ATP-dependent RNA helicase DRS1

Overview
NameATP-dependent RNA helicase DRS1
Smed IDSMED30010089
Length (bp)1900
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DRS1 (SMED30010089) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DRS1 (SMED30010089) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DRS1 (SMED30010089) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DRS1 (SMED30010089) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010089

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30010089h1SMcG0019869 SmedASXL_013942SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30010089h1SMcG0019869 SmedASXL_001327SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010089h1SMcG0019869 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010089h1SMcG0019869 Contig54885uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010089h1SMcG0019869 Contig54885newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30010089h1SMcG0019869 dd_Smed_v4_5413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010089h1SMcG0019869 OX_Smed_1.0.19239ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30010089h1SMcG0009009 Contig5399GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010089h1SMcG0019869 Contig5399GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Human
Match: DDX27 (DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:15837])

HSP 1 Score: 455.677 bits (1171), Expect = 6.562e-151
Identity = 224/457 (49.02%), Postives = 317/457 (69.37%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK--RFNWFSNRDNK 1656
            ++Y    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V + L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV EDER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E ++  A + ++ G E  ++    +WF  ++ +
Sbjct:  181 SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQ---APVTRVLVLVPTRELGIQVHSVTRQLAQFC-NITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEER 628          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Human
Match: DDX27 (DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:15837])

HSP 1 Score: 455.677 bits (1171), Expect = 2.158e-150
Identity = 224/457 (49.02%), Postives = 317/457 (69.37%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK--RFNWFSNRDNK 1656
            ++Y    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V + L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV EDER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E ++  A + ++ G E  ++    +WF  ++ +
Sbjct:  212 SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQ---APVTRVLVLVPTRELGIQVHSVTRQLAQFC-NITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEER 659          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Human
Match: DDX27 (DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:15837])

HSP 1 Score: 455.677 bits (1171), Expect = 2.158e-150
Identity = 224/457 (49.02%), Postives = 317/457 (69.37%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK--RFNWFSNRDNK 1656
            ++Y    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V + L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV EDER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E ++  A + ++ G E  ++    +WF  ++ +
Sbjct:  212 SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQ---APVTRVLVLVPTRELGIQVHSVTRQLAQFC-NITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEER 659          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Human
Match: DDX27 (DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:15837])

HSP 1 Score: 239.58 bits (610), Expect = 9.510e-74
Identity = 126/256 (49.22%), Postives = 162/256 (63.28%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEAD-------------------------------KMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVA 966
            ++Y    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V + L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD                               +MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA
Sbjct:   23 SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQA---PVTRVLVLVPTRELGIQVHSVTRQLAQFC-NITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADSPPVDTAWPHAPTLWLLHLPFPQPGAISCPFRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVA 274          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Human
Match: DDX47 (DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:18682])

HSP 1 Score: 226.483 bits (576), Expect = 1.489e-66
Identity = 134/371 (36.12%), Postives = 213/371 (57.41%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQ--LVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            +F D+ ++  + +A      TKPT IQ   IP+ L+ +DI   A+TGSGKT AF +PI+  L+ +P +        A+VL+PTRELA QI E  + L      + VQ  ++ GG++  +Q   L     IIIATPGRLID + NT  F+L  +++ ++DEAD++L+  F  ++ ++LK     R+  LFSATMT+ V+ L   +LK+P K  V+      + LQQ  I I S   + ++  L+ ++        +IF  T N   R  ++L   G     LH  M+Q++RL +L +F     + +   +L+ TD+A+RGLD+ +++ VVN+ +P   + YIHRVGRTAR  +SG+AI+ V + +  + + I
Sbjct:   25 TFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRL------FALVLTPTRELAFQISEQFEAL---GSSIGVQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPS---KFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKF-----KAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRI 378          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Celegans
Match: ddx-27 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q95XM9])

HSP 1 Score: 443.351 bits (1139), Expect = 8.619e-147
Identity = 220/446 (49.33%), Postives = 309/446 (69.28%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKN-GVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEK---AMKKVDNGDEQAMKRFNWF 1638
            SF  M +S+ ILKA   +  + PTPIQ+ACIP+ L  KDICACA TG+GKT AF++PI+E++I  P      +  R +VL PTRELA+Q+++V + L  F  +L V L +GGL+   QEA LR+G D+++ATPGRLID +HN+P+F+L  IE  +LDEAD+ML+E F +Q+ E+++ C+  RQ +LFSATMTE + +L S+SL+ P KIF+N+N D A  L+QE IRIR+ R  DREAM+ AL+ R F   TI+F+ TK  C R+ I+LGL G+K  ++ S++TQ QR+++L +F K       +DVLV TDLA+RGLD+E ++TV+N ++PK  +QYIHRVGRTAR  K+GR+ISLV EDER +LK I   + +  +K R + PEVV+ Y  +I    ET+ QI E +R EKE +IAE  + K   A++  +NG   A +R  W 
Sbjct:  149 SFEQMNLSRQILKACSGAGYSDPTPIQQACIPVALTGKDICACAATGTGKTAAFVLPILERMIYRPKG---ASCTRVLVLVPTRELAIQVFQVFRKLSTF-IQLEVCLCAGGLDLKAQEAALRSGPDVVVATPGRLIDHLHNSPSFNLSNIEVLVLDEADRMLEEAFRDQMNELIRLCAQNRQTLLFSATMTEEIDELASMSLQKPVKIFINENTDTALKLRQEFIRIRAGRETDREAMVAALVTRTFQTNTIVFVRTKKDCQRMQILLGLLGIKVGQMQSSLTQGQRIESLSKFKKA-----EIDVLVSTDLASRGLDIEGVQTVINMNMPKSIKQYIHRVGRTARAGKAGRSISLVGEDERKLLKEIVNSNADRTLKQRLVAPEVVEAYRRRIDELEETIQQIDEEDRAEKELRIAEASMAKTQNALEVGENGGAPAERRV-WM 584          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Celegans
Match: T26G10.1 (Putative ATP-dependent RNA helicase T26G10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34580])

HSP 1 Score: 235.728 bits (600), Expect = 4.472e-70
Identity = 134/360 (37.22%), Postives = 210/360 (58.33%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAE 1392
            SF ++ +S+P+  A       KP+ IQ+A +P  L+ KD+   A+TGSGKT AF IP+++ L+  P  Q  +     +VL+PTRELA QI +  + L      L   ++ GG++ + Q   L     II+ATPGRL+D + NT  F+L  ++F I+DEAD++L+  F  ++ ++LK     R+  LFSATMT+ V  L   SL+DP ++ V+      DNL+Q  I + +   + +E  L+ L+        I+F  T     +I +ML   G++   LH  M+Q +RL +L +F     E     +LV TD+AARGLD+ +++ V+NY +P + + Y+HRVGRTAR  +SG AI++V +
Sbjct:   45 SFAELGVSQPLCDACQRLGWMKPSKIQQAALPHALQGKDVIGLAETGSGKTGAFAIPVLQSLLDHP--QAFF----CLVLTPTRELAFQIGQQFEAL-GSGIGLIAAVIVGGVDMAAQAMALARRPHIIVATPGRLVDHLENTKGFNLKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLERASLRDPARVSVSSRYKTVDNLKQHYIFVPN---KYKETYLVYLLNEHAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNKFKSKARE-----ILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQ 389          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334091:1 gene:WBGene00019219.1 transcript:H20J04.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 218.779 bits (556), Expect = 5.226e-63
Identity = 141/431 (32.71%), Postives = 236/431 (54.76%), Query Frame = 1
Query:  301 VTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNF---DLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNND---VADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQI 1560
            +T   F  + +   I + L    I   TP+Q ACIP  L+  DI  CA+TG+GKTLAF IPI++KL   P   G Y    A++L+PTRELA QI E    L K    L   ++ GG +  +Q   L     +++ATPGRL D+I + P+       KI+FF+LDEAD+ML+  + +Q+K + +  S  RQ +L SAT+T N+  L  +S + P+  F ++  D     D L+Q+ +         ++A L+ ++ + +S++      +IF  T   C  +  M    G +   LHS + Q QRL AL  F      ++ + V++ TD+A+RGLD+ +++ VVN+++P+  + YIHRVGR+AR  + G A+S V + +  +L+ + +     +   K+ P+ V  Y  ++ +  +     +E+++  ++ +I
Sbjct:   86 MTTKKFSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPY--GIY----ALILTPTRELAFQIAEQFTALGK-PITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPY-FFEDKGKDDESTVDRLEQKYVVC---PVAVKDAYLVYVV-KNYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAF-----RSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKLDELKVSPKHVTKYVTQVLVAKKEAELKLENQKFGEKKEI 499          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334484:1 gene:WBGene00019219.1 transcript:H20J04.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 218.779 bits (556), Expect = 5.226e-63
Identity = 141/431 (32.71%), Postives = 236/431 (54.76%), Query Frame = 1
Query:  301 VTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNF---DLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNND---VADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQI 1560
            +T   F  + +   I + L    I   TP+Q ACIP  L+  DI  CA+TG+GKTLAF IPI++KL   P   G Y    A++L+PTRELA QI E    L K    L   ++ GG +  +Q   L     +++ATPGRL D+I + P+       KI+FF+LDEAD+ML+  + +Q+K + +  S  RQ +L SAT+T N+  L  +S + P+  F ++  D     D L+Q+ +         ++A L+ ++ + +S++      +IF  T   C  +  M    G +   LHS + Q QRL AL  F      ++ + V++ TD+A+RGLD+ +++ VVN+++P+  + YIHRVGR+AR  + G A+S V + +  +L+ + +     +   K+ P+ V  Y  ++ +  +     +E+++  ++ +I
Sbjct:   86 MTTKKFSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPY--GIY----ALILTPTRELAFQIAEQFTALGK-PITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPY-FFEDKGKDDESTVDRLEQKYVVC---PVAVKDAYLVYVV-KNYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAF-----RSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKLDELKVSPKHVTKYVTQVLVAKKEAELKLENQKFGEKKEI 499          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4332507:1 gene:WBGene00019219.1 transcript:H20J04.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 216.468 bits (550), Expect = 6.347e-63
Identity = 135/384 (35.16%), Postives = 215/384 (55.99%), Query Frame = 1
Query:  301 VTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNF---DLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNND---VADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            +T   F  + +   I + L    I   TP+Q ACIP  L+  DI  CA+TG+GKTLAF IPI++KL   P   G Y    A++L+PTRELA QI E    L K    L   ++ GG +  +Q   L     +++ATPGRL D+I + P+       KI+FF+LDEAD+ML+  + +Q+K + +  S  RQ +L SAT+T N+  L  +S + P+  F ++  D     D L+Q+ +         ++A L+ ++ + +S++      +IF  T   C  +  M    G +   LHS + Q QRL AL  F      ++ + V++ TD+A+RGLD+ +++ VVN+++P+  + YIHRVGR+AR  + G A+S V + +  +L+ +
Sbjct:   86 MTTKKFSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPY--GIY----ALILTPTRELAFQIAEQFTALGK-PITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPY-FFEDKGKDDESTVDRLEQKYVVC---PVAVKDAYLVYVV-KNYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAF-----RSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAV 452          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Fly
Match: Rs1 (gene:FBgn0021995 transcript:FBtr0345935)

HSP 1 Score: 423.32 bits (1087), Expect = 1.737e-138
Identity = 211/464 (45.47%), Postives = 300/464 (64.66%), Query Frame = 1
Query:  268 KFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSP-NQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            K  F + +     + SF  M +S+P+++A+       PTPIQ + IP+ L  +DIC CA TG+GKT A+++P +E+L+  P N +    + R +VL PTREL  Q+Y+V K L +F+  + V L  GGL+   QEA LR   DI+IATPGRLID I NTP+F L  IE  ILDEAD+MLDEYF EQ+KE++  C  TRQ MLFSATM+E VKDL ++SL  P K+FVN N  VA NL+QE IRIR  +  DRE +L +LICR F    ++F+ TK   HR+HI+LGL GV+  ELH N+TQ QRL++L +F     + E++DVL+ TD+AARGLD+  ++TV+N+ +P   E YIHRVGRTAR  ++G ++SL  E ER ++K I K +++ +K R I PE+++ Y  K+      +  I++ E+ E++    E +L K  +K+     Q  +R  WF  +  +
Sbjct:  143 KMQFADTVEANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKA---ITRVLVLVPTRELGAQVYQVTKQLCQFTT-IDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDKEGDREPILASLICRTFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKF-----KEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKERKIVKDIIKNAESTIKNRIIPPEIIEKYRNKLTSLEPEIQNILDEEQAERQLAKTEQQLSKTERKLLG---QTNERRGWFQTKQQR 594          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Fly
Match: Rs1 (gene:FBgn0021995 transcript:FBtr0088788)

HSP 1 Score: 423.32 bits (1087), Expect = 1.737e-138
Identity = 211/464 (45.47%), Postives = 300/464 (64.66%), Query Frame = 1
Query:  268 KFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSP-NQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            K  F + +     + SF  M +S+P+++A+       PTPIQ + IP+ L  +DIC CA TG+GKT A+++P +E+L+  P N +    + R +VL PTREL  Q+Y+V K L +F+  + V L  GGL+   QEA LR   DI+IATPGRLID I NTP+F L  IE  ILDEAD+MLDEYF EQ+KE++  C  TRQ MLFSATM+E VKDL ++SL  P K+FVN N  VA NL+QE IRIR  +  DRE +L +LICR F    ++F+ TK   HR+HI+LGL GV+  ELH N+TQ QRL++L +F     + E++DVL+ TD+AARGLD+  ++TV+N+ +P   E YIHRVGRTAR  ++G ++SL  E ER ++K I K +++ +K R I PE+++ Y  K+      +  I++ E+ E++    E +L K  +K+     Q  +R  WF  +  +
Sbjct:  143 KMQFADTVEANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKA---ITRVLVLVPTRELGAQVYQVTKQLCQFTT-IDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDKEGDREPILASLICRTFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKF-----KEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKERKIVKDIIKNAESTIKNRIIPPEIIEKYRNKLTSLEPEIQNILDEEQAERQLAKTEQQLSKTERKLLG---QTNERRGWFQTKQQR 594          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Fly
Match: CG9253 (gene:FBgn0032919 transcript:FBtr0081468)

