SMED30010090

Overview
NameSMED30010090
Smed IDSMED30010090
Length (bp)614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010090 (SMED30010090) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010090 (SMED30010090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010090 (SMED30010090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010090 (SMED30010090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30010090h1SMcG0009289 dd_Smed_v4_1448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010090h1SMcG0009289 dd_Smed_v4_1448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010090 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002734:19258..20044 -2913
Homology
BLAST of SMED30010090 vs. Ensembl Human
Match: COPZ1 (coatomer protein complex subunit zeta 1 [Source:HGNC Symbol;Acc:HGNC:2243])

HSP 1 Score: 166.007 bits (419), Expect = 8.890e-52
Identity = 90/175 (51.43%), Postives = 132/175 (75.43%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. Ensembl Human
Match: COPZ1 (coatomer protein complex subunit zeta 1 [Source:HGNC Symbol;Acc:HGNC:2243])

HSP 1 Score: 164.466 bits (415), Expect = 4.154e-51
Identity = 90/174 (51.72%), Postives = 131/174 (75.29%), Query Frame = -3
Query:   49 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 570
            EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:   15 EPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 185          
BLAST of SMED30010090 vs. Ensembl Human
Match: COPZ2 (coatomer protein complex subunit zeta 2 [Source:HGNC Symbol;Acc:HGNC:19356])

HSP 1 Score: 154.451 bits (389), Expect = 7.899e-47
Identity = 83/172 (48.26%), Postives = 127/172 (73.84%), Query Frame = -3
Query:   55 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNL 570
            EP+LYTIKA+ ILDN+G+R+++KY+D+  FPS K ++ FE  +F+KTS+   +EI  F G T VY+N++DLF YV+G  YENEL+L + L CL++S++ +L+ NVEK+ LLE +D   L LDE+ DGG+++ESD   +  +V  + ++  L EQ++ QV++SA+EQ+K S L
Sbjct:   40 EPSLYTIKAVFILDNDGRRLLAKYYDD-TFPSMKEQMVFEKNVFNKTSRT-ESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRKNVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLL 209          
BLAST of SMED30010090 vs. Ensembl Human
Match: COPZ1 (coatomer protein complex subunit zeta 1 [Source:HGNC Symbol;Acc:HGNC:2243])

HSP 1 Score: 154.066 bits (388), Expect = 8.851e-47
Identity = 90/196 (45.92%), Postives = 132/196 (67.35%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILK---------------------HNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +  + EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+                      NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHRTDS-EIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRTGSTQAGGLHESSSRQAWATQKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 198          
BLAST of SMED30010090 vs. Ensembl Human
Match: COPZ1 (coatomer protein complex subunit zeta 1 [Source:HGNC Symbol;Acc:HGNC:2243])

HSP 1 Score: 151.754 bits (382), Expect = 2.487e-46
Identity = 81/160 (50.62%), Postives = 119/160 (74.38%), Query Frame = -3
Query:   94 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQV 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQV 163          
BLAST of SMED30010090 vs. Ensembl Celegans
Match: copz-1 (Probable coatomer subunit zeta [Source:UniProtKB/Swiss-Prot;Acc:O17901])

HSP 1 Score: 152.91 bits (385), Expect = 5.787e-47
Identity = 84/183 (45.90%), Postives = 125/183 (68.31%), Query Frame = -3
Query:   55 IVKFQMEPT-LYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQV----IKSAREQLKLSNL 588
            +  F   PT LY+IK I+ILD +G R+++KY+D   F + K +  FE  LFSKTS+  +A+I+L +G TC+YR+NVDL+FYV+G   ENEL L   L CLYD++  +L+ NVEKK L++ +D I+L +DE+CD GI+ME+D+ ++  R  +K +E    +Q++ Q+    +KSA EQ K S L
Sbjct:    1 MADFDTNPTSLYSIKGIVILDQDGNRVLAKYYDRTTFGTVKEQKAFEKSLFSKTSRNTSADILLLDGVTCLYRSNVDLYFYVLGSTRENELFLDATLTCLYDAVSVVLRKNVEKKALIDSMDTIMLIIDEICDEGIIMETDAQAVVQRTALKSDEVSFSDQSVSQIGFSFMKSANEQFKWSLL 183          
BLAST of SMED30010090 vs. Ensembl Fly
Match: zetaCOP (gene:FBgn0040512 transcript:FBtr0075352)

HSP 1 Score: 160.229 bits (404), Expect = 7.703e-50
Identity = 87/164 (53.05%), Postives = 125/164 (76.22%), Query Frame = -3
Query:   61 IKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 552
            IK + I+DN+G RI++KY+D     + K +  FE  LF+KT +  T EII+ +G TCVY++NVDLFFYV+G+ YENEL+L + L CLYDSI  ILK NVEK+ +LE L++I+LA DE+CDGGI++++D +S+  RV ++ ++ P+ EQT+ QV++SAREQLK S
Sbjct:    9 IKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNT-EIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVLQSAREQLKWS 171          
BLAST of SMED30010090 vs. Ensembl Fly
Match: zetaCOP (gene:FBgn0040512 transcript:FBtr0075351)

HSP 1 Score: 156.762 bits (395), Expect = 1.157e-48
Identity = 85/159 (53.46%), Postives = 122/159 (76.73%), Query Frame = -3
Query:   61 ILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 537
            I+DN+G RI++KY+D     + K +  FE  LF+KT +  T EII+ +G TCVY++NVDLFFYV+G+ YENEL+L + L CLYDSI  ILK NVEK+ +LE L++I+LA DE+CDGGI++++D +S+  RV ++ ++ P+ EQT+ QV++SAREQLK S
Sbjct:    3 IMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNT-EIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVLQSAREQLKWS 160          
BLAST of SMED30010090 vs. Ensembl Fly
Match: zetaCOP (gene:FBgn0040512 transcript:FBtr0075353)

