Sodium/potassium-transporting ATPase subunit alpha

Overview
NameSodium/potassium-transporting ATPase subunit alpha
Smed IDSMED30010071
Length (bp)3187
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/potassium-transporting ATPase subunit alpha (SMED30010071) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit alpha (SMED30010071) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/potassium-transporting ATPase subunit alpha (SMED30010071) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit alpha (SMED30010071) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010071

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30010071SMESG000008146.1 dd_Smed_v4_3749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30010071SMESG000008146.1 dd_Smed_v6_3749_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010071SMESG000008146.1 dd_Smed_v4_3749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30010071SMESG000008146.1 dd_Smed_v4_3749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010071SMESG000008146.1 dd_Smed_v4_3749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A2 (ATPase Na+/K+ transporting subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:800])

HSP 1 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 624/984 (63.41%), Postives = 767/984 (77.95%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++  D H + ++EL  + + D   GLT   A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++  + DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIRE E  +++   +VVGD+VEVK GDR+PAD+RII +   KVDNS+LTGESEPQ+R+PE T+EN LET NI FFSTN VEGT RGI+I+ GD T+MGRIA L SGL+ GRTPI  EI HF+ +IT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FKA QE+  V KR+ +GDASESALLKC E S G+  K R+ N K+ EIPFNS NKYQ+SIHE  D    ++LVMKGAPERIL++C+TIL+   E  +D   +D F NAYMELGG+GERVLGFC   L + +FP+GF+FDTDE+NFP + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+MTSEQLDEILK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+    KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+R+ W+ +T+NDL+DSY QEWTY QRK +E+TC+T+FF +I+V QW +L++ KTRRNS+FQ GM N  L F +  ET LA FL YCPGM + L+M PL+ TWW  A P+ + +FI+DE +K I+ +     W+ +E
Sbjct:   35 KEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPMSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKE 1017          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1258.82 bits (3256), Expect = 0.000e+0
Identity = 616/985 (62.54%), Postives = 773/985 (78.48%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++C+TIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   40 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1023          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 616/985 (62.54%), Postives = 773/985 (78.48%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++C+TIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 616/985 (62.54%), Postives = 773/985 (78.48%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++C+TIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   38 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1021          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: AC010616.1 (novel protein, ATP1A3-RABAC1 readthrough)

HSP 1 Score: 1256.89 bits (3251), Expect = 0.000e+0
Identity = 614/976 (62.91%), Postives = 769/976 (78.79%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKS 3075
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++C+TIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRN 1002          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: eat-6 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:P90735])

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 616/984 (62.60%), Postives = 771/984 (78.35%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +++  D H +PIEEL  RL ++  TGLT+ +A+  L  +GPNAL PP+  PE +KF K L GGF++LL  GAILC+IAY + Y      ++DNLYLG VL+ +V+ TG F YYQE+KSS I+ SF  MVP  + V R+ +  +V T  LVVGD+VEVK GDR+PAD+R++ A  FKVDNS+LTGESEPQSR+P+CTNEN LET NIAFFSTNAVEGT +GI+I  GDNT+MGRIAHL SGL  G TPI REI HF+++IT + + LG+ FFIIA  LGY+WL  ++FLIGIIVA +P GL+ATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH WY   IHE   +E++  +++    A+++ L+RIA LCNRA+FKA Q+D  + +R+C+GDASE ALLK  E + GN    RE NKKI EIPFNS NKYQVSIH+  D    YLLVMKGAPERIL+ C+TI +   E E+ D  +++FN AY+ELGGMGERVLGFCD+ L A +FPKGF+FD +EVNFPLK LRF GL+SMIDPPR +VPDAV KCRSAGIKV+MVTGDHPITAKAI+++VGII  G++T+ED+A  + IP+ EVNPR+A A V+HGSDL+EM+ +QL EI+KYH+EIVFARTSPQQKL IV+G Q+QG IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR+IFDNLKK++ Y     IPE+ PFL YI   IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PRDP++ KLV ERLISL + Q+G+I+A+   F YF IMA+ GF+P  L  LR QW+++  N++ DSY QEWTYA RK LEYTC T++F++I+V QW +L++ KTRRNS+ Q GM N  L F + FET LA F+ YCPG+D  L+M  LRF+WW  A+PF + +F++DE +++++ +     W+ RE
Sbjct:   15 QEVKMDEHIVPIEELVARLGTNLETGLTRQKAQEVLAKNGPNALSPPETTPEWIKFCKNLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKSSKIMDSFKNMVPTFALVHRDGQKQQVKTEELVVGDIVEVKGGDRVPADLRVVSAFGFKVDNSSLTGESEPQSRSPDCTNENPLETRNIAFFSTNAVEGTAKGIVIYTGDNTVMGRIAHLASGLDTGMTPIAREIEHFIHLITGVAVFLGISFFIIAFILGYHWLTAVVFLIGIIVANVPEGLIATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWYDETIHECDTTETQTSQEK-RTGASFEALVRIASLCNRAEFKAGQQDTPILRRDCTGDASEIALLKFTELTQGNVIAVREKNKKIAEIPFNSTNKYQVSIHDNGD---HYLLVMKGAPERILDVCSTIFLNGKESELTDKLREDFNTAYLELGGMGERVLGFCDFVLPADKFPKGFKFDVEEVNFPLKNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLREMSEDQLAEIIKYHSEIVFARTSPQQKLMIVEGFQKQGQIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVVGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLTYILFGIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRQPRDPIRDKLVNERLISLAYGQIGMIQASAGFFTYFWIMADNGFMPWDLYQLRAQWDSRAYNNVLDSYGQEWTYANRKILEYTCQTAYFVSIVVVQWADLIISKTRRNSLVQQGMSNWTLNFGLVFETALAWFMCYCPGLDNGLRMYGLRFSWWFCALPFSILIFVYDEIRRFLIRRYPGG-WVERE 993          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: eat-6 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:P90735])

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 616/984 (62.60%), Postives = 771/984 (78.35%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +++  D H +PIEEL  RL ++  TGLT+ +A+  L  +GPNAL PP+  PE +KF K L GGF++LL  GAILC+IAY + Y      ++DNLYLG VL+ +V+ TG F YYQE+KSS I+ SF  MVP  + V R+ +  +V T  LVVGD+VEVK GDR+PAD+R++ A  FKVDNS+LTGESEPQSR+P+CTNEN LET NIAFFSTNAVEGT +GI+I  GDNT+MGRIAHL SGL  G TPI REI HF+++IT + + LG+ FFIIA  LGY+WL  ++FLIGIIVA +P GL+ATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH WY   IHE   +E++  +++    A+++ L+RIA LCNRA+FKA Q+D  + +R+C+GDASE ALLK  E + GN    RE NKKI EIPFNS NKYQVSIH+  D    YLLVMKGAPERIL+ C+TI +   E E+ D  +++FN AY+ELGGMGERVLGFCD+ L A +FPKGF+FD +EVNFPLK LRF GL+SMIDPPR +VPDAV KCRSAGIKV+MVTGDHPITAKAI+++VGII  G++T+ED+A  + IP+ EVNPR+A A V+HGSDL+EM+ +QL EI+KYH+EIVFARTSPQQKL IV+G Q+QG IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR+IFDNLKK++ Y     IPE+ PFL YI   IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PRDP++ KLV ERLISL + Q+G+I+A+   F YF IMA+ GF+P  L  LR QW+++  N++ DSY QEWTYA RK LEYTC T++F++I+V QW +L++ KTRRNS+ Q GM N  L F + FET LA F+ YCPG+D  L+M  LRF+WW  A+PF + +F++DE +++++ +     W+ RE
Sbjct:   15 QEVKMDEHIVPIEELVARLGTNLETGLTRQKAQEVLAKNGPNALSPPETTPEWIKFCKNLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKSSKIMDSFKNMVPTFALVHRDGQKQQVKTEELVVGDIVEVKGGDRVPADLRVVSAFGFKVDNSSLTGESEPQSRSPDCTNENPLETRNIAFFSTNAVEGTAKGIVIYTGDNTVMGRIAHLASGLDTGMTPIAREIEHFIHLITGVAVFLGISFFIIAFILGYHWLTAVVFLIGIIVANVPEGLIATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWYDETIHECDTTETQTSQEK-RTGASFEALVRIASLCNRAEFKAGQQDTPILRRDCTGDASEIALLKFTELTQGNVIAVREKNKKIAEIPFNSTNKYQVSIHDNGD---HYLLVMKGAPERILDVCSTIFLNGKESELTDKLREDFNTAYLELGGMGERVLGFCDFVLPADKFPKGFKFDVEEVNFPLKNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLREMSEDQLAEIIKYHSEIVFARTSPQQKLMIVEGFQKQGQIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVVGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLTYILFGIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRQPRDPIRDKLVNERLISLAYGQIGMIQASAGFFTYFWIMADNGFMPWDLYQLRAQWDSRAYNNVLDSYGQEWTYANRKILEYTCQTAYFVSIVVVQWADLIISKTRRNSLVQQGMSNWTLNFGLVFETALAWFMCYCPGLDNGLRMYGLRFSWWFCALPFSILIFVYDEIRRFLIRRYPGG-WVERE 993          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: catp-4 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:G5EFV6])