HSP 1 Score: 223.016 bits (567), Expect = 4.733e-65
Identity = 132/360 (36.67%), Postives = 208/360 (57.78%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAE 1392
            ++ D+ +++ + +A  +     P+ IQ   IP+ L+ KD+   A+TGSGKT AF +PI+  L+ +P    RY    A+VL+PTRELA QI E  + L      +   +V GG++   Q   L     IIIATPGRL+D + N   F+L  I++ ++DEAD++L+  F  ++ ++LK     R+  LFSATMT+ VK L   SLKDP K+ V+      + LQQ  + I     + ++  L+ ++        +IF  T N   +  +ML   G+    LH  M+Q +RL AL +F     + +   +L+ TD+A+RGLD+ +++ VVN+ +P   + YIHRVGRTAR  +SG+AI+LV++
Sbjct:   62 TWKDLGLNEALCQACDELKWKAPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQ---RYF---ALVLTPTRELAFQIGEQFEAL-GSGIGIKCCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQLQQSYLFI---PVKYKDVYLVHILNELAGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKF-----KAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQ 406          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 208.764 bits (530), Expect = 1.573e-58
Identity = 121/363 (33.33%), Postives = 195/363 (53.72%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQ--GRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCS--PTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISL 1383
            +  F    +   I+  +  S    PTPIQ+  IP+    +D+ ACA+TGSGKT AFL+PI+ KL+  P++   GR   P+ V++SPTRELA+QI+  A+    F   L + +V GG +  +Q  C+  G  ++IATPGRL+D +  T         F +LDEAD+MLD  F E ++ ++   +  P  Q ++FSAT  E ++ +    LK+   + +        +++Q +  +  +    +   +++    G    TI+F+ TK     +   L         +H +  Q+QR  AL  F     +N  + VL+ T +A+RGLD++NI+ V+NY +P K + Y+HR+GRT R   +GRA S 
Sbjct:  244 IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGR---PQVVIVSPTRELAIQIFNEARKF-AFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRT-FITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADG----TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDF-----KNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 208.764 bits (530), Expect = 1.573e-58
Identity = 121/363 (33.33%), Postives = 195/363 (53.72%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQ--GRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCS--PTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISL 1383
            +  F    +   I+  +  S    PTPIQ+  IP+    +D+ ACA+TGSGKT AFL+PI+ KL+  P++   GR   P+ V++SPTRELA+QI+  A+    F   L + +V GG +  +Q  C+  G  ++IATPGRL+D +  T         F +LDEAD+MLD  F E ++ ++   +  P  Q ++FSAT  E ++ +    LK+   + +        +++Q +  +  +    +   +++    G    TI+F+ TK     +   L         +H +  Q+QR  AL  F     +N  + VL+ T +A+RGLD++NI+ V+NY +P K + Y+HR+GRT R   +GRA S 
Sbjct:  244 IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGR---PQVVIVSPTRELAIQIFNEARKF-AFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRT-FITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADG----TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDF-----KNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Zebrafish
Match: ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:ZFIN;Acc:ZDB-GENE-031001-8])

HSP 1 Score: 457.603 bits (1176), Expect = 1.383e-151
Identity = 228/486 (46.91%), Postives = 327/486 (67.28%), Query Frame = 1
Query:  199 EADTLRDITTIVNKKSIDIHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            +ADTLR+      +K  D  +     F    ++Y    +F DM +S+P+LKA+      +PTPIQ+AC+P+GL  KDICACA TG+GKT AF++P++E+LI  P +     V R +VL PTREL +Q++ VA+ L +F+  +S  L  GGL+  +QEA LR G D++IATPGRLID +HNTP+F+L +IE  ILDEAD+MLDEYF EQ+KE+++ C+  RQ MLFSATM+E VKDL S+SLK P +IFVN N DVA  L+QE +RIR ++  DREA++ AL+ R F    ++F  TK   HR+HI+LGL G+K  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  K GR++SLV E ER MLK I K +K  VK R I  EV+  + + I+   + V  ++  E+ EKE   +E ++  A K++   +++      WF   + +
Sbjct:  168 KADTLREKQKKGKRKMADTTE----GFFEDASQYDENLTFQDMNLSRPLLKAISTMGFKQPTPIQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRE---TQVTRVLVLVPTRELGIQVHTVARQLAQFTT-ISTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPSFELSQIEILILDEADRMLDEYFEEQMKEIIRMCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPNKEGDREAIVAALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETERKMLKEIVKKAKFPVKARVIPQEVILKFRDLIEKLEKDVYAVLCLEKEEKEMAHSEAQISSAQKRLTKSEDEKQLPRTWFQTNEER 640          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Zebrafish
Match: ddx54 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:ZFIN;Acc:ZDB-GENE-021220-2])

HSP 1 Score: 238.424 bits (607), Expect = 6.899e-68
Identity = 138/366 (37.70%), Postives = 216/366 (59.02%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSK---RTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDE 1398
              F  M +S P+ K +M      PTPIQ   IP+ L  KD+ A A+TGSGKT AFL+P+ EKL ++P  Q   T  RA++L+PTRELALQ  +  K L KF+  L   L+ GG +  +Q A L    DIII TPGRL+ +I    N  L  +E+ + DEAD++ +  F EQ++E+++     RQ +LFSAT+ + + +     L +P  I ++ +  +++ L+   +   S R +D+ A+L+ L+ R   K   +T++F+ TK+    +  +L   GV C+ ++S + Q  R  ++GRF      + +V +L+ TD+AARG+D+  ++ V+NY+ P K + ++HRVGR AR  + G A SLV  DE
Sbjct:   78 GGFQSMGLSYPVYKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPLFEKL-KAPQAQ---TGARALILTPTRELALQTMKFTKELGKFT-GLRTALILGGDSMDDQFAALHENPDIIIGTPGRLMHVIQEM-NLKLQSVEYVVFDEADRLFEMGFAEQLQEIIRRLPDARQTLLFSATLPKLIVEFARAGLTEPVLIRLDVDTKLSEQLK---LSFFSLRLDDKPALLLHLL-RNVVKPQEQTVVFVATKHHVEYLKELLSAEGVDCSCIYSALDQTARKISIGRFV-----HRKVMLLLVTDVAARGIDIPLLDNVINYNFPCKPKLFLHRVGRVARAGRGGTAYSLVCPDE 428          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Zebrafish
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 210.305 bits (534), Expect = 1.288e-60
Identity = 136/381 (35.70%), Postives = 214/381 (56.17%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEY---FIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDV--ADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            +A+F  + +S+ +++      I++PT +QE CIP  L  +D   CAKTGSGKT AF++P+++KL   P     Y V   +VL+PTRELA QI E  ++L K    L   ++ GG++   Q   L     +++ATPGRL D I ++   +L +I+F I+DEAD++L++    F + ++ +L      RQ +LFSAT+T+ ++ L S+++  PF  F    +DV     L Q  I +   + +D  A L+ LI + F         IIF  T   C  + +ML  F      LHS M Q QR   L +F   V       +L+ TD+AARGLD+  ++ V+N++ P   + YIHRVGRTAR  ++G +I+LV + + +++  I
Sbjct:    1 MATFESLGLSEWLIQQCKQMGISRPTAVQEKCIPAILDGRDCMGCAKTGSGKTAAFVLPVLQKLSEDP-----YGV-FCLVLTPTRELAYQIAEQFRVLGK-PLGLKDCIIVGGMDMVTQGLELSKKPHVVVATPGRLADHIRSSDTINLNRIQFLIMDEADRLLEQGCTDFTKDLEVILSAVPVKRQTLLFSATLTDTLQQLQSIAMNRPF--FWEHKSDVQTVKELDQRFI-LTPEKVKD--AYLVHLI-QTFQDEHDDWSIIIFTNTCKSCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKSNV-----FKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLINAI 363          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Zebrafish
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 211.075 bits (536), Expect = 1.077e-58
Identity = 132/403 (32.75%), Postives = 207/403 (51.36%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSP-------NQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVS--GGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLK--------------------------GCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNML 1410
            + ++ +  +   IL+ +       PTPIQ   IPIGL+N+DI   A+TGSGKT AFLIP++  +   P       + QG    P A++L+PTRELA QI E     IKF   L ++ V+  GG++R +Q   LR G +I+IATPGRLID++ N     L +  + +LDEAD+M+D  F   ++++L+                          G    RQ ++F+ATM   V+ L    L+ P  +++       + ++Q+VI +      ++   L+ ++  GF    IIF+  K  C  +   L   G     LH    Q QR  AL             D+LV TD+A RG+D++++  V+NY + K  E YIHR+GRT R  KSG A++ + +++ ++ 
Sbjct:  317 IRNWKEYSLPPHILEVIEKCGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQG----PYAIILAPTRELAQQIEEET---IKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENR-YLVLSRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDDAEDPEKMMQNFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVILMSEG---EKRKKLLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAK-----DILVATDVAGRGIDIQDVSMVLNYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSSVF 703          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Zebrafish
Match: ddx10 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-071022-2])

HSP 1 Score: 212.616 bits (540), Expect = 1.293e-58
Identity = 140/443 (31.60%), Postives = 230/443 (51.92%), Query Frame = 1
Query:  214 RDITTIVNKKSIDIHQEDKFDFKNILTEYVTV-----ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVAD--NLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLF-----GVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRA-ISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLF 1503
            R   + V K+  ++ +E+    K ++ +Y  +       F D  +SK  LK L+++   +PT IQ   I   L+ +D+   AKTGSGKTLAFLIP++E L R   Q        A+++SPTRELA Q +EV + + K + + S  LV GG +  ++   +    +III TPGRL+  +  T  F    +   +LDEAD++LD  F + +  +++    +RQ +LFSAT T +VKDL  LSLKDP  ++V++    +    L+Q  +    H+  +   ML + +     K+ I+F      C  +  +  +F     G+    LH    Q +R++    F +         VL  TD+AARGLD   +  V+ +  P+    YIHRVGRTAR ++ G A + L+  +E+ M+  + +  K  +   +++PE +    +K++ F
Sbjct:   36 RSQKSKVKKRDWEVEREN---IKKLVDKYSEINPKEAVKFSDFPLSKKTLKGLLEAQYRQPTEIQRQTIGFALQGRDVLGAAKTGSGKTLAFLIPVLECLYR--EQWTAMDGLGALIISPTRELAYQTFEVLRKVGK-NHEFSAGLVIGGKDLKDESEKIHR-TNIIICTPGRLLQHMDETATFHASDLHMLVLDEADRILDMGFADTLNAIVENLPKSRQTLLFSATQTRSVKDLARLSLKDPEYVWVHEQAKFSTPATLEQNYVVCELHQKVN---MLYSFLRSHLQKKIIVFFAC---CKEVQYLFRIFCRLRPGISVLALHGKQQQMKRVEVYNDFVRKTSA-----VLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRVGRTARYKEGGEALLVLLPSEEKGMISQL-QEKKVPINKIQVNPEKLMSVQQKLEAF 459          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Xenopus
Match: DDX27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:100101759])

HSP 1 Score: 454.521 bits (1168), Expect = 1.271e-152
Identity = 219/448 (48.88%), Postives = 319/448 (71.21%), Query Frame = 1
Query:  316 FMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-DEQAMKRFNWFSNRDNK 1656
            F +M +S+P+LKA+   + T+PTPIQ+ACIPIGL  KDICACA TG+GKT AF++P++E+LI  P +     V R +VL PTREL +Q++ V+++L +F+ +++  L  GGL+   QEA LR+G D++IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ +LFSATM+E VKDL S+SL++P +IFVN N DVA  L+QE +RIR +R  DREA+  AL+ R F    ++F  TK   HR+HI+LGL G++  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD++ ++TV+N ++P   + Y+HRVGRTAR  K+GR++SLV E+ER MLK I K ++  VK R I  +V+  + EKI    + +  +++ E+ EKE Q++E ++  A KK+  G  E++    +WF  ++ +
Sbjct:   28 FQEMNLSRPLLKAISAMSFTQPTPIQKACIPIGLLGKDICACAATGTGKTAAFMLPVLERLIYKPREA---PVTRVLVLVPTRELGIQVHAVSRLLAQFT-EVTTCLAVGGLDVKTQEAALRSGPDVLIATPGRLIDHLHNCPSFSLDSIEVLILDEADRMLDEYFEEQMKEIIRLCSHQRQTLLFSATMSEEVKDLASVSLRNPVRIFVNSNTDVAPFLRQEFVRIRPNREGDREAVACALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLRVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIDGVKTVINLTMPGTVKHYVHRVGRTARAGKAGRSVSLVGEEERKMLKEIVKKAQAPVKARVIPQDVISKFREKITKSEKEIYAVLQLEKEEKEMQMSEAQISVAKKKLQPGKGEESHPERSWFQTKEER 466          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Xenopus
Match: DDX27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:100101759])

HSP 1 Score: 458.759 bits (1179), Expect = 2.285e-152
Identity = 223/468 (47.65%), Postives = 326/468 (69.66%), Query Frame = 1
Query:  256 HQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-DEQAMKRFNWFSNRDNK 1656
            H +D   F    ++Y     F +M +S+P+LKA+   + T+PTPIQ+ACIPIGL  KDICACA TG+GKT AF++P++E+LI  P +     V R +VL PTREL +Q++ V+++L +F+ +++  L  GGL+   QEA LR+G D++IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ +LFSATM+E VKDL S+SL++P +IFVN N DVA  L+QE +RIR +R  DREA+  AL+ R F    ++F  TK   HR+HI+LGL G++  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD++ ++TV+N ++P   + Y+HRVGRTAR  K+GR++SLV E+ER MLK I K ++  VK R I  +V+  + EKI    + +  +++ E+ EKE Q++E ++  A KK+  G  E++    +WF  ++ +
Sbjct:  156 HWQDSSGFFEDASQYDENLMFQEMNLSRPLLKAISAMSFTQPTPIQKACIPIGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRE---APVTRVLVLVPTRELGIQVHAVSRLLAQFT-EVTTCLAVGGLDVKTQEAALRSGPDVLIATPGRLIDHLHNCPSFSLDSIEVLILDEADRMLDEYFEEQMKEIIRLCSHQRQTLLFSATMSEEVKDLASVSLRNPVRIFVNSNTDVAPFLRQEFVRIRPNREGDREAVACALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLRVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIDGVKTVINLTMPGTVKHYVHRVGRTARAGKAGRSVSLVGEEERKMLKEIVKKAQAPVKARVIPQDVISKFREKITKSEKEIYAVLQLEKEEKEMQMSEAQISVAKKKLQPGKGEESHPERSWFQTKEER 614          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Xenopus
Match: DDX27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:100101759])

HSP 1 Score: 458.759 bits (1179), Expect = 3.409e-152
Identity = 223/468 (47.65%), Postives = 326/468 (69.66%), Query Frame = 1
Query:  256 HQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-DEQAMKRFNWFSNRDNK 1656
            H +D   F    ++Y     F +M +S+P+LKA+   + T+PTPIQ+ACIPIGL  KDICACA TG+GKT AF++P++E+LI  P +     V R +VL PTREL +Q++ V+++L +F+ +++  L  GGL+   QEA LR+G D++IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ +LFSATM+E VKDL S+SL++P +IFVN N DVA  L+QE +RIR +R  DREA+  AL+ R F    ++F  TK   HR+HI+LGL G++  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD++ ++TV+N ++P   + Y+HRVGRTAR  K+GR++SLV E+ER MLK I K ++  VK R I  +V+  + EKI    + +  +++ E+ EKE Q++E ++  A KK+  G  E++    +WF  ++ +
Sbjct:  162 HWQDSSGFFEDASQYDENLMFQEMNLSRPLLKAISAMSFTQPTPIQKACIPIGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRE---APVTRVLVLVPTRELGIQVHAVSRLLAQFT-EVTTCLAVGGLDVKTQEAALRSGPDVLIATPGRLIDHLHNCPSFSLDSIEVLILDEADRMLDEYFEEQMKEIIRLCSHQRQTLLFSATMSEEVKDLASVSLRNPVRIFVNSNTDVAPFLRQEFVRIRPNREGDREAVACALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLRVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIDGVKTVINLTMPGTVKHYVHRVGRTARAGKAGRSVSLVGEEERKMLKEIVKKAQAPVKARVIPQDVISKFREKITKSEKEIYAVLQLEKEEKEMQMSEAQISVAKKKLQPGKGEESHPERSWFQTKEER 620          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Xenopus
Match: DDX27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:100101759])