HSP 1 Score: 144.05 bits (362), Expect = 1.419e-43
Identity = 79/153 (51.63%), Postives = 115/153 (75.16%), Query Frame = -3
Query:   94 IKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQV 552
            IK + I+DN+G RI++KY+D     + K +  FE  LF+KT +  T EII+ +G TCVY++NVDLFFYV+G+ YENEL+L + L CLYDSI  ILK NVEK+ +LE L++I+LA DE+CDGGI++++D +S+  RV ++ ++ P+ EQT+ QV
Sbjct:    9 IKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNT-EIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQV 160          
BLAST of SMED30010090 vs. Ensembl Zebrafish
Match: copz1 (coatomer protein complex, subunit zeta 1 [Source:ZFIN;Acc:ZDB-GENE-000406-6])

HSP 1 Score: 162.925 bits (411), Expect = 2.163e-50
Identity = 86/175 (49.14%), Postives = 134/175 (76.57%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KA+LI+DN+G+R+ +KY+D+  +P+ K +  FE  +F+KT +   +EI L EG T VY++N+DL+FYVIG  +ENEL+L + L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ ++ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:   27 LEPSLYTVKAVLIMDNDGERLYAKYYDD-TYPTVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSNIDLYFYVIGSSHENELMLMSVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGDDVPLTEQTVTQVLQSAKEQIKWS-LLR 198          
BLAST of SMED30010090 vs. Ensembl Zebrafish
Match: copz2 (coatomer protein complex, subunit zeta 2 [Source:ZFIN;Acc:ZDB-GENE-000406-5])

HSP 1 Score: 160.614 bits (405), Expect = 6.851e-50
Identity = 81/171 (47.37%), Postives = 124/171 (72.51%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 573
            +EP+LYT+KA+ ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL+DS+ Q+L+ NVEK+ LL+ +D + L +DE+ DGG+++ESD   +  +V  + ++ PL EQ++ QV++SA+EQ+K S
Sbjct:    1 LEPSLYTVKAVFILDNDGNRLLSKYYDAELYPSMKEQKNFEKNVFNKTHKADN-EIAFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFDSLSQMLRKNVEKRTLLDNMDGVFLVVDEIIDGGVILESDPQQVMEKVNYRADDNPLSEQSVAQVLQSAKEQIKWS 170          
BLAST of SMED30010090 vs. Ensembl Zebrafish
Match: copz2 (coatomer protein complex, subunit zeta 2 [Source:ZFIN;Acc:ZDB-GENE-000406-5])

HSP 1 Score: 152.525 bits (384), Expect = 1.866e-46
Identity = 81/182 (44.51%), Postives = 124/182 (68.13%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQ-----------VIKSAREQLKLS 573
            +EP+LYT+KA+ ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL+DS+ Q+L+ NVEK+ LL+ +D + L +DE+ DGG+++ESD   +  +V  + ++ PL EQ++ Q           V++SA+EQ+K S
Sbjct:    6 LEPSLYTVKAVFILDNDGNRLLSKYYDAELYPSMKEQKNFEKNVFNKTHKADN-EIAFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFDSLSQMLRKNVEKRTLLDNMDGVFLVVDEIIDGGVILESDPQQVMEKVNYRADDNPLSEQSVAQHITEKLALTTNVLQSAKEQIKWS 186          
BLAST of SMED30010090 vs. Ensembl Zebrafish
Match: copz2 (coatomer protein complex, subunit zeta 2 [Source:ZFIN;Acc:ZDB-GENE-000406-5])

HSP 1 Score: 147.132 bits (370), Expect = 1.723e-44
Identity = 75/160 (46.88%), Postives = 114/160 (71.25%), Query Frame = -3
Query:   94 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQV 573
            +EP+LYT+KA+ ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL+DS+ Q+L+ NVEK+ LL+ +D + L +DE+ DGG+++ESD   +  +V  + ++ PL EQ++ QV
Sbjct:    6 LEPSLYTVKAVFILDNDGNRLLSKYYDAELYPSMKEQKNFEKNVFNKTHKADN-EIAFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFDSLSQMLRKNVEKRTLLDNMDGVFLVVDEIIDGGVILESDPQQVMEKVNYRADDNPLSEQSVAQV 164          
BLAST of SMED30010090 vs. Ensembl Xenopus
Match: copz1 (coatomer protein complex subunit zeta 1 [Source:NCBI gene;Acc:394893])

HSP 1 Score: 161.384 bits (407), Expect = 4.277e-50
Identity = 86/175 (49.14%), Postives = 133/175 (76.00%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            M+P+LYT+KA+LILDN+G+R+ +KY+D + +P+ K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  +ENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ ++ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    1 MDPSLYTVKAVLILDNDGERLFAKYYD-ETYPTVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSHENELMLMAVLNCLFDSLSQMLRKNVEKRTLLENMEGLFLAVDEIIDGGVILESDPQQVVHRVALRGDDVPLTEQTVSQVLQSAKEQIKWS-LLR 172          
BLAST of SMED30010090 vs. Ensembl Xenopus
Match: copz1 (coatomer protein complex subunit zeta 1 [Source:NCBI gene;Acc:394893])

HSP 1 Score: 159.458 bits (402), Expect = 3.460e-49
Identity = 85/174 (48.85%), Postives = 132/174 (75.86%), Query Frame = -3
Query:   49 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 570
            +P+LYT+KA+LILDN+G+R+ +KY+D + +P+ K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  +ENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ ++ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    7 DPSLYTVKAVLILDNDGERLFAKYYD-ETYPTVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSHENELMLMAVLNCLFDSLSQMLRKNVEKRTLLENMEGLFLAVDEIIDGGVILESDPQQVVHRVALRGDDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. Ensembl Xenopus
Match: COPZ2 (coatomer protein complex subunit zeta 2 [Source:NCBI gene;Acc:100379766])