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 468/997 (46.94%), Postives = 660/997 (66.20%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYL--IQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHE---YPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSS--KYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDL-AHEKNIPISEV-----NPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            KD+  D H IP++ L++R  +    G+++ EA  RL  DGPNAL PPK+  + +K    + GGF+ LL   A    + Y   +    D  V +DN+Y+  +L  +V  TG F +YQ  KS  ++ SF  M+P K+ V+R+    E++  +LVVGD+V  + GDR+PAD+R+  A   KVDNS+LTGESEPQ+R   CT++N LET N+  FST+ +EG+  GIII  GD T +GRIA LT+ +  G TP+ +EINHF+ II+++  T+G+ FFI+AL   Y  L  I+F +GI+VA +P G++ TVTV LTLTA +M +K CLVK L+AVETLGSTS ICSDKTGTLTQN MTV H W+  +I +    P ++    E + E   ++Q LLR A LC+R+ F+  + D  + KR  +GDASE A+++  E   G+    ++R+   KI EIPFNS NKYQ+SIH  +    + +LVMKGAPE+IL+ C+T         +   ++ EF  AY  LG  GERVLGFCD  +  T+FP GF+F+ +E NFP+K LRF GLISMIDPPRP VP+AV  C++AGI+V+MVTGDHPITA+AI+  V II +  +  E + A  K  P S+        +   A V+HG  L  M+ + L  ++  +++IVFARTSP QKLQIV+  Q  G+IV VTGDGVND+PAL+KADIGIAMGI+G+DVSKQAADMILL+DNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PF+ Y+   +PLP+  + IL ID+GTD+ P+IS AYE  ES+IM+R PR+P+  KLV +RL+  ++ Q+G I+A      YF++M   G+ P  L+ +  QW+ + I+DL+DSY Q+W+Y  RK LE  CY +FF  I+V QW +L   KTR+NS+   GM N+ L  ++ F   LA+F++  P ++ +L +Q  R     +A+PF  ++ ++DE ++Y + ++    +I +E
Sbjct:   19 KDVVIDDHEIPLDALFKRYTTSEKNGISEAEATNRLNRDGPNALTPPKQTSKWIKLAGSIFGGFNFLLWCAASASAVGYGMDLSMSDDEEVPKDNMYMAIILATVVTVTGLFDFYQNRKSGNLMDSFANMIPPKTLVVRDGATREIEVKDLVVGDLVRFRGGDRVPADLRVTLARGLKVDNSSLTGESEPQTRNMNCTSKNALETKNLCMFSTSVLEGSGEGIIIGTGDRTFVGRIAALTTQVDPGPTPLAKEINHFIKIISIVAFTVGIAFFILALVYEYPPLKAIVFFMGIVVANVPEGIVPTVTVSLTLTAVKMRKKFCLVKKLQAVETLGSTSTICSDKTGTLTQNRMTVTHLWFDGKIKDTEILPPNDHFKGEKKYEKEDSYQKLLRCATLCSRSHFRVPEFDVPLAKRVVNGDASEVAIMRYCEMIRGDGQVDEFRKIMPKIGEIPFNSTNKYQLSIHPMSKK--QNILVMKGAPEKILKLCSTYYQNGETKNVSKKFEKEFQQAYETLGSYGERVLGFCDLEMSTTKFPPGFKFNMEEPNFPIKNLRFLGLISMIDPPRPGVPEAVRVCQNAGIRVVMVTGDHPITARAIANQVHIIEENVQVTEIVNADPKCDPASDEIYGKGRLKPTGAVVIHGEQLTTMSPKTLKAVVTNYHQIVFARTSPAQKLQIVEAFQSVGNIVGVTGDGVNDAPALRKADIGIAMGITGTDVSKQAADMILLNDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFMSYVLFGLPLPMSIIAILMIDLGTDLWPAISFAYEVPESDIMQRAPRNPLYDKLVNKRLVMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYESRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVLNTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFI-RTYPGGYIYKE 1012          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: catp-3 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:O16331])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 377/1041 (36.22%), Postives = 578/1041 (55.52%), Query Frame = 1
Query:  148 NKDLDTD--AHNIPIEELYERLKSDPI--------TGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEP---QSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIG---IIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHE-YPLSESEIDEDQ---AEDRAAW-----QVLLRIAILCNRAQF-----------KADQE-DKVVWKRE------CSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETA------DD------DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTY-------AQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKN 3084
            +KDL +    H + I +L ER     I         GLT+ EA  +L+TDG NAL PPK +  +  F+++      +L+   A LC++ Y+  Y P + +   NLY+G  ++ IV       +++E K   ++++F  ++P    VIR+ +   ++   LVVGDVV V+ G ++PAD+RII  + F ++ S++TGE+EP    S+T +    +I E+ NIAF  +  V+G   GIII  G+NT++G+IA LT G K  +     EI  FV  ITV+ IT+  V F I L +        LF+ G   +I+A +P GL  TVT  LT+ A+RMA+KN  +K LE ++++G+T++I SDKTGTLT+N MTV   WY+N  +   P ++    + +   A +   W     + +L +  +CN+A+            + D E D  V+K +       SG+ SE ALL+     M ++ + R++   + E+PFNS+ KY + +  T       DD      D  ++L++KGAP+ +++ C+TI I     E++    D+FN AY   G  G RV+GF   +  A   P    F       P+    F G+ +++DPPR   P A++ C+ AGIKV MVTGDH  TA AI+R +G+I   ++ + +L H + + I   N +D    V+ G +L  ++ +Q D +L+ H  IVFART+P+ KL IV   Q++G  V VTGDGVND+PALKKAD+G+AMG++GSDV+KQAAD+ILLDDNF+SIV GIE+GR++FDNL+K + Y      PELVP +L      PL L  + IL ID+ TD+ P++SLAYE  E++IM + PR   +  LVT+ LI+ T+  M I  + G +  Y +     G  P  L          + +  K   +   TY        Q+  +      +F IA++V Q W+L +  TRR SIF  GM N     A+  +  L     + PG+  +   QP  +  WL+ +  G++++IF+E +K+ +    KN
Sbjct:   30 HKDLSSSFVEHQMHIAQLSERFFHSKIDIVEPKKSKGLTKQEAAQKLKTDGKNALSPPKTISNMELFVRQFKNLLWVLMFGAAALCFLTYI--YDPTDAL---NLYVGIFIVAIVFIMCVVSFFEEKKGVEVVRAFQTLMPTSCQVIRDGKEILLNPEELVVGDVVVVRSGCKVPADMRIIACTDFFLETSSITGEAEPLEFHSKTADAKT-SIFESYNIAFNGSFCVDGEGYGIIIRTGENTVIGQIASLTLGQKDKKCKFETEIERFVQFITVMAITMATVIFTIGLLVNGGNDVIRLFVTGFLMVIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNSYNSARPENQGRTTKKRNLNAINTIGWYDAPLKDILSVICVCNKARIENNLTTKVRPPRVDSELDLTVYKSQPVKEMLISGNPSEVALLRYAS-GMLDAMEVRDSFHVVFEVPFNSVRKYHLILATTEATWAEIDDKKKVNADVEFILMIKGAPDVLIKSCSTINIDGVPMELNGKRMDDFNEAYETFGDEGCRVIGFACKKFRA---PATSTFSIKSNTIPMDNWDFLGMSAIMDPPRDDTPRAIKACKEAGIKVYMVTGDHKSTATAIARQIGMI--DTEEVTNLDHNRQV-IRRTNSQDW--AVITGPELPGLSEKQWDALLE-HRYIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMTHMWPELVPVMLNFFFGFPLGLTPVQILSIDLITDIPPAVSLAYEGPEADIMLQPPRKR-ETHLVTKGLITYTYLFMSIFISVGGVVAYLLSYYLNGIYPSEL-------AFSSNDHFKVGASNFTTYNGVVLNAEQQVFMAAQAAAAFHIAVVVGQAWHLWMCLTRRVSIFVHGMANIVAILAVIIDLLLICLFTFVPGVQYVFGSQPPPWECWLVPVIVGIWIWIFNELRKFGIRNYPKN 1046          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: catp-2 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:A0A131MBN3])

HSP 1 Score: 545.814 bits (1405), Expect = 4.616e-177
Identity = 362/1034 (35.01%), Postives = 575/1034 (55.61%), Query Frame = 1
Query:  145 ENKDLDTDAHNIPIEELYERLKS------DPIT--GLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNE--NILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLG------YYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIH--------EYPLSESEIDEDQAED-RAAWQVLLRIAILCNRAQFK-----------ADQE-DKVVWK----RECS--GDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD--------DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWI 3093
            +N  L  + H++ + +L E+         DP    GL++  A  RLE+DG NAL PPK +     FL++      +L+   A L  +AY+  Y P +     NL +G  ++VI+       +++E K   ++++F  ++P    VIR+     ++   LVVGD+V V+ G ++PADIR+I  + F ++ S++TGE+EP        ++  +I E+ NIAF  +  V+G   GI+I  G+ T++G+IA +T   K+ +     EI  FV  ITV+ I + V+ F + L +        Y++ G L    +I+A +P GL  TVT  LT+ A+RMA+KN  +K LE ++++G+T++I SDKTGTLT+N MTV   WY+N  +            +   I  + A+   A    LL +  +CN+A+ +            D E D  +++    +E +  G+ SE ALL+    +M ++ + RE+ + + EIPFNS+ KY + +    +        DD  +++++KGAPE +++ C+T+ I     E+D    ++FN AY   G  G RV+GF   +  A      F   ++ V  P++   F G+ +++DPPR   P A++ C++AGIKV MVTGDH  TA AI+R +G+I   ++ +  + H + I I   N +D    V+ GS+L  +T +Q DE+L+ H  IVFART+P+ KL IV   Q++G  V VTGDGVND+PALKKAD+G+AMG++GSDV+KQAAD+ILLDDNF+SIV GIE+GR++FDNL+K + Y      PELVP +L      PL L  + IL ID+ +D+ P++SLAYE  E++IM + PR      LVT+ LI+ T+  M I  + G +  Y +     G  P  L      +      +   +        Q+  +      +F I++++ Q ++L +  TRR SIF  G+ N    FA+  +  L     + PG+  I   QP  +  WL+ +  GV+++IF+E +K  + K  KN ++
Sbjct:   31 QNLSLSFNEHHLDMRQLSEKFSMSKLDIVDPKVSRGLSKQVAAERLESDGRNALSPPKVISNWKLFLRQFKNLLWILMFGAAALSLVAYI--YDPSD---LTNLCVGIFIIVIIFVMCIVSFFEEKKGVEVVRAFQSLMPLSCQVIRDGVEQTLNPEELVVGDIVVVRSGCKVPADIRVIACTDFYLETSSITGEAEPLEFNSAMADQKTSIFESYNIAFNGSFCVDGEGYGIVIRTGERTVIGQIASMTLDQKEQKCKFQVEIGRFVKFITVMAIIMAVIIFSVGLGINKGHDVIRYFVTGFLM---VIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNSYNSGRPENRRRSTKTRFSITSNPAQSFDAPLSDLLSVVCVCNKARIENTVTVNRPPPNVDSELDMSMYRIQPVKEMTIVGNPSEVALLRYAS-AMLDAKELRESFQVVFEIPFNSVRKYHLILATNKNTWNQVDKNDDVEFVVMIKGAPEVLIKNCSTMNINGESKELDLKRMEDFNEAYEAFGDEGCRVIGFAQKKFRARA-STVFSLKSNTV--PMEDWDFLGMSAIMDPPRDDTPKAIKACKAAGIKVYMVTGDHKSTATAIARQIGMI--DTEEVSRVDHNQQI-IRRSNSQDW--AVITGSELPALTQKQWDELLQ-HRYIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMAHMWPELVPVILNFFFGFPLGLTPVQILSIDLISDIPPAVSLAYEGPEADIMLQPPRKK-DTHLVTKGLITYTYLFMSIFISIGCVCAYLLSYYINGIGPWELAFTASTYFKHGAANFTTAKGVILNEEQQMYMANQAAAAFHISLVLGQAFHLWMCLTRRVSIFAHGLGNIVAIFAVIIDLLLICIFTFVPGVKYIFGSQPPPWQCWLVPIVVGVWIWIFNELRKLGIRKYPKNKFV 1045          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089516)

HSP 1 Score: 1278.46 bits (3307), Expect = 0.000e+0
Identity = 628/985 (63.76%), Postives = 779/985 (79.09%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I  EELY+R ++ P  GL+  +A+  LE DGPNAL PPK+ PE VKF K L GGF++LL  GAILC++AY IQ         DNLYLG VL  +V+ TG F YYQE+KSS I++SF  MVPQ + VIRE E   +   +LV+GDVVEVKFGDRIPADIRII+A +FKVDNS+LTGESEPQSR  E T+EN LET N+AFFSTNAVEGT +G++IS GD+T+MGRIA L SGL  G TPI +EI+HF+++IT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   +E +           ++ L RIA LCNRA+FK  Q+   + K+E SGDASE+ALLKC E ++G+    R+ NKKI E+PFNS NKYQVSIHET D +DPRYLLVMKGAPERILE+C+TI I   E  +D+  K+ FNNAYMELGG+GERVLGFCD+ L + ++P GF+F+TD++NFP+  LRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPR+A A VVHG++L++++S+QLDEIL+YH EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I   IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P + KLV ERLIS+ + Q+G+I+A    FVYF+IMAE GFLP +L G+R  W+++ +NDL DSY QEWTY  RK LEYTC+T+FFI+I+V QW +L++ KTRRNSIFQ GM N  L F + FET LA FL YCPGM+  L+M PL+  WW  A+PF + +FI+DE +++ + ++    W+ +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPFQDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGG-WLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089514)