HSP 1 Score: 456.062 bits (1172), Expect = 3.575e-151
Identity = 229/487 (47.02%), Postives = 333/487 (68.38%), Query Frame = 1
Query:  199 EADTLRDITTIVNKKSIDIHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-DEQAMKRFNWFSNRDNK 1656
            +ADTLR    +  KK       D   F    ++Y     F +M +S+P+LKA+   + T+PTPIQ+ACIPIGL  KDICACA TG+GKT AF++P++E+LI  P +     V R +VL PTREL +Q++ V+++L +F+ +++  L  GGL+   QEA LR+G D++IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ +LFSATM+E VKDL S+SL++P +IFVN N DVA  L+QE +RIR +R  DREA+  AL+ R F    ++F  TK   HR+HI+LGL G++  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD++ ++TV+N ++P   + Y+HRVGRTAR  K+GR++SLV E+ER MLK I K ++  VK R I  +V+  + EKI    + +  +++ E+ EKE Q++E ++  A KK+  G  E++    +WF  ++ +
Sbjct:  150 KADTLR----VKEKKKKRKGAGDSSGFFEDASQYDENLMFQEMNLSRPLLKAISAMSFTQPTPIQKACIPIGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRE---APVTRVLVLVPTRELGIQVHAVSRLLAQFT-EVTTCLAVGGLDVKTQEAALRSGPDVLIATPGRLIDHLHNCPSFSLDSIEVLILDEADRMLDEYFEEQMKEIIRLCSHQRQTLLFSATMSEEVKDLASVSLRNPVRIFVNSNTDVAPFLRQEFVRIRPNREGDREAVACALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLRVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIDGVKTVINLTMPGTVKHYVHRVGRTARAGKAGRSVSLVGEEERKMLKEIVKKAQAPVKARVIPQDVISKFREKITKSEKEIYAVLQLEKEEKEMQMSEAQISVAKKKLQPGKGEESHPERSWFQTKEER 623          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Xenopus
Match: DDX27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:100101759])

HSP 1 Score: 455.292 bits (1170), Expect = 7.320e-151
Identity = 229/487 (47.02%), Postives = 333/487 (68.38%), Query Frame = 1
Query:  199 EADTLRDITTIVNKKSIDIHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-DEQAMKRFNWFSNRDNK 1656
            +ADTLR    +  KK       D   F    ++Y     F +M +S+P+LKA+   + T+PTPIQ+ACIPIGL  KDICACA TG+GKT AF++P++E+LI  P +     V R +VL PTREL +Q++ V+++L +F+ +++  L  GGL+   QEA LR+G D++IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ +LFSATM+E VKDL S+SL++P +IFVN N DVA  L+QE +RIR +R  DREA+  AL+ R F    ++F  TK   HR+HI+LGL G++  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD++ ++TV+N ++P   + Y+HRVGRTAR  K+GR++SLV E+ER MLK I K ++  VK R I  +V+  + EKI    + +  +++ E+ EKE Q++E ++  A KK+  G  E++    +WF  ++ +
Sbjct:  150 KADTLR----VKEKKKKRKGAGDSSGFFEDASQYDENLMFQEMNLSRPLLKAISAMSFTQPTPIQKACIPIGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRE---APVTRVLVLVPTRELGIQVHAVSRLLAQFT-EVTTCLAVGGLDVKTQEAALRSGPDVLIATPGRLIDHLHNCPSFSLDSIEVLILDEADRMLDEYFEEQMKEIIRLCSHQRQTLLFSATMSEEVKDLASVSLRNPVRIFVNSNTDVAPFLRQEFVRIRPNREGDREAVACALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLRVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIDGVKTVINLTMPGTVKHYVHRVGRTARAGKAGRSVSLVGEEERKMLKEIVKKAQAPVKARVIPQDVISKFREKITKSEKEIYAVLQLEKEEKEMQMSEAQISVAKKKLQPGKGEESHPERSWFQTKEER 623          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Mouse
Match: Ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:MGI Symbol;Acc:MGI:2385884])

HSP 1 Score: 445.277 bits (1144), Expect = 5.573e-147
Identity = 226/457 (49.45%), Postives = 317/457 (69.37%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK--RFNWFSNRDNK 1656
            +EY    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V K L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV E+ER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E +++ A + +  G E A +    +WF  ++ +
Sbjct:  178 SEYDKSLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAA---VTRVLVLVPTRELGIQVHSVTKQLAQFC-SITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLMRTFTDHVMLFTQTKKQAHRMHILLGLLGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGRAGRSVSLVGEEERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKLEKDVYAVLQLEAEEKEMQQSEAQIDTAQRLLAKGKETADQEPERSWFQTKEER 625          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 223.402 bits (568), Expect = 1.376e-65
Identity = 146/437 (33.41%), Postives = 239/437 (54.69%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQ--LVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYT--EKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDE 1611
            +F D+ ++  + +A       KPT IQ   IP+ L+ +DI   A+TGSGKT AF +PI+  L+ +P +        A+VL+PTRELA QI E  + L      + VQ  ++ GG++  +Q   L     I+IATPGRLID + NT  F+L  +++ ++DEAD++L+  F  ++ ++LK     R+  LFSATMT+ V+ L   +LK+P K  V+      + LQQ  + I S   + ++  L+ ++        +IF  T N   R  ++L   G     LH  M+Q++RL +L +F     + +   +L+ TD+A+RGLD+ +++ VVN+ +P   + YIHRVGRTAR  +SG+AI+ V + +  + + I            I  ++  F T  E++ + +E V++     RME    + E   +K  K+ D GD+
Sbjct:   25 TFKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRL------FALVLTPTRELAFQISEQFEAL---GSSIGVQCAVIVGGIDSMSQSLALAKKPHIVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPS---KFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKF-----KAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRI---------EHLIGKKLPVFPTQDEEVMMLTERVNEAQRFARME----LREHGEKKKRKREDAGDD 431          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Mouse
Match: Ddx54 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:MGI Symbol;Acc:MGI:1919240])

HSP 1 Score: 230.335 bits (586), Expect = 6.544e-65
Identity = 135/366 (36.89%), Postives = 205/366 (56.01%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSK---RTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDE 1398
              F  M +S P+ K +M      PTPIQ   IP+ L  KD+ A A+TGSGKT  FL+P+ E+L     Q G     RA++LSPTRELALQ  +  K L KF+  L   L+ GG    +Q A L    DIIIATPGRL+ +     N  L  +E+ + DEAD++ +  F EQ++E++       Q +LFSAT+ + + +     L +P  I ++ ++ + + L+   + +R    ED +A ++  + +   +   +T++F+ TK+    +  +L   GV CA ++S + Q  R   L +F      + +   L+ TDLAARGLD+  ++ V+NYS P K + ++HRVGR AR  +SG A SLVA DE
Sbjct:   95 GGFQSMGLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFERLKARSAQTG----ARALILSPTRELALQTMKFTKELGKFT-GLKTALILGGDKMEDQFAALHENPDIIIATPGRLVHVAVEM-NLKLQSVEYVVFDEADRLFEMGFAEQLQEIIGRLPGGHQTVLFSATLPKLLVEFARAGLTEPVLIRLDVDSKLNEQLKTSFLLVR----EDTKAAVLLYLLQNVVRPQDQTVVFVATKHHAEYLTELLMGQGVSCAHIYSALDQTARKINLAKFT-----HNKCSTLIVTDLAARGLDIPLLDNVINYSFPAKGKLFLHRVGRVARAGRSGTAYSLVAPDE 445          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Mouse
Match: Ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:MGI Symbol;Acc:MGI:2136689])

HSP 1 Score: 215.698 bits (548), Expect = 1.797e-62
Identity = 130/379 (34.30%), Postives = 213/379 (56.20%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEY---FIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            +A F ++ +S  +++      + +PTP+Q  CIP  L+ +D   CAKTGSGKT AF++PI++KL   P     Y +   +VL+PTRELA QI E  ++L K    L   ++ GG++   Q   L     ++IATPGRL D + ++  F++ KI+F ++DEAD++L++    F   ++ +L      RQ +LFSAT+T+ +K+L  L+  +PF           + L Q  + +     + ++A L+ L+ + F  +      IIF  T   C  + +ML  F      LHS M Q +R  AL +F  ++       +L+ TD+A+RGLD+  ++ V+N++ P   + YIHRVGRTAR  + G+AI+LV + + ++L  I
Sbjct:    1 MAGFAEIGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDP-----YGI-FCLVLTPTRELAYQIAEQFRVLGK-PLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFNMKKIQFLVMDEADRLLEQGCTDFTTDLETILAAVPARRQTLLFSATLTDTLKELQGLATNEPFFWEAQATVRTVEQLDQRYLLVPE---KVKDAYLVHLV-QTFQDQLEDCSIIIFTNTCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALAKFKSSI-----YRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLLHAI 363          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Mouse
Match: Ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:MGI Symbol;Acc:MGI:1921601])

HSP 1 Score: 216.853 bits (551), Expect = 2.776e-60
Identity = 136/399 (34.09%), Postives = 207/399 (51.88%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSP-------NQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVS--GGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLK--------------------------GCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDE 1398
            + S+ D  +   IL+ +      +PTPIQ   IPIGL+N+DI   A+TGSGKT AFLIP++  +   P       + QG    P A++L+PTRELA QI E     IKF   L ++ V+  GG++R +Q   LR G +I+IATPGRLID++ N     L +  + +LDEAD+M+D  F   ++++L+                          G    RQ ++F+ATM   V+ L    L+ P  +++       + ++Q+V  +      ++   L+A++ +GF    IIF+  K  C  +   L   G     LH    Q QR  AL             D+LV TD+A RG+D++++  VVNY + K  E YIHR+GRT R  KSG AI+ + +++
Sbjct:  389 IRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQG----PYAIILAPTRELAQQIEEET---IKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENR-YLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSES---EKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAK-----DILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKED 771          
BLAST of ATP-dependent RNA helicase DRS1 vs. UniProt/SwissProt
Match: sp|Q96GQ7|DDX27_HUMAN (Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2)

HSP 1 Score: 455.677 bits (1171), Expect = 1.036e-149
Identity = 224/457 (49.02%), Postives = 317/457 (69.37%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK--RFNWFSNRDNK 1656
            ++Y    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V + L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV EDER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E ++  A + ++ G E  ++    +WF  ++ +
Sbjct:  212 SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQ---APVTRVLVLVPTRELGIQVHSVTRQLAQFC-NITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEER 659          
BLAST of ATP-dependent RNA helicase DRS1 vs. UniProt/SwissProt
Match: sp|A1A4H6|DDX27_BOVIN (Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus OX=9913 GN=DDX27 PE=2 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 2.328e-149
Identity = 224/457 (49.02%), Postives = 315/457 (68.93%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDE--QAMKRFNWFSNRDNK 1656
            ++Y    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V K L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV E+ER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E ++  A + ++ G E        +WF  ++ +
Sbjct:  181 SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQ---APVTRVLVLVPTRELGIQVHSVTKQLAQFC-SITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLMRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEEERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQKSEAQINTAQRLLEKGKEAPNPEPERSWFQTKEER 628          
BLAST of ATP-dependent RNA helicase DRS1 vs. UniProt/SwissProt
Match: sp|Q921N6|DDX27_MOUSE (Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus OX=10090 GN=Ddx27 PE=1 SV=3)

HSP 1 Score: 445.277 bits (1144), Expect = 3.899e-146
Identity = 226/457 (49.45%), Postives = 317/457 (69.37%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK--RFNWFSNRDNK 1656
            +EY    SF DM +S+P+LKA+      +PTPIQ+ACIP+GL  KDICACA TG+GKT AF +P++E+LI  P Q     V R +VL PTREL +Q++ V K L +F   ++  L  GGL+  +QEA LR   DI+IATPGRLID +HN P+F L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ VKDL S+SLK+P +IFVN N DVA  L+QE IRIR +R  DREA++ AL+ R F+   ++F  TK   HR+HI+LGL G++  ELH N++Q QRL+AL RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR++SLV E+ER MLK I K +K  VK R +  +V+  + +KI+   + V  +++ E  EKE Q +E +++ A + +  G E A +    +WF  ++ +
Sbjct:  178 SEYDKSLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAA---VTRVLVLVPTRELGIQVHSVTKQLAQFC-SITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLMRTFTDHVMLFTQTKKQAHRMHILLGLLGLQVGELHGNLSQTQRLEALRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGRAGRSVSLVGEEERKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKLEKDVYAVLQLEAEEKEMQQSEAQIDTAQRLLAKGKETADQEPERSWFQTKEER 625          
BLAST of ATP-dependent RNA helicase DRS1 vs. UniProt/SwissProt
Match: sp|Q9ZRZ8|RH28_ARATH (DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana OX=3702 GN=RH28 PE=2 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 1.349e-114
Identity = 187/443 (42.21%), Postives = 283/443 (63.88%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDE-QAMKRFNWF 1638
            +FM++ +S+P+L+A       KPTPIQ ACIP+ L  +D+CA A TGSGKT AF +P +E+L+  P    R    R ++L+PTRELA+QI+ + + L +F+  +   L+ GGL+   QE  LR+  DI++ATPGR+ID + N+ + DL  +   ILDEAD++L   F  +I E+++ C   RQ MLFSATMTE VK+L+ LSL  P ++  + +      L +EV+RIR  R  ++EA+L++L  R F  + IIF  TK   HR+ I+ GL G+K AELH N+TQAQRLD+L  F K     + VD L+ TD+AARGLD+  ++TV+NY+ P++ + Y+HRVGRTAR  + G A++ V + +R++LK+I K   + +K R I  + +  +++ I    +  S +I +ER E+  + AE+E  KA   +++ DE  A  +  WF
Sbjct:  168 TFMELNLSRPLLRACETLGYKKPTPIQAACIPLALTGRDLCASAITGSGKTAAFALPTLERLLFRPK---RVFATRVLILTPTRELAVQIHSMIQNLAQFT-DIKCGLIVGGLSVREQEVVLRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLQTGFATEITELVRLCPKRRQTMLFSATMTEEVKELVKLSLNKPLRLSADPSARRPPGLTEEVVRIRRTREANQEAVLLSLCTRTFKSKVIIFSGTKQAAHRLKILFGLAGLKAAELHGNLTQAQRLDSLELFRK-----QEVDFLIATDVAARGLDIIGVQTVINYACPREIDSYVHRVGRTARAGREGYAVTFVTDSDRSLLKVIAKKVGSKLKSRVIPEQSIVKWSQIIDEMEDQYSAVISAERDERALRKAEMEFAKAENMLEHRDEIYARPKRTWF 601          
BLAST of ATP-dependent RNA helicase DRS1 vs. UniProt/SwissProt
Match: sp|A7TJM9|DRS1_VANPO (ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) OX=436907 GN=DRS1 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 9.567e-111
Identity = 192/462 (41.56%), Postives = 283/462 (61.26%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICR---GFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAED--ERNMLKLICK-----GSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDE-QAMKRFNWFSNRDNKGN 1662
            ++F  + +S+P+LK L D   TKP+PIQ A IPIGL  KDI A A TGSGKT AF+IPI+E+L+  P    +    R +VL+PTRELA+QI +V K + K+   L+  L  GGLN   QE  L+   DI+IATPGR ID + N+ +F++  +E  ++DEAD+ML+E F E++ E+L      RQ +LFSATM   +K LISLSL+ P +I +N     A  L QE +RIR  R   + A+L  LI +      KR ++F+  K + H++ I+LGL G+K  ELH ++TQ QRL ++  F K+++    V VL+ TDLA+RGLD+  IE V+N+ +PK YE Y+HRVGRTAR  + GR+++ V E   +R++++   K      SKN    R ++   ++   + ++ F ET+  I+  E+ EKE   AE++L K    + +  E Q+  +  WF +   K N
Sbjct:  231 STFNSLTLSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIERLLYKP---AKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELKTRPDIVIATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQTLLFSATMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIR-KRDHLKPALLFYLIRKLDGTGQKRIVVFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNF-KSLE----VPVLICTDLASRGLDIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRSAIKSVEESSSKNKAVSRNVEWTQIEETNKLVESFGETIDDILVEEKQEKEILRAEMQLRKGENMIKHKKEIQSRPKRTWFQSEAEKKN 683          
BLAST of ATP-dependent RNA helicase DRS1 vs. TrEMBL
Match: A0A4S2KJG2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011017 PE=3 SV=1)

