTCCTAAACTCGGTGTAGTAAAGAGACAACATGCCT
CTAACAGATTTTCACAATAGTTGTTGAACTTGATCTTTATTTAGTATTGA
TAATATTTTTTGTCTTTGACCGCGACTAAGCAGTGCTACTGCAGATTTTG
TGATCGTATTTTTGTAAACTTTTGTCCAGTAAGATTGTCGTATCTTATTG
TTATTATTAATTTCACTATCATTTCATCAACAGGATTAATAA
back to top

protein sequence of SMED30010096-orf-1

>SMED30010096-orf-1 ID=SMED30010096-orf-1|Name=SMED30010096-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=650bp
MKITWILLFLCEYVVCGKIVTNQWHVHLHDPATQESANKVAQETGFSVLR
NHLNSPNEFVFHHKTVPHVSSVPSWSQHKVLLAHHLVKNAKQVEGFLRRK
RGYKPIKKQGRVPLPTINKKGIPGLGESDNIKVDLKLPTDPLFSKEWYIR
NTGQADGVKDLDLNVLSAWAQGITGKGVTTAIMDDGIDYLHPDLSKNYNA
ESSYDFSSNDPYPFPRYTDDWFNSHGTRCAGEISAERDNGICGVGVAYDS
KIAGLRMLDQPYMTDLIEAAAMSYDRDNIDIYSASWGPTDDGRTVDGPRN
ETMRAIVEGVNKGRKGKGSIYVWASGDGGAADDCNCDGYAASMWTISINS
ATNDGETASYDESCSSTLASTFSNGKAWFSLDAGVGTVDLYGQCTLHHSG
TSAAAPEAAGVFALALEANSNIGWRDMQHLTVLTSKRNHLHDRDRRHNWT
INGAGLEFNHLFGYGVLDAGDMVRVAKKWVNVPERFHCIAGQIDKRYRFN
VTKALILEIDTDACKSDIGHRVNYLEHVQAFVSVKSSRRGDITMFLTSPM
GTTSMILSHRPKDDDSTRGFTKWPFMTTHTWGENPRGKWKLTVMFDTKDP
LSQGIFSEWVLVLHGTQSRPYDKLSSSLEKIIPKLGVVKRQHASNRFSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000025nervous system
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0000232copulatory apparatus
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000467submuscular nerve plexus
PLANA:0000478pharynx musculature
PLANA:0002056medial muscle cell
PLANA:0004519embryonic pharynx neuron
PLANA:0000023embryonic pharynx
PLANA:0000058embryonic digestive system
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
Vocabulary: INTERPRO
TermDefinition
IPR036852Peptidase_S8/S53_dom_sf
IPR038466S8_pro-domain_sf
IPR034182Kexin/furin
IPR015500Peptidase_S8_subtilisin-rel
IPR032815S8_pro-domain
IPR000209Peptidase_S8/S53_dom
IPR002884P_dom
IPR008979Galactose-bd-like_sf
IPR023827Peptidase_S8_Asp-AS
IPR023828Peptidase_S8_Ser-AS
IPR022398Peptidase_S8_His-AS
IPR009020Propept_inh
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015500Peptidase S8, subtilisin-relatedPRINTSPR00723SUBTILISINcoord: 399..415
score: 60.03
coord: 175..194
score: 46.32
coord: 221..234
score: 50.58
IPR032815Peptidase S8, pro-domainPFAMPF16470S8_pro-domaincoord: 23..101
e-value: 5.8E-13
score: 49.4
IPR000209Peptidase S8/S53 domainPFAMPF00082Peptidase_S8coord: 175..452
e-value: 3.1E-42
score: 144.9
IPR036852Peptidase S8/S53 domain superfamilyGENE3DG3DSA:3.40.50.200coord: 140..477
e-value: 5.8E-83
score: 280.9
IPR036852Peptidase S8/S53 domain superfamilySUPERFAMILYSSF52743Subtilisin-likecoord: 137..479
IPR002884P domainPFAMPF01483P_proproteincoord: 525..612
e-value: 8.3E-24
score: 83.4
IPR002884P domainPROSITEPS51829P_HOMO_Bcoord: 481..619
score: 43.647
IPR038466Peptidase S8, pro-domain superfamilyGENE3DG3DSA:3.30.70.850coord: 16..101
e-value: 1.1E-7
score: 34.2
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 480..616
e-value: 3.3E-41
score: 141.9
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 473..621
NoneNo IPR availablePANTHERPTHR42884FAMILY NOT NAMEDcoord: 8..645
NoneNo IPR availablePANTHERPTHR42884:SF13NEUROENDOCRINE CONVERTASE 2coord: 8..645
NoneNo IPR availablePROSITEPS51892SUBTILASEcoord: 146..473
score: 39.537
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.78
NoneNo IPR availableSUPERFAMILYSSF54897Protease propeptides/inhibitorscoord: 21..92
IPR022398Peptidase S8, subtilisin, His-active sitePROSITEPS00137SUBTILASE_HIScoord: 225..235
IPR023827Peptidase S8, subtilisin, Asp-active sitePROSITEPS00136SUBTILASE_ASPcoord: 180..191
IPR023828Peptidase S8, subtilisin, Ser-active sitePROSITEPS00138SUBTILASE_SERcoord: 400..410
IPR034182Kexin/furin catalytic domainCDDcd04059Peptidases_S8_Protein_convertases_Kexins_Furin-likecoord: 138..436
e-value: 1.01698E-164
score: 471.274