HSP 1 Score: 1278.46 bits (3307), Expect = 0.000e+0
Identity = 628/985 (63.76%), Postives = 779/985 (79.09%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I  EELY+R ++ P  GL+  +A+  LE DGPNAL PPK+ PE VKF K L GGF++LL  GAILC++AY IQ         DNLYLG VL  +V+ TG F YYQE+KSS I++SF  MVPQ + VIRE E   +   +LV+GDVVEVKFGDRIPADIRII+A +FKVDNS+LTGESEPQSR  E T+EN LET N+AFFSTNAVEGT +G++IS GD+T+MGRIA L SGL  G TPI +EI+HF+++IT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   +E +           ++ L RIA LCNRA+FK  Q+   + K+E SGDASE+ALLKC E ++G+    R+ NKKI E+PFNS NKYQVSIHET D +DPRYLLVMKGAPERILE+C+TI I   E  +D+  K+ FNNAYMELGG+GERVLGFCD+ L + ++P GF+F+TD++NFP+  LRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPR+A A VVHG++L++++S+QLDEIL+YH EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I   IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P + KLV ERLIS+ + Q+G+I+A    FVYF+IMAE GFLP +L G+R  W+++ +NDL DSY QEWTY  RK LEYTC+T+FFI+I+V QW +L++ KTRRNSIFQ GM N  L F + FET LA FL YCPGM+  L+M PL+  WW  A+PF + +FI+DE +++ + ++    W+ +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPFQDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGG-WLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089510)

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 627/985 (63.65%), Postives = 776/985 (78.78%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I  EELY+R ++ P  GL+  +A+  LE DGPNAL PPK+ PE VKF K L GGF++LL  GAILC++AY IQ         DNLYLG VL  +V+ TG F YYQE+KSS I++SF  MVPQ + VIRE E   +   +LV+GDVVEVKFGDRIPADIRII+A +FKVDNS+LTGESEPQSR  E T+EN LET N+AFFSTNAVEGT +G++IS GD+T+MGRIA L SGL  G TPI +EI+HF+++IT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   +E +           ++ L RIA LCNRA+FK  Q+   + K+E SGDASE+ALLKC E ++G+    R+ NKKI E+PFNS NKYQVSIHET D +DPRYLLVMKGAPERILE+C+TI I   E  +D+  K+ FNNAYMELGG+GERVLGFCD+ L + ++P GF+F+TD++NFP+  LRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPR+A A VVHG++L++++S+QLDEIL+YH EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I   IPLPLG +TILCID+GTDM+P+ISLAYE +E++IMKR PRDP   KLV  RLIS+ + Q+G+I+A    FVYF+IMAE GFLP +L G+R  W+++ +NDL DSY QEWTY  RK LEYTC+T+FFI+I+V QW +L++ KTRRNSIFQ GM N  L F + FET LA FL YCPGM+  L+M PL+  WW  A+PF + +FI+DE +++ + ++    W+ +E
Sbjct:   55 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGG-WLEQE 1038          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089515)

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 627/985 (63.65%), Postives = 777/985 (78.88%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I  EELY+R ++ P  GL+  +A+  LE DGPNAL PPK+ PE VKF K L GGF++LL  GAILC++AY IQ         DNLYLG VL  +V+ TG F YYQE+KSS I++SF  MVPQ + VIRE E   +   +LV+GDVVEVKFGDRIPADIRII+A +FKVDNS+LTGESEPQSR  E T+EN LET N+AFFSTNAVEGT +G++IS GD+T+MGRIA L SGL  G TPI +EI+HF+++IT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   +E +           ++ L RIA LCNRA+FK  Q+   + K+E SGDASE+ALLKC E ++G+    R+ NKKI E+PFNS NKYQVSIHET D +DPRYLLVMKGAPERILE+C+TI I   E  +D+  K+ FNNAYMELGG+GERVLGFCD+ L + ++P GF+F+TD++NFP+  LRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPR+A A VVHG++L++++S+QLDEIL+YH EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I   IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PRDP +  LV  RLIS+ + Q+G+I+A    FVYF+IMAE GFLP +L G+R  W+++ +NDL DSY QEWTY  RK LEYTC+T+FFI+I+V QW +L++ KTRRNSIFQ GM N  L F + FET LA FL YCPGM+  L+M PL+  WW  A+PF + +FI+DE +++ + ++    W+ +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMIPAISLAYEQAESDIMKRQPRDPYRDNLVNRRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGG-WLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089511)

HSP 1 Score: 1276.15 bits (3301), Expect = 0.000e+0
Identity = 627/985 (63.65%), Postives = 776/985 (78.78%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I  EELY+R ++ P  GL+  +A+  LE DGPNAL PPK+ PE VKF K L GGF++LL  GAILC++AY IQ         DNLYLG VL  +V+ TG F YYQE+KSS I++SF  MVPQ + VIRE E   +   +LV+GDVVEVKFGDRIPADIRII+A +FKVDNS+LTGESEPQSR  E T+EN LET N+AFFSTNAVEGT +G++IS GD+T+MGRIA L SGL  G TPI +EI+HF+++IT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   +E +           ++ L RIA LCNRA+FK  Q+   + K+E SGDASE+ALLKC E ++G+    R+ NKKI E+PFNS NKYQVSIHET D +DPRYLLVMKGAPERILE+C+TI I   E  +D+  K+ FNNAYMELGG+GERVLGFCD+ L + ++P GF+F+TD++NFP+  LRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPR+A A VVHG++L++++S+QLDEIL+YH EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I   IPLPLG +TILCID+GTDM+P+ISLAYE +E++IMKR PRDP   KLV  RLIS+ + Q+G+I+A    FVYF+IMAE GFLP +L G+R  W+++ +NDL DSY QEWTY  RK LEYTC+T+FFI+I+V QW +L++ KTRRNSIFQ GM N  L F + FET LA FL YCPGM+  L+M PL+  WW  A+PF + +FI+DE +++ + ++    W+ +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGG-WLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 1262.28 bits (3265), Expect = 0.000e+0
Identity = 612/985 (62.13%), Postives = 776/985 (78.78%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADD-DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  + ++D + GLT  +AR  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++   DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RG+++  GD T+MGRIA LTSGL+ G+TPI +EI HF++IIT + + LGV FFI+A+ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA FKA Q+   + KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D+ D RYLLVMKGAPERIL++C+TI++   E  +D+  K+ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ + EQ+DE+L+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ + +NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K ++ ++    W+ +E
Sbjct:   37 KEVPLTEHKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSSGSVKAMREKNKKVAEIPFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDYSQEQIDEVLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFAYFVILAENGFLPSLLVGIRLNWDDRAMNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEVRKLLLRRNPGG-WVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 1262.28 bits (3265), Expect = 0.000e+0
Identity = 612/985 (62.13%), Postives = 776/985 (78.78%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADD-DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  + ++D + GLT  +AR  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++   DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RG+++  GD T+MGRIA LTSGL+ G+TPI +EI HF++IIT + + LGV FFI+A+ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA FKA Q+   + KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D+ D RYLLVMKGAPERIL++C+TI++   E  +D+  K+ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ + EQ+DE+L+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ + +NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K ++ ++    W+ +E
Sbjct:   37 KEVPLTEHKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSSGSVKAMREKNKKVAEIPFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDYSQEQIDEVLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFAYFVILAENGFLPSLLVGIRLNWDDRAMNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEVRKLLLRRNPGG-WVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1253.04 bits (3241), Expect = 0.000e+0
Identity = 615/976 (63.01%), Postives = 762/976 (78.07%), Query Frame = 1
Query:  166 DAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWI 3093
            D H + ++EL  R   D   GLT   A   L  DGPNAL PP   PE VKF K+L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIR+ E  +++   +V GD+VE+K GDR+PAD+RII +S  KVDNS+LTGESEPQ+R+PE T+EN LET NI+FFSTN VEGT  GI+I+ GD+T+MGRIA L SGL+ G+TPI  EI HF++IIT + I LG+ FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +   D  +    W  L R+  LCNRA FKA QE+  +  R+ +GDASESALLKC E   GN    RENN+K+ EIPFNS NKYQ+SIHE  D    +LLVMKGAPERIL++C+TI+I   E+ IDD W D F  AYMELGG+GERVLGFC   L  ++FP+GF+FD D+VNFP+  L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+M++E LD+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  S+PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP  L+G+R+ W+ +T+NDL+D Y Q+WTY QRK +E+TC+TSFF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+  WW  A P+ + +F++DE +K+I+ ++    W+
Sbjct:   37 DDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRRNPGG-WV 1011          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1253.04 bits (3241), Expect = 0.000e+0
Identity = 615/976 (63.01%), Postives = 762/976 (78.07%), Query Frame = 1
Query:  166 DAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWI 3093
            D H + ++EL  R   D   GLT   A   L  DGPNAL PP   PE VKF K+L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIR+ E  +++   +V GD+VE+K GDR+PAD+RII +S  KVDNS+LTGESEPQ+R+PE T+EN LET NI+FFSTN VEGT  GI+I+ GD+T+MGRIA L SGL+ G+TPI  EI HF++IIT + I LG+ FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +   D  +    W  L R+  LCNRA FKA QE+  +  R+ +GDASESALLKC E   GN    RENN+K+ EIPFNS NKYQ+SIHE  D    +LLVMKGAPERIL++C+TI+I   E+ IDD W D F  AYMELGG+GERVLGFC   L  ++FP+GF+FD D+VNFP+  L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+M++E LD+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  S+PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP  L+G+R+ W+ +T+NDL+D Y Q+WTY QRK +E+TC+TSFF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+  WW  A P+ + +F++DE +K+I+ ++    W+
Sbjct:   37 DDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRRNPGG-WV 1011          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1252.27 bits (3239), Expect = 0.000e+0
Identity = 615/976 (63.01%), Postives = 762/976 (78.07%), Query Frame = 1
Query:  166 DAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWI 3093
            D H + ++EL  R   D   GLT   A   L  DGPNAL PP   PE VKF K+L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIR+ E  +++   +V GD+VE+K GDR+PAD+RII +S  KVDNS+LTGESEPQ+R+PE T+EN LET NI+FFSTN VEGT  GI+I+ GD+T+MGRIA L SGL+ G+TPI  EI HF++IIT + I LG+ FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +   D  +    W  L R+  LCNRA FKA QE+  +  R+ +GDASESALLKC E   GN    RENN+K+ EIPFNS NKYQ+SIHE  D    +LLVMKGAPERIL++C+TI+I   E+ IDD W D F  AYMELGG+GERVLGFC   L  ++FP+GF+FD D+VNFP+  L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+M++E LD+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  S+PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP  L+G+R+ W+ +T+NDL+D Y Q+WTY QRK +E+TC+TSFF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+  WW  A P+ + +F++DE +K+I+ ++    W+
Sbjct:   33 DDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRRNPGG-WV 1007          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-GENE-1001990])