HSP 1 Score: 520.39 bits (1339), Expect = 4.258e-175
Identity = 247/492 (50.20%), Postives = 348/492 (70.73%), Query Frame = 1
Query:  265 DKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDE--------------------NERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-----DEQAMKRFNWFSNRDNKGNI 1665
            DK+ F + + +Y  V+SFM++K+++P+LKAL + ++ KP PIQ ACIP+ L N DICACA+TGSGKT AFL+PI+E+L + P+   R ++ RA+++SPTRELA+QI+ VA+ L+ + PK+ +QL +GGL+   QEA LR   D++IATPGRLID + N PNF+L +IE+ +LDEADK+LDEYF+EQI E++K C   RQ +LFSATMTE+VK+L +LSLK+P ++F+NQ   VA  LQQE IRIR HR EDR A+L+AL+ R FSKRTI+FLPTK  CHR+HI+L L G  C+ELH +MTQAQRL+AL RF++                        N +VD+L+ TDLAARGLD+ N++T++NY+LP+  +QY+HRVGRTAR   +GRA+SLV E++R +LK I K +   V+ R I PEV+  + EK++    TV +I+ +E  E+E + A+I+L++  K +  G     D    KR +WF  R  +  +
Sbjct:   92 DKYVFNHAVDKYREVSSFMELKLARPLLKALTEMSLEKPMPIQCACIPVALLNHDICACARTGSGKTFAFLLPILERLTKKPSGTAR-SITRALIISPTRELAVQIFRVAEKLVSYCPKIRIQLAAGGLDLHTQEASLRLNPDLVIATPGRLIDHLSNAPNFNLQQIEYLVLDEADKLLDEYFVEQISEIVKHCGKQRQTLLFSATMTESVKELATLSLKNPVQVFLNQTTAVAKRLQQEFIRIRPHREEDRAAILVALLVRTFSKRTIVFLPTKKECHRMHILLSLIGHSCSELHGDMTQAQRLEALRRFSEPAGSHPAESTSGNTASTKPLEDVPNPQVDILLATDLAARGLDIPNVQTIINYNLPQTMKQYVHRVGRTARAANTGRAVSLVGENDRKLLKQIIKEAPYPVQARVISPEVISRFREKLEKLQGTVEEILTAEAEERELRAAQIQLDRTEKLMTEGSQSKEDLPKRKRVDWFVERKRQQKL 582          
BLAST of ATP-dependent RNA helicase DRS1 vs. TrEMBL
Match: A0A4S2KFA6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011017 PE=3 SV=1)

HSP 1 Score: 520.39 bits (1339), Expect = 6.815e-175
Identity = 246/492 (50.00%), Postives = 348/492 (70.73%), Query Frame = 1
Query:  265 DKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDE--------------------NERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQ-----AMKRFNWFSNRDNKGNI 1665
            DK+ F + + +Y  V+SFM++K+++P+LKAL + ++ KP PIQ ACIP+ L N DICACA+TGSGKT AFL+PI+E+L + P+   R ++ RA+++SPTRELA+QI+ VA+ L+ + PK+ +QL +GGL+   QEA LR   D++IATPGRLID + N PNF+L +IE+ +LDEADK+LDEYF+EQI E++K C   RQ +LFSATMTE+VK+L +LSLK+P ++F+NQ   VA  LQQE IRIR HR EDR A+L+AL+ R FSKRTI+FLPTK  CHR+HI+L L G  C+ELH +MTQAQRL+AL RF++                        N +VD+L+ TDLAARGLD+ N++T++NY+LP+  +QY+HRVGRTAR   +GRA+SLV E++R +LK I K +   V+ R I PEV+  + EK++    TV +I+ +E  E+E + A+I+L++  K +  G +        KR +WF  R  +  +
Sbjct:  105 DKYVFNHAVDKYREVSSFMELKLARPLLKALTEMSLEKPMPIQCACIPVALLNHDICACARTGSGKTFAFLLPILERLTKKPSGTAR-SITRALIISPTRELAVQIFRVAEKLVSYCPKIRIQLAAGGLDLHTQEASLRLNPDLVIATPGRLIDHLSNAPNFNLQQIEYLVLDEADKLLDEYFVEQISEIVKHCGKQRQTLLFSATMTESVKELATLSLKNPVQVFLNQTTAVAKRLQQEFIRIRPHREEDRAAILVALLVRTFSKRTIVFLPTKKECHRMHILLSLIGHSCSELHGDMTQAQRLEALRRFSEPAGSHPAESTSGNTASTKPLEDVPNPQVDILLATDLAARGLDIPNVQTIINYNLPQTMKQYVHRVGRTARAANTGRAVSLVGENDRKLLKQIIKEAPYPVQARVISPEVISRFREKLEKLQGTVEEILTAEAEERELRAAQIQLDRTEKLMTEGSQSKEDLPKRKRVDWFVERKRQQKL 595          
BLAST of ATP-dependent RNA helicase DRS1 vs. TrEMBL
Match: A0A5J4NFT7 (ATP-dependent RNA helicase DDX27 OS=Paragonimus westermani OX=34504 GN=DEA37_0005558 PE=3 SV=1)

HSP 1 Score: 520.39 bits (1339), Expect = 1.041e-174
Identity = 265/565 (46.90%), Postives = 377/565 (66.73%), Query Frame = 1
Query:   70 QIANPITEEKPAEIYRGKVVDRLIDEHR-TQLECFNIIDESKDLEADTLRD-------ITTIVNKKSIDIHQE----DKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVD--------------------ENERVDVLVGTDLAARGLDVENIET-----VVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMK----KVDNGDE-QAMKRFNWF 1638
            Q+  PI    P      ++VD LI+++R +Q+E    +D  K+L A  +R+       +  +V  K +   +     DK+ FK+ + +Y  V+SF+D+++SKP+LKAL + ++ KP PIQ ACIP+ L N DICACA+TGSGKTLAFL+PI+E+L + P      T+ RA+++SPTREL +QI+ + + L+K+ PK+ VQL +GGL+  +QEA LR   D++IATPGRLID + N PNF L +IE+ +LDEADK+LDEYF+EQI E++K C   RQ +LFSATMTE+VK+L +LSLKDP ++F+NQ   VA  LQQE +R+RSHR EDR A+L+AL+ R F +R+I+F PTK  CHR+HIM  L G++CAELH +MTQAQRLDAL RF+++ D                    +   VD+L+ TDLAARGLD+ +++T     V+NY+LP+  +QY+HRVGRTAR   +GRA+SLV E +R +LK I KG+   VK R + PEV+  + EK+   +  V  I+ +E  E+E + A+++LEKA K       N D     +R +WF
Sbjct:   35 QLTEPIEPNFPGR----RLVDSLIEQYRQSQVE---DLDLEKELVAPNVREDNHKVFHLKDVVRDKKVHRSKAKDELDKYCFKHAVDKYREVSSFLDLRLSKPLLKALTEMSLDKPMPIQCACIPVALLNHDICACARTGSGKTLAFLLPILERLTKKPFTNTGRTMTRALIISPTRELTVQIFRITEKLVKYCPKIRVQLAAGGLDLCSQEASLRRNPDLVIATPGRLIDHLSNAPNFSLHQIEYLVLDEADKLLDEYFVEQIGEIVKHCGKHRQTLLFSATMTESVKELATLSLKDPVQVFLNQTTAVATRLQQEFVRVRSHREEDRTAILVALLMRNFRRRSIVFFPTKKQCHRMHIMFSLLGLQCAELHGDMTQAQRLDALHRFSESSDFGNDKDCRESQAAATSIDNTQQPHVDILLATDLAARGLDIPDVQTVCLELVINYNLPRTIKQYVHRVGRTARAANAGRAVSLVGEADRKLLKQIMKGAPYAVKSRVVPPEVITRFREKLNKLNSIVEGILMAEAEERELRAAQVQLEKAEKLAAASSSNQDSVTPRQRVDWF 592          
BLAST of ATP-dependent RNA helicase DRS1 vs. TrEMBL
Match: A0A4S2KIT1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011017 PE=3 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 5.717e-174
Identity = 247/486 (50.82%), Postives = 346/486 (71.19%), Query Frame = 1
Query:  265 DKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDE--------------------NERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNG-----DEQAMKRFNWFSNR 1647
            DK+ F + + +Y  V+SFM++K+++P+LKAL + ++ KP PIQ ACIP+ L N DICACA+TGSGKT AFL+PI+E+L + P+   R ++ RA+++SPTRELA+QI+ VA+ L+ + PK+ +QL +GGL+   QEA LR   D++IATPGRLID + N PNF+L +IE+ +LDEADK+LDEYF+EQI E++K C   RQ +LFSATMTE+VK+L +LSLK+P ++F+NQ   VA  LQQE IRIR HR EDR A+L+AL+ R FSKRTI+FLPTK  CHR+HI+L L G  C+ELH +MTQAQRL+AL RF++                        N +VD+L+ TDLAARGLD+ N++T++NY+LP+  +QY+HRVGRTAR   +GRA+SLV E++R +LK I K +   V+ R I PEV+  + EK++    TV +I+ +E  E+E + A+I+L++  K +  G     D    KR +WF  R
Sbjct:   92 DKYVFNHAVDKYREVSSFMELKLARPLLKALTEMSLEKPMPIQCACIPVALLNHDICACARTGSGKTFAFLLPILERLTKKPSGTAR-SITRALIISPTRELAVQIFRVAEKLVSYCPKIRIQLAAGGLDLHTQEASLRLNPDLVIATPGRLIDHLSNAPNFNLQQIEYLVLDEADKLLDEYFVEQISEIVKHCGKQRQTLLFSATMTESVKELATLSLKNPVQVFLNQTTAVAKRLQQEFIRIRPHREEDRAAILVALLVRTFSKRTIVFLPTKKECHRMHILLSLIGHSCSELHGDMTQAQRLEALRRFSEPAGSHPAESTSGNTASTKPLEDVPNPQVDILLATDLAARGLDIPNVQTIINYNLPQTMKQYVHRVGRTARAANTGRAVSLVGENDRKLLKQIIKEAPYPVQARVISPEVISRFREKLEKLQGTVEEILTAEAEERELRAAQIQLDRTEKLMTEGSQSKEDLPKRKRVDWFVER 576          
BLAST of ATP-dependent RNA helicase DRS1 vs. TrEMBL
Match: A0A4Z2CY35 (Putative ATP-dependent RNA helicase DDX27 OS=Schistosoma japonicum OX=6182 GN=EWB00_006499 PE=3 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 2.440e-173
Identity = 274/590 (46.44%), Postives = 392/590 (66.44%), Query Frame = 1
Query:   16 RMEFAGDFQFDLAVVPNFQIANP----ITEEKPAEIYRGKVVDRLIDEHRTQL------ECFNIIDESKDLEADTLRDITTIVNKKSIDIHQE----DKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAK-----------TVDENER--------VDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAM------KRFNWFSNRD-NKGNI 1665
            +M F   F FD    P+  I+ P    I+   P  I R  +VD LI+ +R  +      + +N +   +  E +   + T +V ++S  + ++    DKF+F   +++Y  V+SFM++K++KP+LK+L + ++ KPTPIQ ACIP+ L + DICACA+TGSGKTLAFL+PI+E+L + P+    + + RA+V+SPTRELA+QI+ VA+ L+K+ PKL +QL +GGL+  +QEA LR   D++IATPGRLID + N P+F+L  IE+ +LDEADK+LDEYF EQI E++K CS  RQ +LFSATMTE+VK+L  LSL+DP +IF+NQ   VA+ L QE +RIR HR  DR+A+++AL+ R F KRTI+FLPTK  CHR+HIMLGL G+ CAELH NMTQAQRL+AL RF+            TVD+  +        VD+L+ TDLA+RGLD+ +++TV+NY+LP+  +QY+HRVGRTAR    GRA+SLV ED+R ++K I K +   VK R I P+V+  Y  KI      + +I+ +E  E+E + A+ +L KA + V +   + +      +R +WF  R  NK  I
Sbjct:    7 QMIFNPKFSFD---TPD--ISRPVDAQISLSTPIPITR--LVDTLIETYRKDISSDENVDIYNKVTPPEFSEGEGPTEFTDVVRERSNCVRKKKNEPDKFNFARAVSKYKQVSSFMELKLAKPLLKSLTEMSLDKPTPIQCACIPVALLHHDICACARTGSGKTLAFLLPILERLAKKPSDFN-HAITRALVISPTRELAVQIFNVAEKLVKYCPKLRIQLAAGGLDLHSQEAALRLNPDLVIATPGRLIDHLSNAPSFNLQHIEYLVLDEADKLLDEYFTEQIGEIIKFCSTKRQTLLFSATMTESVKELAVLSLRDPVQIFLNQTTAVAEFLHQEFVRIRPHRENDRQAIVVALLMRYFRKRTIVFLPTKKDCHRMHIMLGLLGLPCAELHGNMTQAQRLEALQRFSNVSENDDSKTKGTVDQLSKINTNDIRPVDILLATDLASRGLDIPSVQTVINYTLPQTMKQYVHRVGRTARYMNVGRAVSLVGEDDRKVMKEIMKEAPYPVKARVIAPDVIASYQSKITRLEPIIGRILATEAEERELRAAQSQLLKAEELVSSMKSETVPLSCVQRRVDWFIERKRNKKTI 588          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Cavefish
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:103032272])