HSP 1 Score: 77.411 bits (189), Expect = 2.276e-17
Identity = 55/150 (36.67%), Postives = 96/150 (64.00%), Query Frame = -3
Query:  121 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETP 570
            +P+LYT+KA +ILD++G+R+++KY+ + A+PS   +  FE ++F ++ K    E++L +  T + +   D+  Y+IG  +ENELLL  AL C+ +S+  +L+ +V++  LLE +D   L LDE+ D G+++ESD   +  R+  K    P
Sbjct:    9 DPSLYTVKAFIILDHDGRRLLAKYYGD-AYPSLAEQQEFEKQIFRRSYKADN-EVLLVDSVTALCQKLSDITCYIIGGPHENELLLLAALTCICESLCHMLRKHVDRSSLLENMDTAFLVLDEIIDQGVILESDYQQVVQRLSFKTISEP 156          
BLAST of SMED30010090 vs. Ensembl Xenopus
Match: COPZ2 (coatomer protein complex subunit zeta 2 [Source:NCBI gene;Acc:100379766])

HSP 1 Score: 63.929 bits (154), Expect = 7.216e-13
Identity = 30/83 (36.14%), Postives = 56/83 (67.47%), Query Frame = -3
Query:  322 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENE 570
            +P+LYT+KA +ILD++G+R+++KY+ + A+PS   +  FE ++F ++ K    E++L +  T + +   D+  Y+IG  +ENE
Sbjct:    2 DPSLYTVKAFIILDHDGRRLLAKYYGD-AYPSLAEQQEFEKQIFRRSYKADN-EVLLVDSVTALCQKLSDITCYIIGGPHENE 82          
BLAST of SMED30010090 vs. Ensembl Mouse
Match: Copz1 (coatomer protein complex, subunit zeta 1 [Source:MGI Symbol;Acc:MGI:1929063])

HSP 1 Score: 166.007 bits (419), Expect = 6.104e-52
Identity = 90/175 (51.43%), Postives = 132/175 (75.43%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. Ensembl Mouse
Match: Copz1 (coatomer protein complex, subunit zeta 1 [Source:MGI Symbol;Acc:MGI:1929063])

HSP 1 Score: 151.754 bits (382), Expect = 1.708e-46
Identity = 81/160 (50.62%), Postives = 119/160 (74.38%), Query Frame = -3
Query:   94 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQV 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQV 163          
BLAST of SMED30010090 vs. Ensembl Mouse
Match: Copz2 (coatomer protein complex, subunit zeta 2 [Source:MGI Symbol;Acc:MGI:1929008])

HSP 1 Score: 151.369 bits (381), Expect = 9.050e-46
Identity = 82/174 (47.13%), Postives = 125/174 (71.84%), Query Frame = -3
Query:   55 QMEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNL 576
            Q EP+LYTIKA+ ILDN+G+R+++KY+D+  FPS K ++ FE  +F+KTS+   +EI    G T VY++++D+F YV+G   ENEL+L + L CL+DS+  IL+ NVEK+ LLE +D   L LDE  DGG+++ESD   +  +V  + +++ L EQ++ QV++SA+EQ+K S L
Sbjct:   33 QREPSLYTIKAVFILDNDGRRLLAKYYDD-TFPSVKEQMVFEKNVFNKTSRT-ESEIAFLGGMTIVYKSSIDIFLYVVGSSSENELMLMSVLACLFDSLSHILRKNVEKRWLLENMDGAFLVLDETVDGGVILESDPQQVIQKVNFRTDDSGLTEQSVAQVLQSAKEQIKWSLL 204          
BLAST of SMED30010090 vs. Ensembl Mouse
Match: Copz1 (coatomer protein complex, subunit zeta 1 [Source:MGI Symbol;Acc:MGI:1929063])