HSP 1 Score: 1246.11 bits (3223), Expect = 0.000e+0
Identity = 619/984 (62.91%), Postives = 763/984 (77.54%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++  D H + +EE+  +  +D   GLT   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIRE E  +++   +VVGD+VE+K GDR+PADIRII A   KVDNS+LTGESEPQ+R+PE T+EN LET NI FFSTN VEGT RGI+I+ GD T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FK  QE   V KR+ +GDASESALLKC E S G+  K R+ N K+ EIPFNS NK+Q+SIHE  D    +LLVMKGAPERIL++C+TI++   E  +D+  KD F NAY ELGG+GERVLGFC   + A +F +GF+FDTDE NFPL  L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+++VNPR+A ACVVHGSDLK+MTSEQLD++LK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+R+ W+ ++ ND++DSY QEWTY QRK +E+TC+T+FF +I+V QW +L++ KTRRNS+FQ GM N  L F +  ET LA FL YCPGMD+ L+M PL+ TWW  A P+ + +F++DE +K I+ +     W+ +E
Sbjct:   35 KEVAMDDHKLSMEEIGRKYGTDLAKGLTNARAAEVLAQDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQIAMEDEPINDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKLQINAEMVVVGDLVEIKGGDRVPADIRIIIAHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTGRGIVINTGDRTVMGRIATLASGLEVGRTPIAMEIEHFIHIITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTTFDKRSPTWTALSRIAGLCNRAVFKVGQEKVAVSKRDTAGDASESALLKCIELSCGSVRKLRDRNPKVAEIPFNSTNKFQLSIHEREDSPEGHLLVMKGAPERILDRCSTIMLHGAEQPLDEEMKDAFQNAYFELGGLGERVLGFCHLYIPADKFQRGFKFDTDEPNFPLTDLCFIGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIADRLNIPVNQVNPREAKACVVHGSDLKDMTSEQLDDLLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSNNDVEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMDVALRMYPLKVTWWFCAFPYSLLIFLYDEVRKLILRRDPGG-WVEKE 1017          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: naif1 (nuclear apoptosis inducing factor 1 [Source:Xenbase;Acc:XB-GENE-986890])

HSP 1 Score: 1243.02 bits (3215), Expect = 0.000e+0
Identity = 615/992 (62.00%), Postives = 771/992 (77.72%), Query Frame = 1
Query:  172 HNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQA--------------EDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            H I +EE+  +L +D + GLT ++A   L  DGPNAL PP   PE +KF ++L GGFS+LL  GAILC+ AY I    +   + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +++   +VVGD+VEVK GDR+PAD+RII +   KVDNS+LTGESEPQ+R+P+CT+EN LET NIAFFSTN VEGT RGI+++ GD T+MGRIA L SGL+ G+TPI +EI HF+++IT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE     ++  EDQ+              +    W  L RIA LCNRA FKA  ++  V KR+ +GDASESALLKC E S G+    RE +KK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL+ C+TILI   E  +DD  K+ F NAY+ELGG+GERVLGFC Y       PKGF FDT+++NF  + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+M++EQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  LIG+R+ W+ +++NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ +     W+ +E
Sbjct:    4 HKITVEEVCRKLNTDCVQGLTLSKAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFFAYGILASMEEEPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQLNAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHENPLETRNIAFFSTNCVEGTARGIVVATGDRTVMGRIATLASGLEVGKTPIAKEIEHFIHLITGVAVFLGVTFFVLSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE-----ADTTEDQSAHSYPYYFSISSFDKSSPTWLGLARIAALCNRAVFKAGNDNIPVLKRDVAGDASESALLKCIELSCGSVKAMREKSKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDVCSTILIQGKEQPLDDELKEAFQNAYLELGGLGERVLGFCHYYFPEELHPKGFAFDTEDLNFSTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDMSTEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPSHLIGIRLTWDDRSVNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDIALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLIL-RRHPGGWVEKE 989          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 613/985 (62.23%), Postives = 768/985 (77.97%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K+L  + H + ++EL+ +  +D   GL+   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY I    +   T DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIR  E   ++  ++V+GD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+ TNEN LET NIAFFSTN VEGT RG++++ GD T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FFI++L L Y WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E++      +    W  L R+A LCNRA F+A QE+  + KR+ +GDASESALLKC E   G+    RE N K+ EIPFNS NKYQ+S+H+ A+  + RY+LVMKGAPERIL++C+TI++   E  +D+  KD F NAY+ELGG+GERVLGFC   L   +FP GFQFDT+EVNFP + L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+++VNPRDA ACV+HGSDLK+M  EQ+D+ILK+H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +  ND++DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ TWW  A P+ + +FI+DE +K I+ +S    W+ +E
Sbjct:   37 KELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRRSPGG-WVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1233.01 bits (3189), Expect = 0.000e+0
Identity = 611/976 (62.60%), Postives = 764/976 (78.28%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKS 3075
            K+L  + H + ++EL+ +  +D   GL+   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY I    +   T DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIR  E   ++  ++V+GD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+ TNEN LET NIAFFSTN VEGT RG++++ GD T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FFI++L L Y WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E++      +    W  L R+A LCNRA F+A QE+  + KR+ +GDASESALLKC E   G+    RE N K+ EIPFNS NKYQ+S+H+ A+  + RY+LVMKGAPERIL++C+TI++   E  +D+  KD F NAY+ELGG+GERVLGFC   L   +FP GFQFDT+EVNFP + L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+++VNPRDA ACV+HGSDLK+M  EQ+D+ILK+H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +  ND++DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ TWW  A P+ + +FI+DE +K I+ +S
Sbjct:   34 KELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRRS 1009          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-GENE-1001990])

HSP 1 Score: 1225.31 bits (3169), Expect = 0.000e+0
Identity = 611/982 (62.22%), Postives = 756/982 (76.99%), Query Frame = 1
Query:  157 LDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +D D H + +EE+  +  +D   GLT   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIRE E  +++   +VVGD+VE+K GDR+PADIRII A   KVDNS+LTGESEPQ+R+PE T EN LET +      N+ +GT RGI+I+ GD T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FK  QE   V KR+ +GDASESALLKC E S G+  K R+ N K+ EIPFNS NK+Q+SIHE  D    +LLVMKGAPERIL++C+TI++   E  +D+  KD F NAY ELGG+GERVLGFC   + A +F +GF+FDTDE NFPL  L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+++VNPR+A ACVVHGSDLK+MTSEQLD++LK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+R+ W+ ++ ND++DSY QEWTY QRK +E+TC+T+FF +I+V QW +L++ KTRRNS+FQ GM N  L F +  ET LA FL YCPGMD+ L+M PL+ TWW  A P+ + +F++DE +K I+ +     W+ +E
Sbjct:    2 VDHDDHKLSMEEIGRKYGTDLAKGLTNARAAEVLAQDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQIAMEDEPINDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKLQINAEMVVVGDLVEIKGGDRVPADIRIIIAHGCKVDNSSLTGESEPQTRSPEFTQENTLETIHCLH---NSYKGTGRGIVINTGDRTVMGRIATLASGLEVGRTPIAMEIEHFIHIITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTTFDKRSPTWTALSRIAGLCNRAVFKVGQEKVAVSKRDTAGDASESALLKCIELSCGSVRKLRDRNPKVAEIPFNSTNKFQLSIHEREDSPEGHLLVMKGAPERILDRCSTIMLHGAEQPLDEEMKDAFQNAYFELGGLGERVLGFCHLYIPADKFQRGFKFDTDEPNFPLTDLCFIGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIADRLNIPVNQVNPREAKACVVHGSDLKDMTSEQLDDLLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSNNDVEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMDVALRMYPLKVTWWFCAFPYSLLIFLYDEVRKLILRRDPGG-WVEKE 979          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1260.36 bits (3260), Expect = 0.000e+0
Identity = 617/985 (62.64%), Postives = 773/985 (78.48%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++CATIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1259.59 bits (3258), Expect = 0.000e+0
Identity = 617/985 (62.64%), Postives = 773/985 (78.48%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++CATIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   40 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1023          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1256.12 bits (3249), Expect = 0.000e+0
Identity = 615/976 (63.01%), Postives = 769/976 (78.79%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKS 3075
            K++    H + +EE+  +  +D + GLT ++A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   +++ + DNLYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIRE E  +V+   +VVGD+VE+K GDR+PAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NI FFSTN VEGT RG++++ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L  IA LCNRA FK  Q++  V KR+ +GDASESALLKC E S G+    RE NKK+ EIPFNS NKYQ+SIHET D +D RYLLVMKGAPERIL++CATIL+   E  +D+  K+ F NAY+ELGG+GERVLGFC Y L   +FPKGF FD D+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+ TSEQ+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T+NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRN 1002          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a2 (ATPase, Na+/K+ transporting, alpha 2 polypeptide [Source:MGI Symbol;Acc:MGI:88106])

HSP 1 Score: 1254.58 bits (3245), Expect = 0.000e+0
Identity = 620/984 (63.01%), Postives = 765/984 (77.74%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++  D H + ++EL  + + D   GLT   A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GA+LC++AY I    ++  + DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIRE E  +++   +VVGD+VEVK GDR+PAD+RII +   KVDNS+LTGESEPQ+R+PE T+EN LET NI FFSTN VEGT RGI+I+ GD T+MGRIA L SGL+ G+TPI  EI HF+ +IT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FKA QE+  V KR+ +GDASESALLKC E S G+  K R+ N K+ EIPFNS NKYQ+SIHE  D    ++LVMKGAPERIL++C+TIL+   E  +D   +D F NAYMELGG+GERVLGFC   L + +FP+GF+FDTDE+NFP + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+MTSEQLDEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+    KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+R+ W+ +T NDL+DSY QEWTY QRK +E+TC+T+FF +I+V QW +L++ KTRRNS+FQ GM N  L F +  ET LA FL YCPGM + L+M PL+ TWW  A P+ + +FI+DE +K I+ +     W+ +E
Sbjct:   35 KEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAMEDEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKE 1017          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a1 (ATPase, Na+/K+ transporting, alpha 1 polypeptide [Source:MGI Symbol;Acc:MGI:88105])

HSP 1 Score: 1239.17 bits (3205), Expect = 0.000e+0
Identity = 614/985 (62.34%), Postives = 770/985 (78.17%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++  D H + ++EL+ +  +D   GLT   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY I+   +     D+LYLG VL  +V+ TGCF YYQEAKSS I++SF  MVPQ++ VIR  E   ++  ++VVGD+VEVK GDRIPAD+RII A+  KVDNS+LTGESEPQ+R+P+ TNEN LET NIAFFSTN VEGT RGI++  GD T+MGRIA L SGL+ G+TPI  EI HF+++IT + + LGV FFI++L L Y WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E++      +  A W  L RIA LCNRA F+A+QE+  + KR  +GDASESALLKC E   G+  + RE   KIVEIPFNS NKYQ+SIH+  +  +P++LLVMKGAPERIL++C++IL+   E  +D+  KD F NAY+ELGG+GERVLGFC   L   +FP+GFQFDTD+VNFP+  L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+++VNPRDA ACVVHGSDLK+MTSE+LD+IL+YH EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R  W+ + +ND++DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGM   L+M PL+ TWW  A P+ + +F++DE +K I+ + +   W+ +E
Sbjct:   37 KEVSMDDHKLSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLII-RRRPGGWVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|Q6RWA9|AT1A_TAESO (Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium OX=6204 PE=2 SV=1)

HSP 1 Score: 1323.53 bits (3424), Expect = 0.000e+0
Identity = 640/985 (64.97%), Postives = 790/985 (80.20%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQ-YIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++L  D H I ++ELY RL ++P TGLT  +A+ RL+ DGPNAL PPK  PE VKF K + GGFSLLL  GA+LC+IA+ I  +        DNLYLG VL  +V+ TGCF YYQE+KSS I++SF K+VPQ + VIR  +  +     LVVGD+++VKFGDR+PADIR+IKASSFKVDNSALTGESEPQ+RT E TNEN LET N+AFFSTNAVEGTCRG++++ GD T+MGRIA+L SGL+ G TPI REI HF++IIT + + LGV FFIIA  LGYYWLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   S+ +   + +   + W  L RIA+LCNRA+FK  +E   V KREC+GDASESALLKC   S+G  + YR +  K+ EIPFNS NKYQVS+H+T D D RYL+VMKGAPERIL++C+T+L+   E  +DD W++ FNNAY+ELGG+GERVLGFCD RL A +FP+GF+FD DE NFP++G+ F GL+SMIDPPR +VPDAV KCRSAGIKV+MVTGDHPITAKAI++ VGII  G+KT+ED+A E+ +P+S+VNPR+A+ACVVHGSDL++MT  Q+DEIL+ H+EIVFARTSPQQKL IV+G QR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +E +IMKR PRDP + KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAE GF P RL+GLR QW++  IND+ DSY QEWTY QRK+LEYTC+T+FF +I++ QW +LL+ KTR+NSI+Q GMWN+HLTF +FFET LA+FL YCPG++  L+M PLR+TWWL  +PF V +FIFDE +K  +       W+ RE
Sbjct:   28 QELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGIPCWCAGEPYLYDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRASSTWMALSRIAMLCNRAEFKPGEETNPVLKRECNGDASESALLKCVGLSIGGVTGYRTDKPKVAEIPFNSTNKYQVSVHQTDDGDERYLVVMKGAPERILDRCSTVLMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDIDEPNFPIEGMPFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVSQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGIQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAE-DIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIYQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPVLPFSVSIFIFDEVRKKFLRTLPPGNWVERE 1011          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P13607|ATNA_DROME (Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3)