HSP 1 Score: 460.299 bits (1183), Expect = 7.719e-153
Identity = 221/455 (48.57%), Postives = 315/455 (69.23%), Query Frame = 1
Query:  292 TEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            ++Y    +F DM +S+P+LKA+      +PTP+Q+AC+P+GL  KDICACA TG+GKT AF++P++E+L+  P +     V R +VL PTREL +Q++ VA+ L +F+  +S  L  GGL+  +QEA LR G DI+IATPGRLID +HNTP+F+L +IE  ILDEAD+MLDEYF EQ+KE+++ C+  RQ MLFSATM+E VKDL S+SLK P +IFVN N DVA  L+QE +RIR  R  DREA++ AL+ R F    ++F  TK   HR+HI+LGL G+K  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  K GR++SLV E ER MLK I K +K  VK R +  EV+  + + I+   + +  ++  E+ EKE   +E ++  A KK+   +E+      WF  R+ +
Sbjct:  190 SQYDENLTFQDMNLSRPLLKAITTMGFKQPTPVQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLLYKPRE---TQVTRVLVLVPTRELGIQVHSVARQLSQFTT-ISTCLAVGGLDLKSQEAALRAGPDILIATPGRLIDHLHNTPSFELSQIEVLILDEADRMLDEYFEEQMKEIIRLCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPAREGDREAIVAALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETERKMLKEIVKKAKTPVKARVLPQEVILKFRDLIEKLEKDIYAVLRLEKEEKEMVHSETQINSAQKKLTQKEEEKQPARGWFQTREER 635          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Cavefish
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:103032272])

HSP 1 Score: 459.144 bits (1180), Expect = 8.976e-153
Identity = 226/475 (47.58%), Postives = 323/475 (68.00%), Query Frame = 1
Query:  232 VNKKSIDIHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            V KK+  I++     F    ++Y    +F DM +S+P+LKA+      +PTP+Q+AC+P+GL  KDICACA TG+GKT AF++P++E+L+  P +     V R +VL PTREL +Q++ VA+ L +F+  +S  L  GGL+  +QEA LR G DI+IATPGRLID +HNTP+F+L +IE  ILDEAD+MLDEYF EQ+KE+++ C+  RQ MLFSATM+E VKDL S+SLK P +IFVN N DVA  L+QE +RIR  R  DREA++ AL+ R F    ++F  TK   HR+HI+LGL G+K  ELH N++Q QRL++L RF     ++E++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  K GR++SLV E ER MLK I K +K  VK R +  EV+  + + I+   + +  ++  E+ EKE   +E ++  A KK+   +E+      WF  R+ +
Sbjct:  140 VLKKAGKINRPAPEAFFEDASQYDENLTFQDMNLSRPLLKAITTMGFKQPTPVQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLLYKPRE---TQVTRVLVLVPTRELGIQVHSVARQLSQFTT-ISTCLAVGGLDLKSQEAALRAGPDILIATPGRLIDHLHNTPSFELSQIEVLILDEADRMLDEYFEEQMKEIIRLCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPAREGDREAIVAALLTRTFQDHVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRF-----KDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETERKMLKEIVKKAKTPVKARVLPQEVILKFRDLIEKLEKDIYAVLRLEKEEKEMVHSETQINSAQKKLTQKEEEKQPARGWFQTREER 605          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Cavefish
Match: ddx54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:103046998])

HSP 1 Score: 243.432 bits (620), Expect = 7.826e-70
Identity = 138/366 (37.70%), Postives = 217/366 (59.29%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSK---RTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDE 1398
              F  M +S P+ K +M      PTPIQ   IP+ L  KD+ A A+TGSGKT AFL+P+ E+L ++P  Q   T  RA++L+PTRELALQ  +  K L KF+  L   L+ GG +  +Q A L    DIII TPGRL+ I+    N  L  +E+ + DEAD++ +  F +Q++E+++    TRQ +LFSAT+ + + D     L +P  + ++ +  ++D L+     +   R +D+ A+L+ L+ R   K   +T++F+ TK+    ++ +L   G++CA ++S + Q  R   +GRF      + +  VL+ TD+AARG+D+  ++ V+NY+ P K + ++HRVGR AR  +SG A SLV  DE
Sbjct:   78 GGFQSMGLSYPVYKGVMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPMFERL-KAPQAQ---TGARALILTPTRELALQTMKFTKELGKFT-GLKTALILGGDSMDDQFAALHENPDIIIGTPGRLMHIVMEM-NLKLNNVEYVVFDEADRLFEMGFADQLQEIIRRLPETRQTLLFSATLPKLLVDFARAGLTEPVLMRLDVDTKLSDQLKLAFFHL---RLDDKPALLLHLL-RNVVKPQEQTVVFVSTKHHVEYLNQLLTAEGIECAYIYSALDQTARKINIGRFV-----HRKAMVLLVTDVAARGIDIPMLDNVINYNFPSKAKLFLHRVGRVARAGRSGTAFSLVCPDE 428          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Cavefish
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:103034543])

HSP 1 Score: 226.868 bits (577), Expect = 6.806e-67
Identity = 131/371 (35.31%), Postives = 212/371 (57.14%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            + SF ++ +++ + +A       +PT IQ   IP+ L+ +D+   A+TGSGKT AF +PI++ L+  P +         +VL+PTRELA QI E  + L   S  +   +V GG++  +Q   L     I+IATPGRLID + NT  F+L  + F ++DEAD++L+  F  ++ ++LK     R   LFSATMT+ V+ L   +LKDP K  V+      D LQQ  I I    A+ ++  L++++        +IF  T N   R+ ++L   G+    LH  M+Q +RL +L +F     + +   VL+ TD+A+RGLD+ +++ V+N+ +P   + YIHRVGRTAR  +SG++I+ V + +  + + I
Sbjct:   27 IRSFKELGVTEVLCEACEQLGWKQPTKIQIEAIPVALEGRDVIGLAETGSGKTGAFALPILQTLLSHPQRL------HTLVLTPTRELAFQIAEQFEAL-GSSIGVKTAVVVGGIDMMSQAMVLAKKPHIVIATPGRLIDHLENTKGFNLRALRFLVMDEADRILNMDFESEVDKILKVIPRERHTFLFSATMTKKVQKLQRAALKDPVKCAVSTKYATVDKLQQYYIFI---PAKYKDCYLVSILNELAGNSFMIFCGTCNNAQRVALLLRNLGITAIPLHGQMSQNKRLGSLNKF-----KAKSRSVLLATDVASRGLDIPHVDCVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVTQYDVELFQRI 382          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Cavefish
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:103043246])

HSP 1 Score: 211.846 bits (538), Expect = 3.813e-61
Identity = 133/378 (35.19%), Postives = 216/378 (57.14%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEY---FIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDV--ADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            +F  + +S  +++      IT+PTP+Q++C+P  L  +D   CAKTGSGKT AF++P+++KL   P     Y +   +VL+PTRELA QI E  + L K    L   ++ GG++   Q   L     I++ATPGRL D I ++  F++ +I+F ILDEAD++L++    F + ++ +L      RQ +LFSAT+T+ +++L ++++ +PF  F    ++V   D L Q  I +   + +D  A L+ LI +   +      +IF  T   C  + +ML  F      LHS M Q QR   L +F   V       +L+ TD+AARGLD+  ++ V+N++ P   + YIHRVGRTAR  ++G +I+LV + + +++  I
Sbjct:    3 AFAALGLSDWLIQQCKQMGITRPTPVQQSCVPAILAGRDCMGCAKTGSGKTAAFVLPVLQKLAEDP-----YGI-FCLVLTPTRELAYQIAEQFRALGK-PLGLRDCIIVGGMDMVAQGLELSKKPHIVVATPGRLADHIRSSDTFNMKRIKFLILDEADRLLEQGCTDFTKDLEVILSVVPAKRQTLLFSATLTDTLQELKTIAMNEPF--FWENKSEVRTVDELDQRYI-LTPEKVKD--AYLVHLIQKIQDEHDDWSVMIFTNTCKNCQILTMMLREFKFPAISLHSMMKQRQRFANLAKFKSNV-----FKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVNAI 363          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Sea Lamprey
Match: ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:ZFIN;Acc:ZDB-GENE-031001-8])

HSP 1 Score: 411.764 bits (1057), Expect = 1.552e-134
Identity = 213/449 (47.44%), Postives = 301/449 (67.04%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDP-EVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            +F DM +S+P+LKA+      +PTPIQ++CIP+GL  KDICACA TG+GKT AF++P++E+L+  P Q     V R +VL PTREL +Q++ V + L +F   +   L  GGL+   QEA LR G DI+IATPGRLID + N P+FDL  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMT+ V+DL ++SLK P KIFVN N DVA  L+QE +RIR +R  DREA++ AL+ R F    ++F  T  L   + ++    G    ELH N++Q QRL+AL RF     +++++D+LV TD+AARGLD+E ++TV+N+++P   + Y+HRVGRTAR  ++GR+ISLV E ER +LK I K +++ VK R   P EVV+ +  KI+   + +  ++  ER +KE   +E +L KA K++D   +    R  WF  +  +
Sbjct:  220 TFPDMNLSRPLLKAISSMGFQQPTPIQKSCIPVGLLGKDICACAATGTGKTAAFMLPVLERLVYKPRQ---APVTRVLVLVPTRELGIQVHSVTRQLSQFC-NVQTSLAVGGLDIKTQEAALRAGPDILIATPGRLIDHLQNCPSFDLSSIEILILDEADRMLDEYFEEQMKEIIRQCSHQRQTMLFSATMTDQVQDLAAVSLKHPVKIFVNSNTDVAPYLRQEFVRIRPNREGDREAIVSALLTRTFQDHVMVF--THRLHILLGLLGLRVG----ELHGNLSQTQRLEALRRF-----KDDQIDILVATDVAARGLDIEGVKTVINFTMPSTIKHYVHRVGRTARAGRAGRSISLVGETERRVLKDIVKQARSTVKSRVSPPAEVVEKFRAKIENMEKDIYAVLRLEREDKELCASENQLSKAQKQLDGTVQDEAAR-TWFQTKKER 652          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 235.343 bits (599), Expect = 1.377e-71
Identity = 137/366 (37.43%), Postives = 214/366 (58.47%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSK---RTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDE 1398
              F  M +S P+ K +M      PTPIQ  CIP+ L+ +D+ A A+TGSGKT AFL+P+ E+L     Q G     RA+VLSPTRELALQ  +  K L K +  L   L+ GG    +Q A L    DIII TPGRL+ ++    N  L  +E+ + DEAD++ +  F EQ+ E+++    +RQ +LFSAT+ + + +     L DP  I ++ ++ ++D L+   +     RA+D+  +L+ L+ R   K   +T++F+ TK+    +  ++   G+ CA ++S + Q +R   +G+F      +++  +L+ TD+AARG+D   ++ V+NY+ P K + +IHRVGR AR  +SG A SLVA DE
Sbjct:   33 GGFQSMGLSYPVFKGVMGKGYKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERLHARSAQAG----ARALVLSPTRELALQTSKFTKELGKHT-GLKTALILGGDRMEDQFAALHENPDIIIGTPGRLMHVVVEM-NLKLQAMEYVVFDEADRLFEMGFAEQLTEIIRRLPDSRQTLLFSATLPKQLVEFARAGLSDPVLIRLDVDSKLSDQLK---LAFMCSRADDKPCVLLHLL-RTVVKPHEQTVVFVATKHHVEYLRELVSQAGMSCAYIYSALDQTERKINVGKFV-----HKKTMLLIVTDVAARGID-PMLDNVINYNFPGKPKLFIHRVGRVARAGRSGTAYSLVAPDE 382          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 1.011e-65
Identity = 136/392 (34.69%), Postives = 222/392 (56.63%), Query Frame = 1
Query:  376 KPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYT--EKIKLFSETVSQIIESERME 1545
            +PT IQ   IP+ L+ KDI   A+TGSGKT AF +PI++ L+ +P +        A+VL+PTRELA QI E  + L   S  +   +V GG++  +Q   L     +IIATPGRL+D + NT  F++  +++ ++DEAD++L+  F  ++ ++LK     R+  LFSATMT+ V+ L   +LK+P K  V+      + LQQ  + I    A+ +++ L+ ++        IIF  T N   RI ++L   G     LH  M+Q +RL +L +F     + +   +L+ TD+A+RGLD+ +++ V+N+ +P   + YIHRVGRTAR  +SG++I+ V++ +  + + I            I  ++  F T  E++ + +E VS+     RME
Sbjct:   17 QPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAPQRL------FALVLTPTRELAFQISEQFEAL-GSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFI---PAKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKF-----KGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRI---------EHLIGKKLPAFPTNEEEVMMLTERVSEAQRFARME 384          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.305 bits (534), Expect = 1.144e-60
Identity = 133/391 (34.02%), Postives = 215/391 (54.99%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIR---------SPNQQ------GRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQ--LVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVL-KGCSPT---RQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALI-CRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLK 1413
            + SF ++++ + I+ ++      +PTP+Q+  IPI    +D+ ACA+TGSGKT AFL+PI+ ++           + NQQ       R   P ++VL+PTRELALQIY+ A+   KF+ +  V+  +V GG +  NQ   L+ G  +++ATPGRL+D++       L    + +LDEAD+MLD  F  QI+ ++ +   PT   RQ ++FSAT  + ++ L    L+D   + V +    ++N+ Q+V+ +      D+ + L+ L+   G    T++F+ TK     +   L   G  C  +H + +Q  R +AL  F        R  +LV T +AARGLD+ N++ V+N+ LP   E+Y+HR+GRT R    G+A S   E   NM +
Sbjct:   58 IESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEAR---KFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERG-KVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEM---DKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLF-----RTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMTR 436          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 203.371 bits (516), Expect = 8.156e-59
Identity = 126/361 (34.90%), Postives = 207/361 (57.34%), Query Frame = 1
Query:  367 NITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIK--EVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICR----GFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLA----ARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
             I+KPTP+QE CIP  L+ +D   CA+TGSGKT AF++PI++KL   P   G +     +VL+PTRELA QI E  +++ K    L   ++ GG++   Q   L     ++IATPGRL D + ++  F L KI+F ++DEAD++L++   +  K  +V+      RQ +LFSAT+T+ +++L +L+L +PF     +     + L Q  I +     + ++A L+ +I +          I+F  T   C  +++ML  F      LHS M Q +R  +L +F  ++       +L+ TD+A    ARGLD+  ++ V+N++ P   + YIHRVGRTAR  ++G AI++V + + ++++ I
Sbjct:   24 GISKPTPVQENCIPPILRGQDCMGCAQTGSGKTAAFVLPILQKLSEDPF--GIF----CLVLAPTRELAYQIAEQFRVMGK-PLGLKDSVIVGGMDSVRQAQELARKPHVVIATPGRLADHLRSSNTFSLKKIQFLVMDEADRLLEQGATDFTKDLQVILALPAKRQTLLFSATLTDTLQELRNLALTNPFFWESKEPVRTVEELDQRYILVAD---KVKDAYLVHIIQKIQDAHDDWSIIVFTNTCKNCQVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSM-----FKILIATDVASSFWARGLDIPTVQVVLNHNTPSLPKTYIHRVGRTARAGRNGVAITIVTQYDIHLVQAI 369          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Yeast
Match: DRS1 (Nucleolar DEAD-box protein required for ribosome assembly and function; including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000003931])