HSP 1 Score: 59.3066 bits (142), Expect = 1.491e-11
Identity = 26/50 (52.00%), Postives = 39/50 (78.00%), Query Frame = -3
Query:  424 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSK 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR 54          
BLAST of SMED30010090 vs. UniProt/SwissProt
Match: sp|P35604|COPZ1_BOVIN (Coatomer subunit zeta-1 OS=Bos taurus OX=9913 GN=COPZ1 PE=1 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 3.548e-51
Identity = 90/175 (51.43%), Postives = 132/175 (75.43%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMTVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. UniProt/SwissProt
Match: sp|Q5R5F2|COPZ1_PONAB (Coatomer subunit zeta-1 OS=Pongo abelii OX=9601 GN=COPZ1 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.269e-51
Identity = 90/175 (51.43%), Postives = 132/175 (75.43%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. UniProt/SwissProt
Match: sp|P61924|COPZ1_MOUSE (Coatomer subunit zeta-1 OS=Mus musculus OX=10090 GN=Copz1 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.269e-51
Identity = 90/175 (51.43%), Postives = 132/175 (75.43%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. UniProt/SwissProt
Match: sp|P61923|COPZ1_HUMAN (Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.269e-51
Identity = 90/175 (51.43%), Postives = 132/175 (75.43%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KAILILDN+G R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY++++DL+FYVIG  YENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ E+ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAILILDNDGDRLFAKYYDD-TYPSVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. UniProt/SwissProt
Match: sp|Q9P299|COPZ2_HUMAN (Coatomer subunit zeta-2 OS=Homo sapiens OX=9606 GN=COPZ2 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.793e-46
Identity = 83/172 (48.26%), Postives = 127/172 (73.84%), Query Frame = -3
Query:   55 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNL 570
            EP+LYTIKA+ ILDN+G+R+++KY+D+  FPS K ++ FE  +F+KTS+   +EI  F G T VY+N++DLF YV+G  YENEL+L + L CL++S++ +L+ NVEK+ LLE +D   L LDE+ DGG+++ESD   +  +V  + ++  L EQ++ QV++SA+EQ+K S L
Sbjct:   40 EPSLYTIKAVFILDNDGRRLLAKYYDD-TFPSMKEQMVFEKNVFNKTSRT-ESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRKNVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLL 209          
BLAST of SMED30010090 vs. TrEMBL
Match: A0A504YCW6 (Coatomer subunit zeta OS=Fasciola gigantica OX=46835 GN=FGIG_01689 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.137e-60
Identity = 105/171 (61.40%), Postives = 139/171 (81.29%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 573
            +EP+LY+IKAILILD +GKRI+SKY+DN  F S K +L FE++LF KT+K  +AEI L +G TCVYR+  D+FFY++GD+ ENEL+L +AL CLYDS+ QILK  VEKK +L+ LDLI LA+DELC+ GILME D+++L +RVG + E+ PLGEQT+ Q I+SA+EQ+KLS
Sbjct:    3 LEPSLYSIKAILILDGDGKRIVSKYYDN-TFSSAKDQLEFESKLFKKTNKSSSAEITLLDGATCVYRSVSDVFFYILGDIAENELILVSALNCLYDSVSQILKRCVEKKTVLDNLDLIFLAVDELCNNGILMECDASALVARVGTRTEDIPLGEQTVAQAIQSAKEQIKLS 172          
BLAST of SMED30010090 vs. TrEMBL
Match: A0A0X3P8C4 (Coatomer subunit zeta OS=Schistocephalus solidus OX=70667 GN=COPZ1 PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 3.058e-60
Identity = 109/175 (62.29%), Postives = 142/175 (81.14%), Query Frame = -3
Query:   46 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLRG 570
            EPTLY IKAILILD++GKRI++KY+DN  FP+ K++L FE +LFSKT+K   AEI LFEG  CV+R++ D+FFYVIGD  ENEL+L +AL CL+DSI  IL+ N+EKK L++ LDL+ LA+DELCDGGI++E DST+L SRVG K E+  + EQTM Q +++A+EQLK+S LLRG
Sbjct:    6 EPTLYAIKAILILDSDGKRILAKYYDN-TFPTLKAQLDFEKKLFSKTNKTSYAEITLFEGANCVHRSSSDIFFYVIGDANENELILMSALTCLHDSISHILRGNIEKKPLMDNLDLVFLAVDELCDGGIILECDSTALASRVGFKSEDMSISEQTMSQALQAAKEQLKMS-LLRG 178          
BLAST of SMED30010090 vs. TrEMBL
Match: G4V8D5 (Coatomer subunit zeta OS=Schistosoma mansoni OX=6183 GN=Smp_020220.1 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.780e-59
Identity = 104/171 (60.82%), Postives = 139/171 (81.29%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 573
            +EP+LY+I +ILILD+EGKRI++KY+D+ +FPS K +L FE++LF KTSK   AEI L +G TCVYRN  DL+FYV+GD  ENELLL +ALQCLYDS+ Q LK +VEKK L++ LDLI L +DELC  GIL+ESD+T+L SRVG + ++ PLGEQT+ Q I++A+EQ+++S
Sbjct:    3 LEPSLYSINSILILDSEGKRILAKYYDS-SFPSVKLQLEFESKLFKKTSKTNGAEITLLDGATCVYRNVGDLYFYVVGDANENELLLVSALQCLYDSVSQALKRSVEKKTLMDNLDLIFLIVDELCHNGILLESDATALMSRVGARTDDIPLGEQTVAQAIQNAKEQIRMS 172          
BLAST of SMED30010090 vs. TrEMBL
Match: A0A3L8DN81 (Coatomer subunit zeta OS=Ooceraea biroi OX=2015173 GN=DMN91_006278 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 3.128e-59
Identity = 97/171 (56.73%), Postives = 139/171 (81.29%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 573
            +EPTLYT+K + ILDN+G RI++KY+D   FP++K +  FE  LFSKT +   AEII+ +G TCVYR+NVDLFFYV+G  +ENEL+L +AL CLYDS+ QIL+ NVEK+ +L+ LD+++LA+DE+CDGGI++++D+TS+  RV ++ ++ PLGEQT+ QV++SA+EQLK S
Sbjct:    6 LEPTLYTVKGMAILDNDGNRILAKYYDKNVFPTSKEQKAFEKNLFSKTHR-ANAEIIMLDGLTCVYRSNVDLFFYVMGSSHENELILMSALNCLYDSVSQILRKNVEKRAVLDSLDIVMLAMDEICDGGIILDADATSVVQRVALRTDDIPLGEQTVAQVLQSAKEQLKWS 175          
BLAST of SMED30010090 vs. TrEMBL
Match: A0A0R3W9K4 (Coatomer subunit zeta OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7142 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 3.234e-59
Identity = 112/171 (65.50%), Postives = 140/171 (81.87%), Query Frame = -3
Query:   49 LYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 561
            LY IKAIL+LDNEGKRII KY+DN  FPS K++L FE +LFSKT+K   AEI LFEG TCV+R   D++FY+IGDV ENEL+L NAL CL+DSI QIL++N+EKK LL+ LDLI LA+DELCD GI+ME DS++L SRVG+K EET L EQT+ Q +++AREQ+K++ LLR
Sbjct:    9 LYAIKAILLLDNEGKRIIVKYYDN-TFPSLKAQLDFEKKLFSKTNKSAYAEITLFEGTTCVHRTTSDIYFYIIGDVNENELMLMNALTCLHDSITQILRNNLEKKTLLDNLDLIYLAVDELCDEGIIMECDSSALASRVGIKPEETSLSEQTVTQAMQAAREQIKMA-LLR 177          
BLAST of SMED30010090 vs. Ensembl Cavefish
Match: copz2 (coatomer subunit zeta-1 [Source:NCBI gene;Acc:103037899])