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 627/985 (63.65%), Postives = 776/985 (78.78%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I  EELY+R ++ P  GL+  +A+  LE DGPNAL PPK+ PE VKF K L GGF++LL  GAILC++AY IQ         DNLYLG VL  +V+ TG F YYQE+KSS I++SF  MVPQ + VIRE E   +   +LV+GDVVEVKFGDRIPADIRII+A +FKVDNS+LTGESEPQSR  E T+EN LET N+AFFSTNAVEGT +G++IS GD+T+MGRIA L SGL  G TPI +EI+HF+++IT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   +E +           ++ L RIA LCNRA+FK  Q+   + K+E SGDASE+ALLKC E ++G+    R+ NKKI E+PFNS NKYQVSIHET D +DPRYLLVMKGAPERILE+C+TI I   E  +D+  K+ FNNAYMELGG+GERVLGFCD+ L + ++P GF+F+TD++NFP+  LRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPR+A A VVHG++L++++S+QLDEIL+YH EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I   IPLPLG +TILCID+GTDM+P+ISLAYE +E++IMKR PRDP   KLV  RLIS+ + Q+G+I+A    FVYF+IMAE GFLP +L G+R  W+++ +NDL DSY QEWTY  RK LEYTC+T+FFI+I+V QW +L++ KTRRNSIFQ GM N  L F + FET LA FL YCPGM+  L+M PL+  WW  A+PF + +FI+DE +++ + ++    W+ +E
Sbjct:   55 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGG-WLEQE 1038          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P28774|AT1B_ARTSF (Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 627/986 (63.59%), Postives = 777/986 (78.80%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDN-NVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K+LD D H IPIEE Y+RL S+P TGLT  +AR  +E DGPN L PPK  PE +KF K L GGF+LLL  GAILC++AY I+    N ++ +DNLYLG VL  +V+ TG F YYQE KSS I+ SF  +VPQ +  +RE +   +    L +GD+VEVKFGDR+PAD+R+++A SFKVDNS+LTGESEPQ+R+PE TN+N LET N+AFFSTNAVEGT RGI+I +GDNT+MGRIA L SGL  G TPI +EI HF++IIT + + LGV FFIIA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+   I E   +E +      +  A W+ L++IA LC+RA+FK +Q    + KRE +GDASE+A+LKC E + G +   R+ NKKI EIPFNS NK+QVSIHE  D  D RYLLVMKGAPERILE+C+TI +   E ++ +  K+ FNNAYMELGG+GERVLGFCDY L   ++P GF F+ D+ NFPL GLRFAGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI+++VGII +G++T+ED+A   NIP+SEVNPRDA A VVHG +L+++T + LDEIL++H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK+++Y     IPE+ PFLL+I   IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+PV  KLV ERLISL + Q+G+I+A+   FVYF+IMAE GFLP  L GLR  W+++ +NDL DSY QEWTY  RK+LE +C+T++F++I++ QW +L++ KTRRNS+FQ GM NN L FA+ FETCLA FL Y PGMD  L+M PL+  WW  A+PF   +F++DE +K+I+ ++    W+ +E
Sbjct:   17 KELDIDFHKIPIEECYQRLGSNPETGLTNAQARSNIERDGPNCLTPPKTTPEWIKFCKNLFGGFALLLWTGAILCFLAYGIEASSGNEDMLKDNLYLGIVLATVVIVTGIFSYYQENKSSRIMDSFKNLVPQYALALREGQRVTLKAEELTMGDIVEVKFGDRVPADLRVLEARSFKVDNSSLTGESEPQARSPEFTNDNPLETKNLAFFSTNAVEGTMRGIVIGIGDNTVMGRIAGLASGLDTGETPIAKEIAHFIHIITGVAVFLGVTFFIIAFVLGYHWLDAVVFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDGTITEADTTEDQSGAQFDKSSAGWKALVKIAALCSRAEFKPNQSTTPILKREVTGDASEAAILKCVELTTGETEAIRKRNKKICEIPFNSANKFQVSIHENEDKSDGRYLLVMKGAPERILERCSTIFMNGKEIDMTEELKEAFNNAYMELGGLGERVLGFCDYLLPLDKYPHGFAFNADDANFPLTGLRFAGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVSEVNPRDAKAAVVHGGELRDITPDALDEILRHHPEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIVYTLTSNIPEISPFLLFILFDIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRRPRNPVTDKLVNERLISLAYGQIGMIQASAGFFVYFVIMAECGFLPWDLFGLRKHWDSRAVNDLTDSYGQEWTYDARKQLESSCHTAYFVSIVIVQWADLIISKTRRNSVFQQGMRNNILNFALVFETCLAAFLSYTPGMDKGLRMYPLKINWWFPALPFSFLIFVYDEARKFILRRNPGG-WVEQE 1001          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P50993|AT1A2_HUMAN (Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens OX=9606 GN=ATP1A2 PE=1 SV=1)

HSP 1 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 624/984 (63.41%), Postives = 767/984 (77.95%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++  D H + ++EL  + + D   GLT   A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++  + DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ VIRE E  +++   +VVGD+VEVK GDR+PAD+RII +   KVDNS+LTGESEPQ+R+PE T+EN LET NI FFSTN VEGT RGI+I+ GD T+MGRIA L SGL+ GRTPI  EI HF+ +IT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FKA QE+  V KR+ +GDASESALLKC E S G+  K R+ N K+ EIPFNS NKYQ+SIHE  D    ++LVMKGAPERIL++C+TIL+   E  +D   +D F NAYMELGG+GERVLGFC   L + +FP+GF+FDTDE+NFP + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+MTSEQLDEILK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+    KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+R+ W+ +T+NDL+DSY QEWTY QRK +E+TC+T+FF +I+V QW +L++ KTRRNS+FQ GM N  L F +  ET LA FL YCPGM + L+M PL+ TWW  A P+ + +FI+DE +K I+ +     W+ +E
Sbjct:   35 KEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPMSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKE 1017          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|D2WKD8|AT1A2_PIG (Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa OX=9823 GN=ATP1A2 PE=1 SV=1)

HSP 1 Score: 1260.74 bits (3261), Expect = 0.000e+0
Identity = 620/984 (63.01%), Postives = 769/984 (78.15%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++  D H + ++EL  + + D   GLT   A+  L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++  + DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  MVPQ++ V+RE E  +++   +VVGD+VEVK GDR+PAD+RII +   KVDNS+LTGESEPQ+R+PE T+EN LET NI FFSTN VEGT RGI+I+ GD T+MGRIA L SGL+ GRTPI  EI HF+ +IT + + LGV FF+++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FKA QE+  V KR+ +GDASESALLKC E S G+  K R+ N K+ EIPFNS NKYQ+SIHE  D+   ++LVMKGAPERIL++C++IL+   E  +D   +D F NAY+ELGG+GERVLGFC   L + +FP+GF+FDTDE+NFP + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPR+A ACVVHGSDLK+MTSEQLDEILK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+R+ W+ +++NDL+DSY QEWTY QRK +E+TC+T+FF +I+V QW +L++ KTRRNS+FQ GM N  L F +  ET LA FL YCPGM + L+M PL+ TWW  A P+ + +FI+DE +K I+ +     W+ +E
Sbjct:   35 KEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDNPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYLELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKE 1017          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: O76154 (Sodium/potassium-transporting ATPase subunit alpha OS=Dugesia japonica OX=6161 GN=Djnak PE=2 SV=1)

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 690/983 (70.19%), Postives = 829/983 (84.33%), Query Frame = 1
Query:  154 DLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +LD D+H IPI++LY RL+SDP  G++  +A++RL  DGPNAL PPK  PE VKF K+L GGFSLLL  GA+LC++AY IQ     +  +DNLYLG VL  +V+ TGCF YYQ+AKSS I++SFGKMVPQK+NVIRE +ISE+   NLVVGDV+EVKFGDR+PADIR+I+ASSFKVDNSALTGESE Q RTPE TN+N LET NIAFFSTNAVEGTCRGI+ISVGDNT+MGRIA+L SGL+ G TPI +EINHF++IIT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   SE++I     ++   W++L RI++LCNRAQFKA +EDK V KR+C+GDASESALLKC E S+G  +KYRE NKKIVEIPFNS NKYQVSIHET D +P YL+ MKGAPERILE+C+TILI   E  +DDHWK EFNNAY+ELGGMGERVLGFCD+RLD  EFPKGF+F+ DEVNFPL GLRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T++D+A E+ I  SEVNPRDA ACV+HGSDL++MTSEQLDE+LK+H+EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKRKPRDP   KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAEQGF P RL+GLR +W++  +NDL DSY QEWT+ QRKKLEYTC+T+FF++I++ QW +L++ KTRRNSIFQ GMWN+ +TF +FFET LA FL YCPG+D+ LKMQPLRFTWWL A+PF   +FI+DE +KY++ K K  +W+  E
Sbjct:   37 ELDIDSHRIPIKDLYIRLQSDPDKGISYEDAKMRLARDGPNALTPPKTTPEWVKFCKQLFGGFSLLLWIGAVLCFLAYAIQSGAYEDPPKDNLYLGVVLTAVVVITGCFSYYQDAKSSKIMESFGKMVPQKANVIREGKISEISAENLVVGDVIEVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRTPEFTNDNPLETKNIAFFSTNAVEGTCRGIVISVGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSSKQESDTWKMLARISMLCNRAQFKAGEEDKPVLKRDCTGDASESALLKCVELSIGGVTKYREENKKIVEIPFNSTNKYQVSIHETNDGNPGYLIAMKGAPERILERCSTILIDGKEVHMDDHWKQEFNNAYLELGGMGERVLGFCDFRLDENEFPKGFKFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNRTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMTSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFEQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEVRKYLLRKWKNGSWLENE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: M4LUP7 (Sodium/potassium-transporting ATPase subunit alpha OS=Schmidtea mediterranea OX=79327 GN=ATP12A PE=2 SV=1)