HSP 1 Score: 337.806 bits (865), Expect = 7.663e-107
Identity = 184/463 (39.74%), Postives = 277/463 (59.83%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICR---GFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAED--ERNMLKLICKGSKNGVKM-------RKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDE-QAMKRFNWFSNRDNKGN 1662
            +F  + +S+P+LK L      KP+PIQ A IPI L  KDI A A TGSGKT AF+IPI+E+L+  P    +    R +VL PTRELA+Q+ +V K + +F   ++  L  GGLN   QE  L++  DI+IATPGR ID I N+ +F++  +E  ++DEAD+ML+E F +++ E++      RQ +LFSATM   +K L+SLSLK P +I ++     A  L QE +RIR  R   + A+L  LI +      KR ++F+  K   HR+ I++GL G+   ELH ++TQ QRLD++ +F     +N  V VL+ TDLA+RGLD+  IE V+NY +PK YE Y+HRVGRTAR  + GR+++ V E   +R++++   K  +    +       R +D   ++   + ++  ++T+  I+  E+ EKE   AE++L K    + +  E QA  R  WF +  +K N
Sbjct:  232 NFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP---AKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIR-KRDHLKPALLFNLIRKLDPTGQKRIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKF-----KNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRAAIKSVEENKSLTQGKALGRNVDWVQIEETNKLVESMNDTIEDILVEEKEEKEILRAEMQLRKGENMLKHKKEIQARPRRTWFQSESDKKN 685          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 224.942 bits (572), Expect = 1.220e-66
Identity = 141/362 (38.95%), Postives = 200/362 (55.25%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPT--RQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAE 1392
            SF ++ +   +++A  + N +KPTPIQ   IP  L+  DI   A+TGSGKT AF IPI+ +L    +Q+  Y    A +L+PTRELA QI E    L       S  +V GG+N  +Q   L     IIIATPGRL+D + NT  F L K++F ++DEAD++LD  F   +  +LK   PT  R   LFSATMT  +  L   SL +P K  V+      D L Q ++ +       +   L+ L+     K  IIF  TK    R+  +  L       LH ++ Q QR+ +L  F     +  +  +LV TD+AARGLD+ +++ VVNY +P   + YIHRVGRTAR  +SG++ISLV++
Sbjct:   82 SFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLWH--DQEPYY----ACILAPTRELAQQIKETFDSLGSLMGVRSTCIV-GGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILK-IIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGL---KNTYLIYLLNEFIGKTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLF-----KAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQ 427          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 220.32 bits (560), Expect = 6.446e-64
Identity = 138/383 (36.03%), Postives = 212/383 (55.35%), Query Frame = 1
Query:  325 MKISKPILKALMDSNI-----TKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRS-----PNQQ----GRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQ--LVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCS-PT---RQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLK 1413
            +  S P L  L+  NI     TKPTP+Q+  IPI  K +D+ ACA+TGSGKT  FL P+  +L RS     P +      R   P A+VL+PTRELA QI+E A+   KF+ +  V+  +V GG    NQ   +  G D+++ATPGRL D++       L  I++ +LDEAD+MLD  F  QI+ +++ C  P+   RQ ++FSAT   +++ L    L +   + V +    ++N+ Q ++ +      D+++ L+ L+       T+IF+ TK +  ++   L +   K   +H + TQA+R  AL  F   V      D+LV T +AARGLD+ N+  V+NY LP   + Y+HR+GRT R   +G A S    + +N++K
Sbjct:  154 LDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEAR---KFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERG-KVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDM---DKKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANV-----ADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVK 524          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Yeast
Match: HAS1 (ATP-dependent RNA helicase; involved in the biogenesis of 40S and 60S ribosome subunits; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000004903])

HSP 1 Score: 217.624 bits (553), Expect = 7.688e-64
Identity = 139/386 (36.01%), Postives = 214/386 (55.44%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKL----IRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGC-SPTRQVMLFSATMTENVKDLISLSLKDPFKIFVN----QNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKS-GRAISLVAEDERNMLKLICKGSK 1434
            V  F ++K+S+P LKA+     T  T +Q   IP  L  +D+   AKTGSGKTLAFLIP +E L     +  N  G       +V++PTRELALQI+ VA+ L++F  + +  +V GG NR  +   L  G +++IATPGRL+D + NT  F    ++  I+DEAD++L+  F +++++++K   +  RQ MLFSAT T  V+DL  +SL+ P  +F+N     +N  AD L+Q  +   S +   R  +L + + R   K+ I+FL + N       +L    +   ELH    Q +R +    F      N    +L+ TD+AARGLD+  ++ ++ +  P     YIHRVGRTAR  K  G+++  +  +E   L+ + K SK
Sbjct:   41 VEKFEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLHSLKFKPRNGTG------IIVITPTRELALQIFGVARELMEFHSQ-TFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLR-PGPLFINVVPETDNSTADGLEQGYVVCDSDK---RFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFC-----NAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYL-KASK 409          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 217.624 bits (553), Expect = 5.363e-63
Identity = 129/382 (33.77%), Postives = 211/382 (55.24%), Query Frame = 1
Query:  328 KISKPILKALMDSNI-----TKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRS-----PNQQG----RYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQ--LVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPT----RQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLK 1413
            + + P L  L+  NI     TKPTP+Q+  +PI    +D+ ACA+TGSGKT  FL P++ +  ++     P  QG    R   P AV+++PTRELA QI++ AK   KF+ +  V+  +V GG    NQ   +  G D+++ATPGRL D++       L  +++ +LDEAD+MLD  F  QI+ +++ C  T    RQ ++FSAT   +++ L    L D   + V +    ++N+ Q+V+ + +   +D+++ L+ L+       T+IF+ TK +  ++   L +   +   +H + TQ++R  AL  F           +LV T +AARGLD+ N+  V+NY LP   + Y+HR+GRT R   +G A +    +  N++K
Sbjct:  143 EFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAK---KFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERG-KISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN---QDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGA-----ATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENSNIVK 512          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Nematostella
Match: EDO39252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAN9])

HSP 1 Score: 305.834 bits (782), Expect = 1.120e-99
Identity = 153/306 (50.00%), Postives = 213/306 (69.61%), Query Frame = 1
Query:  325 MKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVG 1242
            M +S+P+LKA+ +     PTPIQ + IP+ L  KD+CACA TG+GKT AF++PI+E+L+  P Q       R +V++PTRELA+QI+ V   L K++  + V L +GGL+  +QEA LR   DI+IATPGRL+D +HNT +F L  IE  +LDEAD+MLDE+F +Q+ E++K     RQ MLFSATMT+ V++L++LSL  P ++FV+ N DVA NL+QE IRIR +R EDR A++ AL  R FS   ++FL TK + H++ I+LGL G+   ELH N+TQ QRL+AL +F     +N  VD+L G
Sbjct:    1 MNLSRPLLKAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAI---RVLVITPTRELAIQIHSVTNNLSKYT-NIQVCLAAGGLDLKSQEAALRKNPDIVIATPGRLVDHLHNTMSFGLQSIEILVLDEADRMLDEHFRDQMNEIIKLSPRGRQTMLFSATMTDEVEELVTLSLNQPVRLFVDSNTDVAYNLRQEFIRIRPNREEDRLAIVAALCSRTFSDHCLVFLQTKWMAHKLRIVLGLMGLNADELHGNLTQLQRLEALQKF-----KNGEVDILGG 297          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Nematostella
Match: EDO43011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV2])

HSP 1 Score: 233.802 bits (595), Expect = 3.088e-70
Identity = 142/373 (38.07%), Postives = 210/373 (56.30%), Query Frame = 1
Query:  304 TVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRT-IIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            T  SF  + ++K ++   +   I KPT IQ  C+P  L+ +D   CAKTGSGKT AF +PI++KL   P     Y +  AVVL+PTRELA QI +  K+L +    L   ++ GGL+   Q   L N   ++IATPGRL D I +T   +L KI+F +LDEAD++LD  F + +K +       RQ +LFSAT+T+ + +L  +S   PF   V  +      L Q  +   +H    R+  L+ L+      ++ I+F  T   C  +  M    G+ C  LHS ++Q +RL AL RF     ++  + +LV TD+A+RGLD+  +E VVN ++P   + YIHRVGRTAR  + G AIS+V + + + +K I
Sbjct:    5 TTCSFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDP-----YGI-FAVVLTPTRELAFQIADQFKVLGR-PIGLKEAVIVGGLDMMKQALSLANKPHVVIATPGRLADHIKSTDTLNLKKIQFLVLDEADRLLDPSFGDDLKVIFDAVPEKRQTLLFSATLTDTMGELQKMSGSQPFSYEVQSDIATVAELDQRYLLTPAHV---RDCYLVHLLRENDDNQSVIVFTHTCKNCQVLVSMFHKLGLTCVGLHSLLSQGERLAALARF-----KSGTIKILVATDVASRGLDIPQVELVVNSNIPADPKDYIHRVGRTARAGRGGMAISMVTQYDIDRVKKI 362          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Nematostella
Match: EDO33593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU4])

HSP 1 Score: 220.705 bits (561), Expect = 2.908e-65
Identity = 143/439 (32.57%), Postives = 238/439 (54.21%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYT--EKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMK 1623
            +F  + +   + +A        P+ IQ   IP+ L+ KD+   A+TGSGKT AF +PI++ L+ +P +        A++L+PTRELA QI E  + L      +   ++ GG++  +Q   L     IIIATPGRLID + NT  F L  +++ ++DEAD++L+  F +++ ++LK     R+  LFSATMT+ V+ L   SL+ P K+ V       + LQQ  + I S   + ++  L+ ++        ++F  T N   R+ +ML   G+    LH  M+Q++RL AL +F     +++   +LV TD+A+RGLD+ +++ V+N+ +P   + YIHRVGRTAR  +SGR+++ V + +  + + I            I  ++  + T  E++ L  E V++     RME    + EI  +K     D+ DEQ +K
Sbjct:   15 TFKSLGVVDALCEACKQLGWKTPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILQALLDNPQRL------FALILTPTRELAFQISEQCEAL-GSGIGVKCAVIVGGIDMMSQALMLAKKPHIIIATPGRLIDHLENTKGFSLRTLKYLVMDEADRILNMDFEKEVDKLLKVIPKERRTFLFSATMTKKVQKLQRASLQAPVKVEVATKYQTVEKLQQSYLFIPS---KFKDCYLVYVLNELAGNSFMVFCGTCNNVQRVTLMLRNLGLDAVPLHGQMSQSKRLGALNKF-----KSKSRSILVATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGRSVTFVTQYDVELYQRI---------EHLIAKKLPQYPTVEEEVMLLMERVTEAQRYARME----LREINDKKKRAPEDDLDEQEVK 425          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Nematostella
Match: EDO41969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2R2])

HSP 1 Score: 216.853 bits (551), Expect = 5.837e-62
Identity = 149/440 (33.86%), Postives = 229/440 (52.05%), Query Frame = 1
Query:  229 IVNKKSIDIHQEDKFDFKNILTEYVT--VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVP---RAVVLSPTRELALQIYEVAKMLIKFSPK--LSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVA--DNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLF-----GVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRA-ISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLF 1503
            I  KKS D  Q++  D ++   E  +  V  F D  ISK  L  LM +    PT IQ+  IP+ L  +D+   AKTGSGKTLAFLIPI+E L R      ++T      A+V+SPTRELA Q +EV   L+K   K  LS  L+ GG +  N++  +    +I++ TPGRL+  +  TPNFD   ++  +LDEAD++LD  F   +  +++     RQ +L+SAT T +VKDL  LSL++P  I  ++ +D +  + L Q  +        D+   L + I      + ++F+ +   C ++  +   F     G+    L+    Q +R+     F K         VL  TD+AARGLD   +  V+    P+    YIHR GRTAR QK G++ + L+  +E+ M+K + K  K  +   K++P+ +     K++ F
Sbjct:   21 IDKKKSWDKEQQEMKDLEDRCKEIGSSEVEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPIIETLWRQ-----KWTSMDGLGALVISPTRELAYQTFEV---LVKIGNKHDLSAGLIIGGKDLKNEQKRIMK-TNIVVCTPGRLLQHMDETPNFDCTSLQILVLDEADRILDMGFAPTLNAIIENLPSERQTLLYSATQTRSVKDLARLSLQEPTYISAHEKSDTSTPNRLTQSYVVC---ELPDKLNFLFSFIRNHLKSKILVFVSS---CKQVKFIYEGFRRLQPGIPLMALYGKQKQLKRVAIYDEFCKKTQ-----CVLFATDIAARGLDFPAVNWVIQLDCPEDANTYIHRAGRTARYQKDGQSLLVLLPSEEQEMIKAL-KDKKVPINEIKVNPKKMSSIQSKLESF 439          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Nematostella
Match: EDO45469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RST4])