HSP 1 Score: 159.844 bits (403), Expect = 1.192e-49
Identity = 81/171 (47.37%), Postives = 125/171 (73.10%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 573
            ++P+LYT+KAI ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL++S++QIL+ NVE++ LL+ +D + L +DE+ DGG+++ESD   +  +V  K ++ PL EQ++ QV++SA+EQ+K S
Sbjct:    6 LQPSLYTVKAIFILDNDGNRLLSKYYDPELYPSMKEQKNFEKNVFNKTHKTDN-EITFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFESLNQILRKNVERRSLLDNMDGVFLVVDEIVDGGVILESDPQQVVEKVNFKADDNPLSEQSVAQVLQSAKEQIKWS 175          
BLAST of SMED30010090 vs. Ensembl Cavefish
Match: copz2 (coatomer subunit zeta-1 [Source:NCBI gene;Acc:103037899])

HSP 1 Score: 151.754 bits (382), Expect = 3.274e-46
Identity = 81/182 (44.51%), Postives = 125/182 (68.68%), Query Frame = -3
Query:   61 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQ-----------VIKSAREQLKLS 573
            ++P+LYT+KAI ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL++S++QIL+ NVE++ LL+ +D + L +DE+ DGG+++ESD   +  +V  K ++ PL EQ++ Q           V++SA+EQ+K S
Sbjct:    6 LQPSLYTVKAIFILDNDGNRLLSKYYDPELYPSMKEQKNFEKNVFNKTHKTDN-EITFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFESLNQILRKNVERRSLLDNMDGVFLVVDEIVDGGVILESDPQQVVEKVNFKADDNPLSEQSVAQHITEKLALTTNVLQSAKEQIKWS 186          
BLAST of SMED30010090 vs. Ensembl Cavefish
Match: copz2 (coatomer subunit zeta-1 [Source:NCBI gene;Acc:103037899])

HSP 1 Score: 145.206 bits (365), Expect = 1.625e-43
Identity = 75/159 (47.17%), Postives = 114/159 (71.70%), Query Frame = -3
Query:   94 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQV 570
            +P+LYT+KAI ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL++S++QIL+ NVE++ LL+ +D + L +DE+ DGG+++ESD   +  +V  K ++ PL EQ++ QV
Sbjct:    5 QPSLYTVKAIFILDNDGNRLLSKYYDPELYPSMKEQKNFEKNVFNKTHKTDN-EITFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFESLNQILRKNVERRSLLDNMDGVFLVVDEIVDGGVILESDPQQVVEKVNFKADDNPLSEQSVAQV 162          
BLAST of SMED30010090 vs. Ensembl Cavefish
Match: copz1 (coatomer protein complex, subunit zeta 1 [Source:ZFIN;Acc:ZDB-GENE-000406-6])

HSP 1 Score: 140.969 bits (354), Expect = 4.191e-42
Identity = 82/174 (47.13%), Postives = 126/174 (72.41%), Query Frame = -3
Query:   49 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 570
            EP+LYT+KA+LI+DN+G+R+ +KY+D+  +P+ K +  FE  +F+KT +   +EI L EG T VY++N+DL+FYVIG  +ENEL+L + L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++     L      QV++SA+EQ+K S LLR
Sbjct:   16 EPSLYTVKAVLIMDNDGERLYAKYYDD-TYPTVKEQKAFEKNIFNKTHR-TDSEIALLEGLTVVYKSNIDLYFYVIGSSHENELMLMSVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALR---FSLSLFLCVQVLQSAKEQIKWS-LLR 183          
BLAST of SMED30010090 vs. Ensembl Cavefish
Match: copz2 (coatomer subunit zeta-1 [Source:NCBI gene;Acc:103037899])

HSP 1 Score: 131.724 bits (330), Expect = 1.604e-38
Identity = 73/161 (45.34%), Postives = 111/161 (68.94%), Query Frame = -3
Query:   91 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVI 573
            ++P+LYT+KAI ILDN+G R++SKY+D + +PS K +  FE  +F+KT K    EI   EG T VY++++DLFFYV+G   ENEL+L   L CL++S++QIL+ NVE++ LL+ +D + L +DE+ DGG+++ESD   +  +V  K     + EQ  G V+
Sbjct:    6 LQPSLYTVKAIFILDNDGNRLLSKYYDPELYPSMKEQKNFEKNVFNKTHKTDN-EITFLEGMTIVYKSSIDLFFYVVGSAQENELMLMAVLNCLFESLNQILRKNVERRSLLDNMDGVFLVVDEIVDGGVILESDPQQVVEKVNFK----FVSEQAFGFVL 161          
BLAST of SMED30010090 vs. Ensembl Sea Lamprey
Match: copz1 (coatomer protein complex, subunit zeta 1 [Source:ZFIN;Acc:ZDB-GENE-000406-6])

HSP 1 Score: 154.066 bits (388), Expect = 4.582e-48
Identity = 85/173 (49.13%), Postives = 126/173 (72.83%), Query Frame = -3
Query:   55 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNL 573
            MEP+LYT+KAI+ILDN+G+R+ +KY+D+  +PS K +  FE  +F+KT +   +EI L EG T VY+++VDL+FYVIG   ENEL+L   L CL +S+  + + NVEK+ L+E +D + LA+DE+ DGG+++ESD   +  RV ++ ++ PL EQT+ QV+ SA+EQLK S L
Sbjct:    1 MEPSLYTVKAIIILDNDGERLYAKYYDD-TYPSVKEQKTFEKNIFNKTHRT-DSEIALLEGLTVVYKSSVDLYFYVIGSPQENELMLMTVLSCLVESLGHMFRKNVEKRALMENMDAVFLAVDEIVDGGVVLESDPLQVMQRVSLRSDDIPLTEQTVAQVLYSAKEQLKWSLL 171          
BLAST of SMED30010090 vs. Ensembl Sea Lamprey
Match: copz1 (coatomer protein complex, subunit zeta 1 [Source:ZFIN;Acc:ZDB-GENE-000406-6])