HSP 1 Score: 1412.51 bits (3655), Expect = 0.000e+0
Identity = 674/983 (68.57%), Postives = 820/983 (83.42%), Query Frame = 1
Query:  154 DLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +LD D+H I I++LY RL++DP  GL+  EA++RL  DGPNAL PPK  PE VKF ++L GGFSLLL  GA LC++AY I      +  +DNLYLG VL  +V+ TGCF YYQEAKSS I++SFGKMVPQK+NVIR+ +I E+   NLV GD+++VKFGDR+PADIR+I+ASSFKVDNSALTGESE Q R+ E TN+N LET NIAFFSTNAVEGTC+G++IS GDNT+MGRIA+L SGL+ G TPI +EINHF++IIT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   SE++I     ++   W++L R+A+LCNRAQFK+ +E+K V KREC+GDASESALLKC E S+G  +KYR  NKKIVEIPFNS NKYQVSIHET+D +  YLL MKGAPERILE+C+TILI   E E+DDHW+ EFNNAY+ELGGMGERVLGFCDYRLD   FP+GF F+ DEVNFPL GLRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G+KT++D+A E+ I  SEVNPRDA ACV+HGSDL++M+SEQLDE+LK+H+EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKRKPRDP   KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAEQGF P RL+GLR +W++  +NDL DSY QEWT+ QRKKLEYTC+T+FF++I++ QW +L++ KTRRNSIFQ GMWN+ +TF +FFET LA FL YCPG+D+ LKMQPLRFTWWL A+PF   +FI+DE +K+++ K K  +W+  E
Sbjct:   37 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: A0A068WQ07 (Sodium/potassium-transporting ATPase subunit alpha OS=Echinococcus granulosus OX=6210 GN=EgrG_000342600 PE=3 SV=1)

HSP 1 Score: 1359.36 bits (3517), Expect = 0.000e+0
Identity = 651/984 (66.16%), Postives = 802/984 (81.50%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++L  D H I ++ELY RL ++P TGLT  +A+ RL+ DGPNAL PPK  PE VKF K + GGFSLLL  GA+LC+IA+ I      N T DNLYLG VL  +V+ TGCF YYQE+KSS I++SF K+VPQ + VIR  +  +     LVVGD+++VKFGDR+PADIR+IKASSFKVDNSALTGESEPQ+RT E TNEN LET N+AFFSTNAVEGTCRG++++ GD T+MGRIA+L SGL+ G TPI REI HF++IIT + + LGV FFIIA  LGYYWLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   S+ +   + + D + W  L RIA+LCNRA+FK  +E+K V KREC+GDASESALLKC E S+G  +KYR +N K+ EIPFNS NKYQVS+H+T+D D RYL+VMKGAPERIL++C+TIL+   E  +DD W++ FNNAY+ELGG+GERVLGFCD RL A +FP+GF+FD DE NFP++G+RF GL+SMIDPPR +VPDAV KCRSAGIKV+MVTGDHPITAKAI++ VGII  G+KT+ED+A E+ +P+++VNPR+A+ACVVHGSDL++MT  Q+DEIL+ H+EIVFARTSPQQKL IV+G QR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR PRDP + KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAE GF P RL+GLR QW++  IND+ DSY QEWTY QRK+LEYTC+T+FF +I++ QW +LL+ KTR+NSIFQ GMWN+HLTF +FFET LA+FL YCPG++  L+M PLR+TWWL A+PF V +FIFDE +K ++       W+ RE
Sbjct:   40 QELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGILAGVQENPTNDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRDSSTWMALSRIAMLCNRAEFKPGEENKPVLKRECNGDASESALLKCVELSIGGVTKYRADNPKVAEIPFNSTNKYQVSVHQTSDGDERYLVVMKGAPERILDRCSTILMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDVDEQNFPIEGMRFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVNQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPALPFSVSIFIFDEVRKKLLRTLPPGNWVERE 1023          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: A0A068Y2K7 (Sodium/potassium-transporting ATPase subunit alpha OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000342600 PE=3 SV=1)

HSP 1 Score: 1358.97 bits (3516), Expect = 0.000e+0
Identity = 652/984 (66.26%), Postives = 802/984 (81.50%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++L  D H I ++ELY RL ++P TGLT  +A+ RL+ DGPNAL PPK  PE VKF K + GGFSLLL  GA+LC+IA+ I      N T DNLYLG VL  +V+ TGCF YYQE+KSS I++SF K+VPQ + VIR  +  +     LVVGDV++VKFGDR+PADIR+IKASSFKVDNSALTGESEPQ+RT E TNEN LET N+AFFSTNAVEGTCRG++++ GD T+MGRIA+L SGL+ G TPI REI HF++IIT + + LGV FFIIA  LGYYWLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   S+ +   + + D + W  L RIA+LCNRA+FK  +E+K V KREC+GDASESALLKC E S+G  +KYR +N K+ EIPFNS NKYQVS+H+T+D D RYL+VMKGAPERIL++C+TIL+   E  +DD W++ FNNAY+ELGG+GERVLGFCD RL A +FP+GF+FD DE NFP++G+RF GL+SMIDPPR +VPDAV KCRSAGIKV+MVTGDHPITAKAI++ VGII  G+KT+ED+A E+ +P+++VNPR+A+ACVVHGSDL++MT  Q+DEIL+ H+EIVFARTSPQQKL IV+G QR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR PRDP + KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAE GF P RL+GLR QW++  IND+ DSY QEWTY QRK+LEYTC+T+FF +I++ QW +LL+ KTR+NSIFQ GMWN+HLTF +FFET LA+FL YCPG++  L+M PLR+TWWL A+PF V +FIFDE +K ++       W+ RE
Sbjct:   40 QELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGILAGVQENPTNDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDVIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRDSSTWMALSRIAMLCNRAEFKPGEENKPVLKRECNGDASESALLKCVELSIGGVTKYRADNPKVAEIPFNSTNKYQVSVHQTSDGDERYLVVMKGAPERILDRCSTILMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDVDEQNFPIEGMRFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVNQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPALPFSVSIFIFDEVRKKLLRTLPPGNWVERE 1023          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: W6UUP9 (Sodium/potassium-transporting ATPase subunit alpha OS=Echinococcus granulosus OX=6210 GN=EGR_08003 PE=3 SV=1)

HSP 1 Score: 1358.58 bits (3515), Expect = 0.000e+0
Identity = 651/984 (66.16%), Postives = 802/984 (81.50%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++L  D H I ++ELY RL ++P TGLT  +A+ RL+ DGPNAL PPK  PE VKF K + GGFSLLL  GA+LC+IA+ I      N T DNLYLG VL  +V+ TGCF YYQE+KSS I++SF K+VPQ + VIR  +  +     LVVGD+++VKFGDR+PADIR+IKASSFKVDNSALTGESEPQ+RT E TNEN LET N+AFFSTNAVEGTCRG++++ GD T+MGRIA+L SGL+ G TPI REI HF++IIT + + LGV FFIIA  LGYYWLD ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   S+ +   + + D + W  L RIA+LCNRA+FK  +E+K V KREC+GDASESALLKC E S+G  +KYR +N K+ EIPFNS NKYQVS+H+T+D D RYL+VMKGAPERIL++C+TIL+   E  +DD W++ FNNAY+ELGG+GERVLGFCD RL A +FP+GF+FD DE NFP++G+RF GL+SMIDPPR +VPDAV KCRSAGIKV+MVTGDHPITAKAI++ VGII  G+KT+ED+A E+ +P+++VNPR+A+ACVVHGSDL++MT  Q+DEIL+ H+EIVFARTSPQQKL IV+G QR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR PRDP + KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAE GF P RL+GLR QW++  IND+ DSY QEWTY QRK+LEYTC+T+FF +I++ QW +LL+ KTR+NSIFQ GMWN+HLTF +FFET LA+FL YCPG++  L+M PLR+TWWL A+PF V +FIFDE +K ++       W+ RE
Sbjct:   28 QELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGILAGVQENPTNDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRDSSTWMALSRIAMLCNRAEFKPGEENKPVLKRECNGDASESALLKCVELSIGGVTKYRADNPKVAEIPFNSTNKYQVSVHQTSDGDERYLVVMKGAPERILDRCSTILMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDVDEQNFPIEGMRFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVNQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPALPFSVSIFIFDEVRKKLLRTLPPGNWVERE 1011          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3 [Source:NCBI gene;Acc:103034051])

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 613/993 (61.73%), Postives = 778/993 (78.35%), Query Frame = 1
Query:  148 NKDLDT-------DAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            NKDLD          H + +EE+  + ++D + GLT  +A   L+ DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+RII +   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI++  GD T+MGRIA LTSGL+ G+TPI +EI HF++IIT + + LG+ FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA FKA Q+   + KR+ +GDASESALLKC E S G+  + RE NKK+ EIPFNS NKYQ+SIHET + +D RYLLVMKGAPERIL++C+TI+I   E  +D+  K+ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF    + F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG++LK+M+ +Q+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K ++ ++    W+ +E
Sbjct:   30 NKDLDDLKKEVPLTEHKMSVEEVCRKFQTDIVQGLTNAKAAEFLQRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGLSFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKTSVTWVSLARVASLCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSCGSVKQMRERNKKVAEIPFNSTNKYQLSIHETEEPNDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLLMPEDQYPKGFAFDTDDVNFQTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTELKDMSQDQIDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSLLVGIRLSWDDRTANDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLLLRRNPGG-WVEKE 1021          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3-like [Source:NCBI gene;Acc:103030580])

HSP 1 Score: 1256.12 bits (3249), Expect = 0.000e+0
Identity = 612/985 (62.13%), Postives = 771/985 (78.27%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + IEE+  +  +D + GLT  +A   L  DGPNAL PP   PE +KF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI++  GD T+MGRIA LTSGL+ G+TPI +EI HF+ IIT + + LGV FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA FKA QE   + KR+ +GDASESALLKC E S G+    R+ NKK+ EIPFNS NKYQ+S+HET +  D  YLLVMKGAPERIL++C+TI++   E  +D+  K+ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF    + F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HGSDLKE+T EQ+D++LK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP RL+G+R+ W+ ++ NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   36 KEVPLTEHRMSIEEVCRKYNTDIVQGLTNAKAAEYLARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSLARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHETEEPSDNHYLLVMKGAPERILDRCSTIMVQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLFMPEDQYPKGFAFDTDDVNFKTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGSDLKELTQEQMDDVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSRLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3 [Source:NCBI gene;Acc:103034051])

HSP 1 Score: 1245.72 bits (3222), Expect = 0.000e+0
Identity = 610/986 (61.87%), Postives = 770/986 (78.09%), Query Frame = 1
Query:  148 NKDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            NKDLD     +P+             GLT  +A   L+ DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+RII +   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI++  GD T+MGRIA LTSGL+ G+TPI +EI HF++IIT + + LG+ FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA FKA Q+   + KR+ +GDASESALLKC E S G+  + RE NKK+ EIPFNS NKYQ+SIHET + +D RYLLVMKGAPERIL++C+TI+I   E  +D+  K+ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF    + F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG++LK+M+ +Q+DEIL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  L+G+R+ W+ +T NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K ++ ++    W+ +E
Sbjct:   20 NKDLDDLKKEVPL-------------GLTNAKAAEFLQRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGLSFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKTSVTWVSLARVASLCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSCGSVKQMRERNKKVAEIPFNSTNKYQLSIHETEEPNDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLLMPEDQYPKGFAFDTDDVNFQTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTELKDMSQDQIDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSLLVGIRLSWDDRTANDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLLLRRNPGG-WVEKE 991          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3-like [Source:NCBI gene;Acc:103030580])

HSP 1 Score: 1244.95 bits (3220), Expect = 0.000e+0
Identity = 606/960 (63.12%), Postives = 758/960 (78.96%), Query Frame = 1
Query:  226 GLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            GLT  +A   L  DGPNAL PP   PE +KF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI++  GD T+MGRIA LTSGL+ G+TPI +EI HF+ IIT + + LGV FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA FKA QE   + KR+ +GDASESALLKC E S G+    R+ NKK+ EIPFNS NKYQ+S+HET +  D  YLLVMKGAPERIL++C+TI++   E  +D+  K+ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF    + F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HGSDLKE+T EQ+D++LK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP RL+G+R+ W+ ++ NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ ++    W+ +E
Sbjct:   55 GLTNAKAAEYLARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSLARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHETEEPSDNHYLLVMKGAPERILDRCSTIMVQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLFMPEDQYPKGFAFDTDDVNFKTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGSDLKELTQEQMDDVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSRLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG-WVEKE 1013          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000037921.1 (sodium/potassium-transporting ATPase subunit alpha-1-like [Source:NCBI gene;Acc:107197318])