HSP 1 Score: 217.238 bits (552), Expect = 1.056e-61
Identity = 127/367 (34.60%), Postives = 206/367 (56.13%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQ--QEVIRIRSHRAEDREAMLMALICRGF--SKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDE 1398
              F  + +S P+ K +M      PTPIQ   +P+ +  KD+ A A+TGSGKT AFLIP+ EKL     + G     RA++LSPTRELALQ  +  K L +F+  L   ++ GG +   Q A +    DI++ATPGR + ++       L  +E+ + DEAD++ +  F EQ+ E++     +RQ +LFSAT+   + D     L DP  + ++ +  +++ L+    V  +  + A      LM L+      +++T+IF  TK+    +  ML   G+ C+ ++S++ Q  R   +G+F     ++++  V+V TD+AARG+D+  ++ V+N+  P K + ++HRVGR AR  +SG A SLVA DE
Sbjct:   19 GGFQSLGLSFPVFKGVMKKGYKVPTPIQRKTLPLVMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVG----IRALILSPTRELALQTQKFIKELGRFT-GLKSSVILGGDSLEGQFAAIHTNPDIVVATPGRFLHVVMEM-ELKLSSVEYVVFDEADRLFEMGFAEQLHEIIHRLPESRQTLLFSATLPRLLVDFAKAGLCDPALVRLDVDTKLSEQLKVSDYVFSLELYTA------LMHLLQNVIKPTEQTLIFAATKHHVEYLKEMLLSGGIDCSYVYSSLDQTARTINVGKF-----QHKKTMVMVVTDVAARGIDIPMLDNVINFHFPPKAKLFVHRVGRVARAGRSGTAYSLVANDE 368          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 457.988 bits (1177), Expect = 6.337e-152
Identity = 229/496 (46.17%), Postives = 327/496 (65.93%), Query Frame = 1
Query:  169 FNIIDESKDLEADTLRDITTIVNKKSIDIHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            F   DE    ++DTLRD      K+     +E    F    +++    SF DM +S+PILKA+      +PTPIQ+AC+P+ L  +D+CACA TG+GKT AF++P++E+LI  P       V R +VL PTREL +Q++ VA+ L +F+  ++  L  GGL+  +QEA LR G D++IATPGRLID +HNTPNF+L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMTE VKDL ++SLK P +IFVN N DVA  L+QE IRIR HR  DREA++ AL+ R F    ++F  T+   HR+HI+LGL G+K  ELH  ++Q QRL+ L RF     +++++D+LV TD+AARGLD++ ++TV+N+++P   + Y+HRVGRTAR  +SGR++SLV E ER +LK + K +KN VK R + P+VV  + + I    + V  ++  E+ E+E   +E +L  A K++D     +  +  WF  +  +
Sbjct:  150 FGSSDEEVLTKSDTLRDKGRRGKKRKA--AEEAPESFHEDASQFDDQLSFDDMNLSRPILKAITALGFKQPTPIQKACVPVSLLGRDLCACAATGTGKTAAFMLPVLERLIYKPRTS---QVTRVLVLVPTRELGIQVHSVARQLAQFT-SITTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPNFELSHIEILILDEADRMLDEYFEEQMKEIIRLCSYNRQTMLFSATMTEEVKDLAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAVVAALLTRTFQDHVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRF-----KDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSLVGESERRILKEVVKSAKNSVKARVLPPDVVLKFRDLICKLEKDVEAVMRLEKEERELAASEAKLSVAQKRLDGSASSSESQRVWFQTQQER 634          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 453.751 bits (1166), Expect = 9.590e-151
Identity = 218/448 (48.66%), Postives = 309/448 (68.97%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNK 1656
            SF DM +S+PILKA+      +PTPIQ+AC+P+ L  +D+CACA TG+GKT AF++P++E+LI  P       V R +VL PTREL +Q++ VA+ L +F+  ++  L  GGL+  +QEA LR G D++IATPGRLID +HNTPNF+L  IE  ILDEAD+MLDEYF EQ+KE+++ CS  RQ MLFSATMTE VKDL ++SLK P +IFVN N DVA  L+QE IRIR HR  DREA++ AL+ R F    ++F  T+   HR+HI+LGL G+K  ELH  ++Q QRL+ L RF     +++++D+LV TD+AARGLD++ ++TV+N+++P   + Y+HRVGRTAR  +SGR++SLV E ER +LK + K +KN VK R + P+VV  + + I    + V  ++  E+ E+E   +E +L  A K++D     +  +  WF  +  +
Sbjct:  174 SFDDMNLSRPILKAITALGFKQPTPIQKACVPVSLLGRDLCACAATGTGKTAAFMLPVLERLIYKPRTS---QVTRVLVLVPTRELGIQVHSVARQLAQFT-SITTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPNFELSHIEILILDEADRMLDEYFEEQMKEIIRLCSYNRQTMLFSATMTEEVKDLAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAVVAALLTRTFQDHVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRF-----KDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSLVGESERRILKEVVKSAKNSVKARVLPPDVVLKFRDLICKLEKDVEAVMRLEKEERELAASEAKLSVAQKRLDGSASSSESQRVWFQTQQER 612          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Medaka
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:101159675])

HSP 1 Score: 235.343 bits (599), Expect = 9.104e-70
Identity = 139/384 (36.20%), Postives = 218/384 (56.77%), Query Frame = 1
Query:  274 DFKNILTE--YVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLI 1419
            D K I+ E     V +F D+ ++  + +A        PT IQ   IP+ L+ KD+   A+TGSGKT AF +PI++ L+ SP +         +VL+PTRELA QI E  + L   S  +   ++ GG++  +Q   L     I+IATPGRLID + NT  F L  ++F ++DEAD++L+  F  ++ ++LK     R+  LFSATMT+ V+ L   +LKDP K  V+      D LQQ  + I    A+ ++  L++++        +IF  T N   R+ +ML   G+    LH  M+Q +RL AL +F     +++   VL+ TD+A+RGLD+ +++ V+NY +P   + YIHRVGRTAR  +SG++I+ V + +  + + I
Sbjct:   25 DEKQIIDEDAEAAVKTFKDLGVTDVLCEACDQLGWKSPTKIQVEAIPVALQGKDVIGLAETGSGKTGAFALPILQSLLASPQRL------HTLVLTPTRELAFQISEQFEAL-GSSIGVKCAVIVGGIDMMSQSLVLAKKPHIVIATPGRLIDHMENTKGFSLRALKFLVMDEADRILNMDFETEVDKILKVIPRERRTFLFSATMTKKVQKLQRAALKDPVKCAVSTKYSTVDKLQQYYVFI---PAKYKDCYLVSILNELAGNSFMIFCSTCNNAQRVALMLRNLGITAIPLHGQMSQNKRLGALNKF-----KSKSRSVLLATDVASRGLDIPHVDCVINYDIPTHSKDYIHRVGRTARAGRSGKSITFVTQYDVELFQRI 393          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Medaka
Match: ddx54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:101162145])

HSP 1 Score: 236.113 bits (601), Expect = 3.135e-67
Identity = 132/369 (35.77%), Postives = 210/369 (56.91%), Query Frame = 1
Query:  310 ASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALI--CRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNML 1410
              F  M +S P+ K +M      PTPIQ   IP+ L  KD+ A A+TGSGKT AFL+P+ EKL       G     RA+++SPTRELALQ  +  K L KF+  L   L+ GG    +Q A L    DIII TPGRL+ ++    N  L  +E+ + DEAD++ +  F EQ++E+++    TRQ +LFSAT+ + + +     L +P  I ++ ++ ++D ++     +   R +D+ AML+ L+       ++T++F+ TK+    +  +L   G++CA ++S + Q  R   +G+F      + +  VL+ TD+AARG+D+  ++ V+NY+ P K + ++HRVGR  R  +SG   SL+  DE   L
Sbjct:   77 GGFQSMGLSYPVYKGVMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPMFEKLKAPQASAG----ARALIMSPTRELALQTMKFTKELGKFA-GLKTALILGGDRMEDQFAALHENPDIIIGTPGRLMHVVKEM-NLKLHSVEYVVFDEADRLFEMGFAEQLQEIIQRLPDTRQTLLFSATLPKLLVEFARAGLTEPVLIRLDVDSKLSDQIKLSFFHL---RVDDKPAMLLHLLKNVAKPQEQTVVFVATKHHVEYLRELLSSEGIECAYIYSALDQTARKINIGKFV-----HRKAMVLIVTDVAARGIDIPMLDIVINYNFPSKPKLFLHRVGRVGRAGRSGTTYSLICPDEMPFL 431          
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Medaka
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:101169189])

HSP 1 Score: 219.164 bits (557), Expect = 6.347e-64
Identity = 137/385 (35.58%), Postives = 217/385 (56.36%), Query Frame = 1
Query:  307 VASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEY---FIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-----TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKN 1437
            +  F  + +S  ++K      I KPTP+QE C+P  L+ +D   CAKTGSGKT AF++P+++KL   P     Y +   +VL+PTRELA QI E  ++L K    L   +V GG++   Q   L     +++ATPGRL D + ++  F + KI+F ILDEAD++L++    F + ++E+L      RQ +LFSAT+T+ +++L S+++  PF           + L Q  I +   + +D  A L+ LI + F+ +      IIF  T   C  + +ML  F      LHS M Q QR   L +F  +V       +L+ TD+AARGLD+  ++ V+N++ P   + YIHRVGRTAR  ++G +I+LV + + +++  I + +K 
Sbjct:    1 MGDFHSLGLSDWLVKQCKQLGIDKPTPVQENCVPAILEGRDCLGCAKTGSGKTAAFVLPVLQKLSEDP-----YGI-FCLVLTPTRELAYQIAEQFRVLGK-PLGLKDCIVVGGMDMVTQALELSKQPHVVVATPGRLADHVRSSNTFSMRKIKFLILDEADRLLEQGCTDFTKDLEEILGTLPAKRQTLLFSATLTDTLQELKSIAMNKPFFWESTSETRTVEELDQRYI-LTPEKVKD--AYLVHLI-QTFTDKHDDWSIIIFTNTCKNCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKASV-----YKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVHSIEEQTKT 369          
BLAST of ATP-dependent RNA helicase DRS1 vs. Planmine SMEST
Match: SMESG000072404.1 (SMESG000072404.1)

HSP 1 Score: 1148.27 bits (2969), Expect = 0.000e+0
Identity = 568/570 (99.65%), Postives = 569/570 (99.82%), Query Frame = 1
Query:   19 MEFAGDFQFDLAVVPNFQIANPITEEKPAEIYRGKVVDRLIDEHRTQLECFNIIDESKDLEADTLRDITTIVNKKSIDIHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNKGNIIXXXXXXXXXXDDHDSEDEMQ 1728
            MEFAGDFQFDLAVVPNFQIANPITEEKPAEIYRGKVVDRLIDEHRTQLECFNIIDESKDLEADTLRDITTIVNKKSID+HQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKE QIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNKGNIIKRVREVKRKRDDHDSEDEMQ
Sbjct:    1 MEFAGDFQFDLAVVPNFQIANPITEEKPAEIYRGKVVDRLIDEHRTQLECFNIIDESKDLEADTLRDITTIVNKKSIDVHQEDKFDFKNILTEYVTVASFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIESERMEKETQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNKGNIIKRVREVKRKRDDHDSEDEMQ 570          
BLAST of ATP-dependent RNA helicase DRS1 vs. Planmine SMEST
Match: SMESG000018018.1 (SMESG000018018.1)

HSP 1 Score: 213.001 bits (541), Expect = 7.891e-62
Identity = 139/408 (34.07%), Postives = 226/408 (55.39%), Query Frame = 1
Query:  316 FMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNT---PNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISL--------SLKDPFKIFVNQNND-----VADNLQQEVIRIRSHRAEDREAMLMALICRGF----SKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDF 1479
            F  + +++ ++K L +  I KPT +QE CIP+ L+ KD+ ACAKTGSGKT AFLIPI++ LI   + +  Y     V+L+PTRELA QI E AK L+         +++GG +   Q A L +   I+IATPGRL  +I +      + L + ++ +LDEAD++L++ F E +K +    S  R+ +LF+AT+T  V D++ +        + + P     +   D       D L+Q  I     + ++ EA++  ++ +      S   +IF      C  +H+ML  F  K   LHS MT+ +R ++L +F     ++  V ++V TDLA+RGLD+  ++ V+N+++P   + Y+HRVGRTAR+ ++G +I++    E+  LK I +    G +M K   E  D 
Sbjct:    2 FKKIGVTEDVIKLLENKKIIKPTEVQEHCIPLVLQGKDVIACAKTGSGKTAAFLIPIIQNLI--VDIKPYY----CVILTPTRELAHQIGEQAKGLLVSQNLAKTIVITGGKDLIKQGADLTSSYHILIATPGRLAHLIRDNEEREEWSLKRCKYLVLDEADRLLEDNFGEDLKVIFDSLSTKRKTLLFTATLTGPVLDVVKIITDTAIANNREVPVIWRASGMTDESKATTVDTLKQYYIL---SKMQNNEAIMFYIVDKFLQQNPSSLIMIFTNKCKWCQMLHMMLKAFKFKTVMLHSVMTEKEREESLMKF-----KSSTVRIMVATDLASRGLDIPRVDLVINHNVPINPKSYVHRVGRTARSGRAGTSITMANLFEKESLKKIQQYI--GCEMEKYPIETTDL 393          
BLAST of ATP-dependent RNA helicase DRS1 vs. Planmine SMEST
Match: SMESG000060345.1 (SMESG000060345.1)

HSP 1 Score: 213.772 bits (543), Expect = 1.717e-61
Identity = 143/443 (32.28%), Postives = 233/443 (52.60%), Query Frame = 1
Query:  313 SFMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMT-------------------------ENVKDLISLSLKDPFKIF-----------VNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVSQIIES 1533
            +F ++ I++ I KAL D N+ K TPIQ  CIP  L+NKD+   AKTGSGKTLAFL+P+V K++ S N + R+    A+++SPTREL++Q +EV + L+  + +L   L+ GG NR  +   L+ G  I++ATPGRL+D ++NT  F   +++  I+DEAD+++++ F+E++  +++     RQ +LFSAT+                          E V  L  LS+K+   +            V  +N     L Q  +     +  DR  +L   I +   K+ ++F+ T       + +  +  V    LH   +Q +RL    +F    +ENE   ++  TD+AARGLD+  ++ V+ Y  P   ++YIHRVGRTAR   +G+A+  +  +E + L L+ K         K+     +F   K+    E+  +I+ES
Sbjct:   17 NFEELNINENIKKALKDMNMIKMTPIQGRCIPHLLENKDVMGAAKTGSGKTLAFLVPLVNKVLNS-NFEPRHGTA-AIIMSPTRELSVQTFEVLRKLVVHT-ELRTGLLIGGNNRQVEAKYLQEGVTILVATPGRLLDHLNNTKFFLFHRLQTLIIDEADRLMEQGFLEEMTAIVRKLPKKRQTVLFSATLKMSSAKLKMKMKKPEIDKRSSKVSTEEKVLTLACLSMKENCMLIDMSKEKLEANVVGGDNATVSQLSQGYVVC---KPSDRFRLLYTFIKKNQKKKIMVFMSTCLEVKYFYELFNIINVPVLALHGKQSQPKRLKNFEKF----NENEAA-IIFCTDVAARGLDIPLVDWVLQYDPPDDPKEYIHRVGRTARAGNAGQALIFLRPEETDFLSLLAKN--------KVPVTEFEFDESKMLPIQESYEKIVES 440          
BLAST of ATP-dependent RNA helicase DRS1 vs. Planmine SMEST
Match: SMESG000078563.1 (SMESG000078563.1)