HSP 1 Score: 135.576 bits (340), Expect = 1.189e-40
Identity = 83/184 (45.11%), Postives = 121/184 (65.76%), Query Frame = -3
Query:   55 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTM-----------GQVIKSAREQLKLSNL 573
            MEP+L ++KAI ILD +G+RI SKY+DN    + K    FE  +FSKT +    EI L +G T VY++ VDL FYVIG   ENEL+L   L CL+DS+ Q+L+ N+EK+ +L+ ++ +LLA+DE+ DGG+++ESD   +  RV +K ++  L EQT+           G V++SA+EQ+K S L
Sbjct:    1 MEPSLLSVKAIFILDADGERIFSKYYDNPHL-TVKDEKTFEKNVFSKTQRTEN-EIALLDGLTVVYKSIVDLHFYVIGSSQENELMLVAVLNCLFDSLSQMLRKNLEKRTVLDNMEGVLLAVDEIVDGGVILESDPQQVAQRVALKVDDGSLSEQTVSQQIAQKLGMKGNVLQSAKEQIKWSLL 182          
BLAST of SMED30010090 vs. Ensembl Yeast
Match: RET3 (Zeta subunit of the coatomer complex (COPI); COPI coats Golgi-derived transport vesicles; involved in retrograde transport between Golgi and ER [Source:SGD;Acc:S000005931])

HSP 1 Score: 78.5666 bits (192), Expect = 7.498e-19
Identity = 55/164 (33.54%), Postives = 95/164 (57.93%), Query Frame = -3
Query:  100 TLYTIKAILILDNEGKRIISKYFDNQA---------FPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMG 564
            +LYT++A+LILD +G+RI +KY+             F S K +  FE +L+ KT K   +EI++FE +  +Y+  +D+  Y++  + ENE++L      +  ++  IL   ++KK + E  D++LLA+DE  D G+++E+DS ++ SRV     + P  E  M 
Sbjct:    5 SLYTVQAVLILDQQGERIYAKYYQPPHRSDEGHQLLFNSVKKQKEFEKQLYRKTHK-QDSEILIFEDHLVLYKEYIDITIYLVASLEENEIVLQQGFSAIRGALDLILNSGMDKKNIQENYDMVLLAIDETIDNGVILETDSNTIASRVS----KPPTNEPQMA 163          
BLAST of SMED30010090 vs. Ensembl Nematostella
Match: EDO42487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1D0])

HSP 1 Score: 162.54 bits (410), Expect = 5.632e-51
Identity = 82/172 (47.67%), Postives = 132/172 (76.74%), Query Frame = -3
Query:   61 QMEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLS 576
            Q + +LYT+KAI ILDN+G+R++++Y+D+  +P+ K +  FE  LF+KT +   AEII+ EG TCVYR++VDL+FYV+G   ENEL+L + L   YD++  +L+ NVEK+ L+E LD ++LA+DE+ DGG+++E+DS+++  RV +K ++ P+ EQT+ QV+++A++QLK S
Sbjct:   11 QNDASLYTVKAIAILDNDGERVVARYYDD-TYPTTKEQKEFEKNLFNKTHR-ANAEIIMLEGMTCVYRSSVDLYFYVMGSFNENELVLVSVLNAFYDAVSMMLRKNVEKRSLMESLDAVMLAMDEIVDGGVILEADSSAIVQRVAMKIDDVPITEQTVAQVLQTAKDQLKWS 180          
BLAST of SMED30010090 vs. Ensembl Medaka
Match: copz1 (coatomer protein complex subunit zeta 1 [Source:NCBI gene;Acc:101175157])

HSP 1 Score: 163.696 bits (413), Expect = 3.648e-51
Identity = 88/175 (50.29%), Postives = 133/175 (76.00%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KA+LILDN+G+R+ +KY+D+  +P+ K +  FE  +F+KT +   +EI L EG T VY++N+DLFFYVIG  +ENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+++ESD   +  RV ++ ++ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    6 LEPSLYTVKAVLILDNDGERLYAKYYDD-TYPTVKEQKAFEKNIFNKTHRT-DSEIALLEGLTVVYKSNIDLFFYVIGSSHENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGDDVPLTEQTVTQVLQSAKEQIKWS-LLR 177          
BLAST of SMED30010090 vs. Ensembl Medaka
Match: copz2 (coatomer subunit zeta-1-like [Source:NCBI gene;Acc:105354657])

HSP 1 Score: 154.066 bits (388), Expect = 2.313e-47
Identity = 81/172 (47.09%), Postives = 123/172 (71.51%), Query Frame = -3
Query:   55 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNL 570
            EP+LYT+KA+ ILDN+G R++SKY+D + +PS K +  FE+ +F+KT K    EI   EG T VY++++DLFFYV G   ENEL+L + L CL+DS+  IL+ NVE+K LLE ++   L +DE+ DGG+++ESD   +  +V  + ++ PL EQ++ QV++SA++Q+K S L
Sbjct:    7 EPSLYTVKAVFILDNDGNRLLSKYYDPELYPSIKEQRNFESNIFNKTHKADN-EIAFLEGLTIVYKSSIDLFFYVAGSAQENELMLMSVLSCLFDSLTHILRKNVERKCLLENMEGAFLVVDEIIDGGVILESDHQQVLQKVNYRADDNPLTEQSVTQVLQSAKDQIKWSIL 177          
BLAST of SMED30010090 vs. Ensembl Medaka
Match: copz2 (coatomer subunit zeta-1-like [Source:NCBI gene;Acc:105354657])