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 617/985 (62.64%), Postives = 772/985 (78.38%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADD-DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K+++ D H + +EEL  +  +D   GL+   A+  L+ DGPNAL PP   PE VKF K+L GGF  LL  GA+LC++AY IQ   ++   +DNLYLG VL  +VL TGCF YYQEAKSS I++SF K+VPQ++ VIR+ E   ++  ++VVGD+VEVK GDRIPAD+RII A   KVDNS+LTGESEPQ+R+P+ +NEN LET NIAF STN VEGT RGI+I+ GD T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E++         A W  L RIA LCNRA F ADQE+  + KR+ +GDASESALLKC E   G+    R+   KI EIPFNS NKYQ+SIH+ +++ + ++LLVMKGAPERIL++C+TI++   E  +DD  KD F NAY+ELGG+GERVLGFC + L   +FP+ FQFDT++VNFP + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIPI+EVNPRDA ACVVHG DLK++T EQLD++LK+H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A    F YF+I+AE GFLP  L+G+R+ W+ + +NDL+DSY Q+WTY QRK +E+TC+T+FFI+I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+  WW  A P+ + +FI+DE +K I+ +S    W+ RE
Sbjct:   39 KEVELDDHKLTVEELQRKYGTDINRGLSHYRAKEILDRDGPNALTPPPTTPEWVKFCKQLFGGFCTLLWIGAVLCFLAYTIQVTTESEPVKDNLYLGIVLAAVVLITGCFSYYQEAKSSKIMESFKKLVPQQALVIRDGEKKSINAVDVVVGDLVEVKGGDRIPADLRIISAQGCKVDNSSLTGESEPQTRSPQFSNENPLETKNIAFLSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGVSFFILSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTSFDRSSATWAGLARIAGLCNRAVFLADQENVAILKRDTAGDASESALLKCIELCCGSVKAMRDQYTKIAEIPFNSTNKYQLSIHKNSNEGESKHLLVMKGAPERILDRCSTIMLQGKEQPLDDEMKDAFQNAYLELGGLGERVLGFCHFSLPDDQFPEDFQFDTEDVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPINEVNPRDAKACVVHGGDLKDLTPEQLDDVLKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALAGFFTYFVILAENGFLPSELLGIRVYWDDKHMNDLEDSYGQQWTYEQRKIVEFTCHTAFFISIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPNWWFCAFPYSLLIFIYDEIRKLIIRRSPGG-WVERE 1022          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 365/578 (63.15%), Postives = 465/578 (80.45%), Query Frame = 1
Query: 1372 KRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +R   GDASESALL+C E  +GN    R  N+K+ EIPF+S  KYQ+SIHE+ + +DPRYLLVMKGAPERIL++C++I+I   E  +D+  ++ F NAY+ELGG+GERVLG C  RL   +FP+G+ FDT+ +NFP++ L   GL+SMIDPPR +VPDAV KCRSAGIKVIM TGDHPITAKAI+++VGII +G++T+ED+A   NIP+++V+PRDA ACVVHGSDLK MT  QLD+ILK + EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDS ALKKADIGIAMGI GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+    KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP +L+GLRI+W T++ N+L+DSY QEWTY QRK +EYTC+TSFF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+ + +F++DE +K I+ ++    W+ +E
Sbjct:    1 QRNVVGDASESALLRCVELCVGNVRDMRSRNQKVAEIPFDSTIKYQLSIHESDEPNDPRYLLVMKGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGERVLGLCQLRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVRVDKLVNERLISIAYGQIGMIQALGGFFTYFVIMAENGFLPSKLMGLRIEWNTRSQNELEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKLSWWFCAFPYSILIFVYDEVRKLIIRRNPGG-WVEKE 577          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 271/410 (66.10%), Postives = 339/410 (82.68%), Query Frame = 1
Query: 1873 KVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +VIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACVVHGSDLK+MT  QLD+ILK H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+    KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP  LIG+RI W+ +++NDL+DSY QEWTY QRK +EYTC+TSFF++I+V QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+ + +F++DE +K+I+ +     W+ RE
Sbjct:    1 QVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTEIQLDDILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNARVDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPWNLIGIRINWDDKSLNDLEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEVRKFIL-RRHPGGWVERE 409          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009058.1 (pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene:ENSPMAG00000008154.1 transcript:ENSPMAT00000009058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 447.588 bits (1150), Expect = 8.666e-148
Identity = 249/416 (59.86%), Postives = 311/416 (74.76%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDAS 1398
            K++  D H + ++EL+ +  +D   GLT   A   L  DGPNAL PP   PE VKF K+L GGFSLLL  GAILC++AY IQ   ++  + DNLYLG VL  +V+ TGCF YYQE+KSS I+ SF  MVPQ++ VIRE E ++++   +V+GD+VE+K GDRIPAD+RI+ +   KVDNS+LTGESEPQSR+P+ T++N LET NIAFFSTN VEGT RGI+I+ GD+T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L R+A LCNRA F+A QE+  V KR+ +GDAS
Sbjct:   35 KEVSLDDHKLSLDELHRKYGTDLSRGLTNVRAAEILARDGPNALTPPPTTPEWVKFCKQLFGGFSLLLWVGAILCFLAYGIQAATEDEPSNDNLYLGVVLSAVVIITGCFSYYQESKSSRIMDSFRNMVPQQALVIREGEKTQLNAELVVLGDLVEIKGGDRIPADLRIVSSHGCKVDNSSLTGESEPQSRSPDFTHDNPLETRNIAFFSTNCVEGTARGIVINTGDHTVMGRIATLASGLEGGRTPINIEIEHFIHIITGVAVFLGVSFFILSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTAFDKSSPTWTALARVASLCNRAVFQAGQENVPVLKRDVAGDAS 450          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001612.1 (pep scaffold:Pmarinus_7.0:GL478157:83838:93675:1 gene:ENSPMAG00000001454.1 transcript:ENSPMAT00000001612.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.544 bits (680), Expect = 3.462e-82
Identity = 120/254 (47.24%), Postives = 177/254 (69.69%), Query Frame = 1
Query: 2332 GRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLT-FAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTW 3090
            GR+IFDNLKK++ Y   K I EL PFL+YI  SIPLP+G +TIL ID+GTD++PSI+LAYE  ES+IM R+PR+     LV  +L + ++ Q+G+ +A GA   YF +MAE+G+LP   IGLR  WE     +L+DSY QEWT+ QR++ E+ CYT+FF+AI++QQ  +L++ KTRRNS+F  G++ N +    M  +  +A FL YCPGMD  L   PLR  WW +A+ + ++++++DE +K+ + +  ++ W
Sbjct:    1 GRLIFDNLKKSIAYTLTKNIAELCPFLIYIIASIPLPIGTVTILFIDLGTDIIPSIALAYEKPESDIMNRRPRNARIDHLVNSKLATYSYLQIGVTQAVGAFLSYFTVMAEEGWLPITCIGLRKHWEQVDEQELEDSYGQEWTFVQRQQQEFVCYTAFFVAIVIQQLADLVIRKTRRNSVFTQGLFRNKVVLLGMLSQLVIAAFLSYCPGMDEGLHFMPLRVGWWFVAISYAIFIWLYDEMRKFFIRRYPESWW 254          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.077 bits (671), Expect = 2.718e-74
Identity = 249/873 (28.52%), Postives = 421/873 (48.22%), Query Frame = 1
Query:  628 GDRIPADIRI--IKASSFKVDNSALTGESEPQSR------TPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSL------GYYWLDGILFLIGIIVAVI----PVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNR-------IHEYPLS------ESEIDEDQAEDRAA-WQVLLRIAI---LCNRAQFKADQEDKVVWKRECSGDASESALLKCGE-------HSMGNSSKYRENN-----KKIVEIPFN---SLNKYQVSIHETADDDPRYL----LVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGE--RVLGFCDY----RLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNN-HLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYI 3063
            GD++PADIR+  IK+++ +VD S LTGES    +       P   N+   +  N+ F  TN   G   G++++ G NT +G+I    +  +Q +TP+ ++++ F   ++ +   + +  +II +        G  W+ G ++   I VA+     P GL A +T  L L  +RMA+KN +V++L +VETLG TSVICSDKTGTLT N M+V   +  +R       ++E+ ++      E E+ ++    R   +  L+ +A    LCN +    ++   V  K    G+A+E+AL    E       H +G S   R N      K++++  F    S ++  +S++ T     R      + +KGAPE ++++C+ + +G T+  +    K++      E G   +  R L         R +        +F + EV+    G    G   M+DPPR  V  ++  CR AGI+VI   GD+  TA AI R +GI  +  + ++D A+                    G +  ++  E+  + L       FAR  P  K +IV+  Q    I A+TGDGVND+PALKKA+IGIAMG SG+ V+K A++M+L DDNF+SIV  +E+GR I++N+K+ + Y     + E+V   L  A+  P  L  + +L +++ TD LP+ +L +   + +IM+R PR+P K  L++  L     A    + A       +  MA      D   G+     +  +    +  + E       +  Y    +  + + ++   N L   +   S+ +   W+N  L  A+     L   ++Y   + +I ++ PL    WL+ +   + + + DE  K+I
Sbjct:    4 GDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQ---DKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEK---VGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSVYCTPVKPSRSSVGNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVG---MLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGE-DEDVKDKAYT-------------------GREFDDLPLEE--QRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNP-KEPLISGWLFFRYLAIGCYVGAATVGAAAWWFMAA-----DDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEM-CNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFI 834          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 385.956 bits (990), Expect = 2.081e-118
Identity = 301/988 (30.47%), Postives = 491/988 (49.70%), Query Frame = 1
Query:  178 IPIEELYERLKSDPITGL-TQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNEN-----------ILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTW----YSNRIHEYPLSESEIDEDQAEDRAAW-----QVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVS-IHETADDDPRYLLVMKGAPERILEKCATILI--GETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPR---DPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHL-TFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKK 3057
            + ++E  E+L +D   GL + NEA  R    GPN +    +     KFL        +LL+ G+ +  ++  +  I D         +   L + ++ T  F   QE +S   +++  K+VP + +++R  + S V  + LV GD+V  + GDRIPADIRII+A    +D S LTGE+EP  +T +   ++           I E S IA+  T   EG  +GI++  G NT  G +  + + +++ +TP+   ++     ++++   +  +  ++ +  G  WL+     + + VA IP GL   VTV L L   RMA++  +V+ L +VETLGS +VICSDKTGTLT N MTV+  W     SN+++   L +++  ++   +   +     +  L I  LCN A F   QE  +       G+ ++ ALL+  + +       R   +K+ E+PFNS  K   + I    D+  +  + +KGA ERILE   + L   G+   ++ +  K   N     +   G RV GF    L  +  P      T+++   +K L F GLI M DPPRP+V  A+E+    G+ +IM+TGD   TA  I++ +GI                 P+  ++P+     V+ G  L EM+ +QL  ++ + N  +FAR +P+ KL IV   +++G +VA+TGDGVND+PALK +DIG++MG  G+DV+K+A+DM+L DD+F++I+T IE+G+ IF+N++  + +    ++  L    L  A  +P PL AM IL I+I  D  P+ SL  E  +  +MK+ PR   D +    V +RL  LT A   I+   G ++++   MAE G                               A+   + +TC+  F         +N L  +    SIF+ G + N +  +A+       +  +Y P    I K + L  +  L+ +     +FI DE +K
Sbjct:   41 LSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAV--VSLFMGNIDD--------AVSITLAIFIVVTVGFV--QEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFS--QEHAIFL-----GNPTDVALLE--QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDN--KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPL-----TEDL---IKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI-----------------PV--IDPK---LSVLSGDKLDEMSDDQLANVIDHVN--IFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRL--LTTAACIIV---GTVYIFVKEMAEDG----------------------------KVTARDTTMTFTCFVFF-------DMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRK 933          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 286.189 bits (731), Expect = 2.009e-81
Identity = 315/1108 (28.43%), Postives = 490/1108 (44.22%), Query Frame = 1
Query:  145 ENKDLDTDA-HNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETS-----NIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQ--GRTP-----------------------IGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAV--IPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWY--------SN----------------RIHEYPLSESE--------------IDEDQAED--RAAWQVLLRIAILCNRAQ-FKADQEDKVVWKRECSGDASESAL------------LKCGEHSMGNS-----SKYRENNKK--------IVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEI----DDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVN-------FPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSI---------PLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLL----VVKTRRNSI------------FQSGMWNNHLTF-AMFFETCLALFLVYCPGM-DLILKMQPLRFTWWLIAMPFGVYLFIFDEFKK 3057
            EN + + +A H +  EE  E + +    GLTQ+E+  RL+  G N L    ++      L ++     ++L+       I+  I +   + +T     + FV+ V VL        QE K++  + S   +    ++VIR  +   +++ ++V GD+  VK GD IPAD+R+I+  +F  D S LTGES P S+          ETS     N+AF S+  V+G  +GI+I    N+ +G+IA    G      R P                       +G  ++  ++ + V+   + V+F II ++   + +D  + +  I VA+  IP  L+  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ  M     W         SN                R   Y  S +E               ++D  ED     +Q  L  A L N A  FK D  D   WK    GD +E A+               GE S   S     S   ++N+K        I E PF+S  K   S++   + +  Y +  KGA E I+  C++   G+   +I    D   +    N Y  L   G RVLGF      +  F K  Q + D++             L F GLI + DPPR     AV+K   AGI V M+TGD   TAKAI++ VGI+        +L H         +    ++ V+ GS    ++ E++D++      +V AR SPQ K+++++   R+    A+TGDGVNDSP+LK A++GIAMGI+GSDVSK+A+D++L DDNFASI+  +E+GR + DN++K V+    + + E V   LY+ + +           PL  + +L I + T   P++ L  E +  ++M R P D   G    E +I                F Y IIM   G       G         IN  +  ++ + TY    +     Y S   A     W  L+    VV  RR+              F   +W N   F ++ F    A  +VY P + D +   +P+   W L A+ F +  +I  E  K
Sbjct:    8 ENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLV-------ISMAISFAVRDWITGG--VISFVIAVNVLIG----LVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD--CWK--AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYN-NHNETYNIYGKGAFESIISCCSS-WYGKDGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFA-----SKSFTKD-QVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT------NLYH--------YSQEIVDSMVMTGSQFDGLSEEEVDDLPVL--PLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVL----QLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIID--------------TFAYGIIMT--GSCMASFTG-----SLYGINSGRLGHDCDGTYNSSCR---DVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGL-AIAFTIAFWIGAELYK 1044          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 285.804 bits (730), Expect = 2.411e-81
Identity = 315/1108 (28.43%), Postives = 490/1108 (44.22%), Query Frame = 1
Query:  145 ENKDLDTDA-HNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETS-----NIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQ--GRTP-----------------------IGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAV--IPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWY--------SN----------------RIHEYPLSESE--------------IDEDQAED--RAAWQVLLRIAILCNRAQ-FKADQEDKVVWKRECSGDASESAL------------LKCGEHSMGNS-----SKYRENNKK--------IVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEI----DDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVN-------FPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSI---------PLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLL----VVKTRRNSI------------FQSGMWNNHLTF-AMFFETCLALFLVYCPGM-DLILKMQPLRFTWWLIAMPFGVYLFIFDEFKK 3057
            EN + + +A H +  EE  E + +    GLTQ+E+  RL+  G N L    ++      L ++     ++L+       I+  I +   + +T     + FV+ V VL        QE K++  + S   +    ++VIR  +   +++ ++V GD+  VK GD IPAD+R+I+  +F  D S LTGES P S+          ETS     N+AF S+  V+G  +GI+I    N+ +G+IA    G      R P                       +G  ++  ++ + V+   + V+F II ++   + +D  + +  I VA+  IP  L+  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ  M     W         SN                R   Y  S +E               ++D  ED     +Q  L  A L N A  FK D  D   WK    GD +E A+               GE S   S     S   ++N+K        I E PF+S  K   S++   + +  Y +  KGA E I+  C++   G+   +I    D   +    N Y  L   G RVLGF      +  F K  Q + D++             L F GLI + DPPR     AV+K   AGI V M+TGD   TAKAI++ VGI+        +L H         +    ++ V+ GS    ++ E++D++      +V AR SPQ K+++++   R+    A+TGDGVNDSP+LK A++GIAMGI+GSDVSK+A+D++L DDNFASI+  +E+GR + DN++K V+    + + E V   LY+ + +           PL  + +L I + T   P++ L  E +  ++M R P D   G    E +I                F Y IIM   G       G         IN  +  ++ + TY    +     Y S   A     W  L+    VV  RR+              F   +W N   F ++ F    A  +VY P + D +   +P+   W L A+ F +  +I  E  K
Sbjct:    8 ENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLV-------ISMAISFAVRDWITGG--VISFVIAVNVLIG----LVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD--CWK--AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYN-NHNETYNIYGKGAFESIISCCSS-WYGKDGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFA-----SKSFTKD-QVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT------NLYH--------YSQEIVDSMVMTGSQFDGLSEEEVDDLPVL--PLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVL----QLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIID--------------TFAYGIIMT--GSCMASFTG-----SLYGINSGRLGHDCDGTYNSSCR---DVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGL-AIAFTIAFWIGAELYK 1044          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 285.804 bits (730), Expect = 2.434e-81
Identity = 315/1108 (28.43%), Postives = 490/1108 (44.22%), Query Frame = 1
Query:  145 ENKDLDTDA-HNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETS-----NIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQ--GRTP-----------------------IGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAV--IPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWY--------SN----------------RIHEYPLSESE--------------IDEDQAED--RAAWQVLLRIAILCNRAQ-FKADQEDKVVWKRECSGDASESAL------------LKCGEHSMGNS-----SKYRENNKK--------IVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEI----DDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVN-------FPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSI---------PLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLL----VVKTRRNSI------------FQSGMWNNHLTF-AMFFETCLALFLVYCPGM-DLILKMQPLRFTWWLIAMPFGVYLFIFDEFKK 3057
            EN + + +A H +  EE  E + +    GLTQ+E   RL+T G N L    ++      L ++     ++L+       I+ +I +   + +T     + FV+ V VL        QE K++  + S   +    ++VIR  +   +++ ++V GD+  VK GD IPAD+R+I+  +F  D S LTGES P S+          ETS     N+AF S+  V+G  +GI+I    N+ +G+IA    G      R P                       +G  ++  ++ + V+   + V+F II ++   + +D  + +  I VA+  IP  L+  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ  M     W         SN                R   Y  S +E               ++D  ED     +Q  L  A L N A  FK D  D   WK    GD +E A+               GE S   S     S   ++N+K        I E PF+S  K   S++   + +  Y +  KGA E I+  C++   G+   +I    D   +    N Y  L   G RVLGF      +  F K  Q + D++             L F GLI + DPPR     AV+K   AGI V M+TGD   TAKAI++ VGI+        +L H         +    ++ V+ GS    ++ E++D++      +V AR SPQ K+++++   R+     +TGDGVNDSP+LK A++GIAMGI+GSDVSK+A+D++L DDNFASI+  +E+GR + DN++K V+    + + E V   LY+ + +           PL  + +L I + T   P++ L  E +  ++M R P D   G    E +I                F Y IIM   G       G         IN  +  ++ + TY    +     Y S   A     W  L+    VV  RR+              F   +W N   F ++ F    A  +VY P + D +   +P+   W L A+ F +  +I  E  K
Sbjct:    8 ENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLL-------ISMIISFAMHDWITGG--VISFVIAVNVLIG----LVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD--CWK--AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYN-NHNETYNIYGKGAFESIISCCSS-WYGKDGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFA-----SKSFTKD-QVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT------NLYH--------YSQEIVDSMVMTGSQFDGLSEEEVDDLPVL--PLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVL----QLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIID--------------TFAYGIIMT--GSCMASFTG-----SLYGINSGRLGHDCDGTYNSSCR---DVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGL-AIAFTIAFWIGAELYK 1044          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: PMA1 (Plasma membrane P2-type H+-ATPase; pumps protons out of cell; major regulator of cytoplasmic pH and plasma membrane potential; long-lived protein asymmetrically distributed at plasma membrane between mother cells and buds; accumulates at high levels in mother cells during aging, buds emerge with very low levels of Pma1p, newborn cells have low levels of Pma1p; Hsp30p plays a role in Pma1p regulation; interactions with Std1p appear to propagate [GAR+] [Source:SGD;Acc:S000002976])