HSP 1 Score: 207.994 bits (528), Expect = 1.071e-58
Identity = 134/372 (36.02%), Postives = 210/372 (56.45%), Query Frame = 1
Query:  316 FMDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPI----VEKLIRSP--NQQGRYTVPRAVVLSPTRELALQIYEVAKMLI-------KFSPKLSVQLVSGGLNRSNQ-EACLRNGADIIIATPGRLIDIIHNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKR-TIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLV 1386
            F +M++ KP+L+ L D  I  PT IQ   +P+ L  +D+   A TGSGKTL F +P+    VE+ +  P  + +G    P  +++ P+RELA Q +++   L        K  PK++  L  GG +  +Q E C RNG  +++ATPGRLID++ +   F+L    + +LDEAD+M+D  F E+I++V       +Q +LFSATM + +++    +L  P  + V +    + N++Q+V  ++    EDR   L  L C   +K   IIF   K+    IH  L + GV    +HS M Q +RL ++  F KT ++    DVLV TD+A +GLD   I  V+NY +P+  E Y+HR+GRT R++K+G A + +
Sbjct:  172 FEEMRLPKPVLRILKDKEIITPTSIQMQGLPVVLSGRDMIGIASTGSGKTLVFSLPLILFNVEQEMNLPFMDNEG----PFGLIIGPSRELASQTHKIITELSNEIHKEKKSFPKINSVLCIGGTSIKDQIEKCKRNGIHVVVATPGRLIDLL-DKKAFNLNICRYLVLDEADRMIDMGFEEEIRKVFSYFKHQKQTLLFSATMPKKIQEFAKSALVKPVIVNVGRAGAASMNIRQDVEYVKH---EDRLQRL--LWCLQKTKPPVIIFTEQKSEVDFIHEYLLIKGVSTTSIHSGMVQEERLRSVESF-KTGEK----DVLVATDVAGKGLDFPKIRQVINYDMPEDIEIYVHRIGRTGRHKKTGVATTFI 528          
BLAST of ATP-dependent RNA helicase DRS1 vs. Planmine SMEST
Match: SMESG000075674.1 (SMESG000075674.1)

HSP 1 Score: 211.846 bits (538), Expect = 1.492e-58
Identity = 127/395 (32.15%), Postives = 212/395 (53.67%), Query Frame = 1
Query:  331 ISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRYTV---PRAVVLSPTRELALQIYEVAKMLIKFSPKLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDII--HNTPNFDLLKIEFFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLSLKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICR-GFSKRTIIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDENERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSGRAISLVAEDERNMLKLICKGSK-NGVKMRKIDPEVVDFYTEKI 1494
            +S  IL AL  + + +PTPIQ   IP  +  KD+   AKTGSGKTL++L+P++  +   PN     TV   P A+VL PTREL++QI++  + +      ++   + GG + + Q + L+ G +I++ TPGR+IDI+  +   N  L +  F +LDEAD+M D  F  Q+  ++    P RQ ++FSAT    ++ +    +K+P ++ V+  N V  ++ Q V  +  +   D+   L+ L+    +  ++++F+ T+     +   L   G + + +H  +TQ +R + +  F         V +L+ T +AARGLDV ++  VVNY  P  YE Y+HR GRT R    G + + V  D+  M+  + K  K NG ++     E    YTE++
Sbjct:  288 VSMKILNALKYNKMNEPTPIQSQTIPAIMSGKDVIGIAKTGSGKTLSYLLPLIRHIHNQPN----VTVGEGPIAIVLCPTRELSIQIHQEIEKITYALRDVNCGCIYGGADTAQQISRLKRGVEIVVGTPGRIIDIMATNGGRNLSLSRCTFIVLDEADRMFDMGFEPQVMAIISRIRPDRQTVMFSATFPRRIEAVAKKIMKEPIEVRVDGGNKVCTDVVQHVYLLDEN---DKFLKLVELLSEFKYRGKSLVFVETQETAQILSSNLTHQGFEVSMIHGGLTQEKREEGMFNFKSGT-----VPILIATSIAARGLDVNDLMMVVNYDCPNHYEDYVHRCGRTGRAGNKGYSYTFVTSDQEVMIGNLIKALKENGQEIPGELTEAYARYTERM 670          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX276.562e-15149.02DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX272.158e-15049.02DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX272.158e-15049.02DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX279.510e-7449.22DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX471.489e-6636.12DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-278.619e-14749.33DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
T26G10.14.472e-7037.22Putative ATP-dependent RNA helicase T26G10.1 [Sou... [more]
H20J04.45.226e-6332.71pep chromosome:WBcel235:II:4329023:4334091:1 gene:... [more]
H20J04.45.226e-6332.71pep chromosome:WBcel235:II:4329023:4334484:1 gene:... [more]
H20J04.46.347e-6335.16pep chromosome:WBcel235:II:4329023:4332507:1 gene:... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rs11.737e-13845.47gene:FBgn0021995 transcript:FBtr0345935[more]
Rs11.737e-13845.47gene:FBgn0021995 transcript:FBtr0088788[more]
CG92534.733e-6536.67gene:FBgn0032919 transcript:FBtr0081468[more]
vas1.573e-5833.33gene:FBgn0283442 transcript:FBtr0445187[more]
vas1.573e-5833.33gene:FBgn0283442 transcript:FBtr0445185[more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx271.383e-15146.91DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
ddx546.899e-6837.70DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:... [more]
ddx491.288e-6035.70DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
ddx231.077e-5832.75DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx101.293e-5831.60DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX271.271e-15248.88DEAD-box helicase 27 [Source:NCBI gene;Acc:1001017... [more]
DDX272.285e-15247.65DEAD-box helicase 27 [Source:NCBI gene;Acc:1001017... [more]
DDX273.409e-15247.65DEAD-box helicase 27 [Source:NCBI gene;Acc:1001017... [more]
DDX273.575e-15147.02DEAD-box helicase 27 [Source:NCBI gene;Acc:1001017... [more]
DDX277.320e-15147.02DEAD-box helicase 27 [Source:NCBI gene;Acc:1001017... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx275.573e-14749.45DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
Ddx471.376e-6533.41DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx546.544e-6536.89DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:... [more]
Ddx491.797e-6234.30DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
Ddx232.776e-6034.09DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96GQ7|DDX27_HUMAN1.036e-14949.02Probable ATP-dependent RNA helicase DDX27 OS=Homo ... [more]
sp|A1A4H6|DDX27_BOVIN2.328e-14949.02Probable ATP-dependent RNA helicase DDX27 OS=Bos t... [more]
sp|Q921N6|DDX27_MOUSE3.899e-14649.45Probable ATP-dependent RNA helicase DDX27 OS=Mus m... [more]
sp|Q9ZRZ8|RH28_ARATH1.349e-11442.21DEAD-box ATP-dependent RNA helicase 28 OS=Arabidop... [more]
sp|A7TJM9|DRS1_VANPO9.567e-11141.56ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KJG24.258e-17550.20Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2KFA66.815e-17550.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NFT71.041e-17446.90ATP-dependent RNA helicase DDX27 OS=Paragonimus we... [more]
A0A4S2KIT15.717e-17450.82Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2CY352.440e-17346.44Putative ATP-dependent RNA helicase DDX27 OS=Schis... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx277.719e-15348.57DEAD-box helicase 27 [Source:NCBI gene;Acc:1030322... [more]
ddx278.976e-15347.58DEAD-box helicase 27 [Source:NCBI gene;Acc:1030322... [more]
ddx547.826e-7037.70DEAD-box helicase 54 [Source:NCBI gene;Acc:1030469... [more]
ddx476.806e-6735.31DEAD-box helicase 47 [Source:NCBI gene;Acc:1030345... [more]
ddx493.813e-6135.19DEAD-box helicase 49 [Source:NCBI gene;Acc:1030432... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx271.552e-13447.44DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
DDX541.377e-7137.43DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSPMAT00000000216.11.011e-6534.69pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ENSPMAT00000003898.11.144e-6034.02pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx498.156e-5934.90DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DRS17.663e-10739.74Nucleolar DEAD-box protein required for ribosome a... [more]
RRP31.220e-6638.95Protein involved in rRNA processing; required for ... [more]
DBP16.446e-6436.03Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
HAS17.688e-6436.01ATP-dependent RNA helicase; involved in the biogen... [more]
DED15.363e-6333.77ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392521.120e-9950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430113.088e-7038.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335932.908e-6532.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419695.837e-6233.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454691.056e-6134.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx276.337e-15246.17DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
ddx279.590e-15148.66DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
ddx479.104e-7036.20DEAD-box helicase 47 [Source:NCBI gene;Acc:1011596... [more]
ddx543.135e-6735.77DEAD-box helicase 54 [Source:NCBI gene;Acc:1011621... [more]
ddx496.347e-6435.58DEAD-box helicase 49 [Source:NCBI gene;Acc:1011691... [more]
back to top
BLAST of ATP-dependent RNA helicase DRS1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072404.10.000e+099.65SMESG000072404.1[more]
SMESG000018018.17.891e-6234.07SMESG000018018.1[more]
SMESG000060345.11.717e-6132.28SMESG000060345.1[more]
SMESG000078563.11.071e-5836.02SMESG000078563.1[more]
SMESG000075674.11.492e-5832.15SMESG000075674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010089 ID=SMED30010089|Name=ATP-dependent RNA helicase DRS1|organism=Schmidtea mediterranea sexual|type=transcript|length=1900bp
TTTATTTAATTTTCTCGCATGGAATTTGCAGGCGATTTTCAATTTGATTT
AGCAGTGGTTCCTAATTTTCAAATAGCCAATCCAATAACTGAGGAAAAGC
CCGCTGAAATTTATCGTGGTAAAGTTGTTGATAGACTAATTGATGAACAC
AGGACACAATTAGAATGTTTTAATATTATCGATGAGAGTAAAGACTTGGA
AGCAGATACTCTTAGAGATATTACCACAATTGTTAACAAAAAGTCTATTG
ATATTCACCAGGAAGACAAGTTCGATTTCAAAAATATTTTAACAGAATAT
GTCACTGTTGCATCTTTTATGGACATGAAGATTTCAAAACCGATTCTAAA
GGCTTTAATGGATTCTAATATAACCAAACCGACACCAATCCAAGAAGCTT
GCATACCAATCGGGTTAAAAAATAAGGATATTTGTGCGTGTGCTAAAACC
GGCAGTGGGAAAACATTAGCGTTTTTAATTCCGATCGTTGAAAAACTCAT
CCGATCACCTAATCAACAAGGTCGCTATACCGTTCCTAGGGCAGTGGTTT
TAAGTCCAACAAGAGAACTCGCTCTTCAGATTTACGAAGTCGCTAAAATG
CTCATCAAATTCTCGCCGAAACTATCGGTTCAACTCGTTTCCGGAGGACT
GAATCGCAGTAATCAAGAGGCATGTCTGAGAAACGGAGCCGATATAATCA
TAGCCACTCCAGGCCGATTGATCGACATAATCCACAACACCCCGAATTTC
GATCTATTGAAAATTGAATTTTTCATCCTGGACGAGGCTGACAAAATGTT
AGACGAGTATTTCATCGAACAGATCAAAGAAGTTCTCAAAGGATGCTCAC
CGACCCGGCAAGTCATGCTGTTCTCGGCTACCATGACTGAGAACGTTAAA
GATCTAATTTCTCTCAGCTTAAAAGACCCGTTTAAAATCTTCGTCAATCA
AAACAATGACGTCGCCGATAATCTCCAACAGGAAGTCATCCGAATCCGAT
CTCATCGCGCTGAAGATCGAGAAGCAATGCTAATGGCGCTGATTTGTCGG
GGATTTTCCAAGCGAACTATAATTTTCCTTCCAACGAAAAACCTTTGCCA
CCGGATCCACATAATGCTGGGTTTGTTTGGGGTGAAATGCGCCGAGCTCC
ATAGCAACATGACCCAAGCCCAAAGGCTCGATGCGTTGGGTAGATTTGCA
AAAACCGTCGATGAGAACGAACGGGTCGATGTGCTAGTTGGAACGGATTT
GGCAGCCAGAGGTTTGGATGTGGAAAACATAGAAACCGTTGTCAACTATT
CTCTGCCGAAAAAGTACGAACAATATATCCATCGGGTCGGTCGAACGGCG
AGAAATCAAAAATCCGGTCGCGCGATTTCATTGGTCGCTGAAGATGAGAG
GAACATGTTGAAGCTGATTTGCAAGGGCTCGAAAAATGGAGTTAAAATGA
GAAAAATCGATCCGGAAGTTGTGGATTTTTACACTGAGAAAATCAAATTG
TTCAGTGAAACTGTTAGTCAAATCATTGAGTCGGAACGGATGGAGAAAGA
GGCACAAATAGCGGAAATTGAATTGGAAAAGGCCATGAAGAAAGTCGATA
ACGGGGATGAACAGGCGATGAAACGATTCAATTGGTTCAGTAATAGGGAC
AACAAAGGCAATATTATAAAGCGGGTAAGAGAGGTGAAACGAAAGAGAGA
TGACCACGATAGTGAGGATGAAATGCAATCTAAAAACAAAAAATCAAAGA
AAGATTTCTCAAAAAAAAATCATTTCTCGCGTAAAATTGAAAAAGAATCC
AAAAAGAAAAAGTCAATAATTCCGAAACATAGAAAAAAATGATAAATAAA
TAAACATTTGATTTCGCTTAGTTTTTTTTATTTGTTGTAAGTTTATTTGT
back to top

protein sequence of SMED30010089-orf-1

>SMED30010089-orf-1 ID=SMED30010089-orf-1|Name=SMED30010089-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=608bp
MEFAGDFQFDLAVVPNFQIANPITEEKPAEIYRGKVVDRLIDEHRTQLEC
FNIIDESKDLEADTLRDITTIVNKKSIDIHQEDKFDFKNILTEYVTVASF
MDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTL
AFLIPIVEKLIRSPNQQGRYTVPRAVVLSPTRELALQIYEVAKMLIKFSP
KLSVQLVSGGLNRSNQEACLRNGADIIIATPGRLIDIIHNTPNFDLLKIE
FFILDEADKMLDEYFIEQIKEVLKGCSPTRQVMLFSATMTENVKDLISLS
LKDPFKIFVNQNNDVADNLQQEVIRIRSHRAEDREAMLMALICRGFSKRT
IIFLPTKNLCHRIHIMLGLFGVKCAELHSNMTQAQRLDALGRFAKTVDEN
ERVDVLVGTDLAARGLDVENIETVVNYSLPKKYEQYIHRVGRTARNQKSG
RAISLVAEDERNMLKLICKGSKNGVKMRKIDPEVVDFYTEKIKLFSETVS
QIIESERMEKEAQIAEIELEKAMKKVDNGDEQAMKRFNWFSNRDNKGNII
KRVREVKRKRDDHDSEDEMQSKNKKSKKDFSKKNHFSRKIEKESKKKKSI
IPKHRKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0010501RNA secondary structure unwinding
GO:0042254ribosome biogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 500..525
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 313..546
e-value: 8.2E-44
score: 152.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 55..311
e-value: 2.4E-76
score: 258.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 550..607
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 550..575
NoneNo IPR availablePANTHERPTHR24031:SF637ATP-DEPENDENT RNA HELICASE DDX27-RELATEDcoord: 37..501
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 37..501
NoneNo IPR availableCDDcd17947DEADc_DDX27coord: 109..308
e-value: 1.52562E-93
score: 283.762
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 319..456
e-value: 3.77825E-45
score: 154.202
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 117..322
e-value: 2.8E-56
score: 203.0
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 129..307
score: 31.138
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 361..447
e-value: 1.3E-23
score: 94.4
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 337..446
e-value: 2.1E-25
score: 89.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 318..488
score: 19.024
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 122..296
e-value: 5.1E-47
score: 159.9
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 253..261
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 98..126
score: 10.993
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 249..463
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 93..309