HSP 1 Score: 145.976 bits (367), Expect = 5.886e-44
Identity = 80/181 (44.20%), Postives = 122/181 (67.40%), Query Frame = -3
Query:   61 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQ-----------VIKSAREQLKLS 570
            EP+LYT+KA+ ILDN+G R++SKY+D + +PS K +  FE+ +F+KT K    EI   EG T VY++++DLFFYV G   ENEL+L + L CL+DS+  IL+ NVE+K LLE ++   L +DE+ DGG+++ESD   +  +V  + ++ PL EQ++ Q           V++SA++Q+K S
Sbjct:    7 EPSLYTVKAVFILDNDGNRLLSKYYDPELYPSIKEQRNFESNIFNKTHKADN-EIAFLEGLTIVYKSSIDLFFYVAGSAQENELMLMSVLSCLFDSLTHILRKNVERKCLLENMEGAFLVVDEIIDGGVILESDHQQVLQKVNYRADDNPLTEQSVTQHLTEKLALTSNVLQSAKDQIKWS 186          
BLAST of SMED30010090 vs. Ensembl Medaka
Match: copz1 (coatomer protein complex subunit zeta 1 [Source:NCBI gene;Acc:101175157])

HSP 1 Score: 141.354 bits (355), Expect = 1.304e-42
Identity = 83/175 (47.43%), Postives = 123/175 (70.29%), Query Frame = -3
Query:   49 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLR 573
            +EP+LYT+KA+LILDN+G+R+ +KY+D+  +P+ K +  FE  +F+KT +  + EI L EG T VY++N+DLFFYVIG  +ENEL+L   L CL+DS+ Q+L+ NVEK+ LLE ++ + LA+DE+ DGG+                 ++ PL EQT+ QV++SA+EQ+K S LLR
Sbjct:    4 LEPSLYTVKAVLILDNDGERLYAKYYDD-TYPTVKEQKAFEKNIFNKTHRTDS-EIALLEGLTVVYKSNIDLFFYVIGSSHENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGV--------------SSGDDVPLTEQTVTQVLQSAKEQIKWS-LLR 161          
BLAST of SMED30010090 vs. Ensembl Medaka
Match: copz2 (coatomer subunit zeta-1-like [Source:NCBI gene;Acc:105354657])

HSP 1 Score: 135.961 bits (341), Expect = 4.255e-40
Identity = 80/176 (45.45%), Postives = 117/176 (66.48%), Query Frame = -3
Query:   55 EPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTS----RVGVKQEETPLGEQTMGQVIKSAREQLKLSNL 570
            EP+LYT+KA+ ILDN+G R++SKY+D + +PS K +  FE+ +F+KT K    EI   EG T VY++++DLFFYV G   ENEL+L + L CL+DS+  IL+ NVE+K LLE ++   L +DE+ DGG+++ESD   +      RVG       L    + QV++SA++Q+K S L
Sbjct:    8 EPSLYTVKAVFILDNDGNRLLSKYYDPELYPSIKEQRNFESNIFNKTHKADN-EIAFLEGLTIVYKSSIDLFFYVAGSAQENELMLMSVLSCLFDSLTHILRKNVERKCLLENMEGAFLVVDEIIDGGVILESDHQQVLQKVNYRVGHPSILLVLTTAPVLQVLQSAKDQIKWSIL 182          
BLAST of SMED30010090 vs. Planmine SMEST
Match: SMESG000029916.1 (SMESG000029916.1)

HSP 1 Score: 319.316 bits (817), Expect = 1.111e-112
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = -3
Query:   46 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQXXXXXXXXXXXXXXXXDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLRG 573
            MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQLLECLDLILLALDELCDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLRG
Sbjct:    1 MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSKIPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQILKHNVEKKQLLECLDLILLALDELCDGGILMESDSTSLTSRVGVKQEETPLGEQTMGQVIKSAREQLKLSNLLRG 176          
The following BLAST results are available for this feature:
BLAST of SMED30010090 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COPZ18.890e-5251.43coatomer protein complex subunit zeta 1 [Source:HG... [more]
COPZ14.154e-5151.72coatomer protein complex subunit zeta 1 [Source:HG... [more]
COPZ27.899e-4748.26coatomer protein complex subunit zeta 2 [Source:HG... [more]
COPZ18.851e-4745.92coatomer protein complex subunit zeta 1 [Source:HG... [more]
COPZ12.487e-4650.63coatomer protein complex subunit zeta 1 [Source:HG... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
copz-15.787e-4745.90Probable coatomer subunit zeta [Source:UniProtKB/... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zetaCOP7.703e-5053.05gene:FBgn0040512 transcript:FBtr0075352[more]
zetaCOP1.157e-4853.46gene:FBgn0040512 transcript:FBtr0075351[more]
zetaCOP1.419e-4351.63gene:FBgn0040512 transcript:FBtr0075353[more]
back to top
BLAST of SMED30010090 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
copz12.163e-5049.14coatomer protein complex, subunit zeta 1 [Source:Z... [more]
copz26.851e-5047.37coatomer protein complex, subunit zeta 2 [Source:Z... [more]
copz21.866e-4644.51coatomer protein complex, subunit zeta 2 [Source:Z... [more]
copz21.723e-4446.88coatomer protein complex, subunit zeta 2 [Source:Z... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
copz14.277e-5049.14coatomer protein complex subunit zeta 1 [Source:NC... [more]
copz13.460e-4948.85coatomer protein complex subunit zeta 1 [Source:NC... [more]
COPZ22.276e-1736.67coatomer protein complex subunit zeta 2 [Source:NC... [more]
COPZ27.216e-1336.14coatomer protein complex subunit zeta 2 [Source:NC... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Copz16.104e-5251.43coatomer protein complex, subunit zeta 1 [Source:M... [more]
Copz11.708e-4650.63coatomer protein complex, subunit zeta 1 [Source:M... [more]
Copz29.050e-4647.13coatomer protein complex, subunit zeta 2 [Source:M... [more]
Copz11.491e-1152.00coatomer protein complex, subunit zeta 1 [Source:M... [more]
back to top
BLAST of SMED30010090 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35604|COPZ1_BOVIN3.548e-5151.43Coatomer subunit zeta-1 OS=Bos taurus OX=9913 GN=C... [more]
sp|Q5R5F2|COPZ1_PONAB4.269e-5151.43Coatomer subunit zeta-1 OS=Pongo abelii OX=9601 GN... [more]
sp|P61924|COPZ1_MOUSE4.269e-5151.43Coatomer subunit zeta-1 OS=Mus musculus OX=10090 G... [more]
sp|P61923|COPZ1_HUMAN4.269e-5151.43Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9P299|COPZ2_HUMAN3.793e-4648.26Coatomer subunit zeta-2 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of SMED30010090 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YCW62.137e-6061.40Coatomer subunit zeta OS=Fasciola gigantica OX=468... [more]
A0A0X3P8C43.058e-6062.29Coatomer subunit zeta OS=Schistocephalus solidus O... [more]
G4V8D52.780e-5960.82Coatomer subunit zeta OS=Schistosoma mansoni OX=61... [more]
A0A3L8DN813.128e-5956.73Coatomer subunit zeta OS=Ooceraea biroi OX=2015173... [more]
A0A0R3W9K43.234e-5965.50Coatomer subunit zeta OS=Taenia asiatica OX=60517 ... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copz21.192e-4947.37coatomer subunit zeta-1 [Source:NCBI gene;Acc:1030... [more]
copz23.274e-4644.51coatomer subunit zeta-1 [Source:NCBI gene;Acc:1030... [more]
copz21.625e-4347.17coatomer subunit zeta-1 [Source:NCBI gene;Acc:1030... [more]
copz14.191e-4247.13coatomer protein complex, subunit zeta 1 [Source:Z... [more]
copz21.604e-3845.34coatomer subunit zeta-1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
copz14.582e-4849.13coatomer protein complex, subunit zeta 1 [Source:Z... [more]
copz11.189e-4045.11coatomer protein complex, subunit zeta 1 [Source:Z... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RET37.498e-1933.54Zeta subunit of the coatomer complex (COPI); COPI ... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO424875.632e-5147.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30010090 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copz13.648e-5150.29coatomer protein complex subunit zeta 1 [Source:NC... [more]
copz22.313e-4747.09coatomer subunit zeta-1-like [Source:NCBI gene;Acc... [more]
copz25.886e-4444.20coatomer subunit zeta-1-like [Source:NCBI gene;Acc... [more]
copz11.304e-4247.43coatomer protein complex subunit zeta 1 [Source:NC... [more]
copz24.255e-4045.45coatomer subunit zeta-1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30010090 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029916.11.111e-112100.00SMESG000029916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010090 ID=SMED30010090|Name=SMED30010090|organism=Schmidtea mediterranea sexual|type=transcript|length=614bp
TTTTTATTCAAGAAAAATTTATTTAATAAAATTTGAAATAATTCATCCTC
TCAACAGATTCGACAATTTCAATTGTTCCCGAGCACTTTTGATCACCTGG
CCCATCGTTTGCTCGCCCAGAGGAGTTTCTTCTTGTTTTACTCCAACTCG
ACTGGTTAATGACGTTGAATCACTTTCCATCAGAATTCCTCCATCACAAA
GTTCATCTAACGCTAAAAGAATTAAATCTAAACATTCCAAAAGTTGTTTC
TTTTCCACATTATGCTTCAATATTTGATGAATTGAATCATACAAACACTG
AAGTGCATTTGCTAATAAGAGTTCATTTTCATAAACATCACCAATAACAT
AAAAGAATAAATCGACATTGTTTCGATAAACACACGTATAGCCTTCAAAA
AGGATGATTTCGGCAGTTGGGATTTTGCTAGTTTTACTAAATAATCTTGT
TTCGAAACCTAATCGACTTTTATTTGACGGAAACGCTTGATTGTCAAAAT
ATTTAGATATTATTCGTTTTCCTTCATTATCCAATATTAAAATAGCTTTA
ATTGTATAAAGAGTTGGTTCCATTTGAAATTTAACGATGATTTGTAAATA
TTTTGACAATCAAG
back to top

protein sequence of SMED30010090-orf-1

>SMED30010090-orf-1 ID=SMED30010090-orf-1|Name=SMED30010090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MEPTLYTIKAILILDNEGKRIISKYFDNQAFPSNKSRLGFETRLFSKTSK
IPTAEIILFEGYTCVYRNNVDLFFYVIGDVYENELLLANALQCLYDSIHQ
ILKHNVEKKQLLECLDLILLALDELCDGGILMESDSTSLTSRVGVKQEET
PLGEQTMGQVIKSAREQLKLSNLLRG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039652Coatomer_zeta
IPR022775AP_mu_sigma_su
IPR011012Longin-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006890retrograde vesicle-mediated transport, Golgi to ER
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0030126COPI vesicle coat
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022775AP complex, mu/sigma subunitPFAMPF01217Clat_adaptor_scoord: 17..158
e-value: 9.1E-25
score: 87.3
NoneNo IPR availableGENE3DG3DSA:3.30.450.60coord: 10..157
e-value: 1.5E-45
score: 156.7
NoneNo IPR availablePANTHERPTHR11043:SF0COAT PROTEIN (COATOMER) ZETA, ISOFORM Acoord: 11..179
NoneNo IPR availableCDDcd14829Zeta-COPcoord: 19..152
e-value: 4.82432E-59
score: 178.894
IPR039652Coatomer subunit zetaPANTHERPTHR11043ZETA-COAT PROTEINcoord: 11..179
IPR011012Longin-like domain superfamilySUPERFAMILYSSF64356SNARE-likecoord: 18..156