HSP 1 Score: 204.912 bits (520), Expect = 8.197e-55
Identity = 200/755 (26.49%), Postives = 345/755 (45.70%), Query Frame = 1
Query:  181 PIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSF-KVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGIL----FLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEI-PFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAV 2427
            P+ E Y  L++DP  GLT +E   R +  G N +   KE   +VKF+    G    ++ A AIL   A L  ++            G +  +++L  G   + QE ++ +I+    K +   + VIR+ ++ E+    +V GD+++++ G  IP D RI+    F ++D SA+TGES    +             +  F S+    G    ++ + GDNT +GR A L +    G+      +N    I+ V+ I       ++  +  +Y  +GI+    + +GI +  +PVGL A VT  + + A  +A+K  +V+ L A+E+L    ++CSDKTGTLT+N ++         +HE P +   +  D         ++L   +  +R +   D  DK   K       ++ AL           +KY     K++E  PF+ ++K   ++ E+ + +   ++ +KGAP  +L+        E ++ I +   + + N   EL   G R LG    R +                         G++  +DPPR      V + R  G++V M+TGD          AVGI ++   T   L    NI          NA  +      +M   +L + ++  N   FA   PQ K ++V+  Q +G +VA+TGDGVND+P+LKKAD GIA+    +D ++ AAD++ L    ++I+  ++  R IF  +   V+Y    ++   +   L+IA+
Sbjct:   74 PVPEEY--LQTDPSYGLTSDEVLKRRKKYGLNQMADEKE-SLVVKFVMFFVGPIQFVMEAAAILA--AGLSDWVD----------FGVICGLLMLNAGV-GFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDK----------HYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLVIAT----LLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLS---------LHE-PYTVEGVSPDD--------LMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDAL-----------TKY-----KVLEFHPFDPVSKKVTAVVESPEGE--RIVCVKGAPLFVLKTV------EEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGH-------------------WEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGD----------AVGIAKE---TCRQLGLGTNI---------YNAERLGLGGGGDMPGSELADFVE--NADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI 712          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 1211.05 bits (3132), Expect = 0.000e+0
Identity = 607/1001 (60.64%), Postives = 755/1001 (75.42%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADD----------------DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFD-TDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD D H I +EEL  RL ++  TGLT  EA +RL+ DGPNAL PP   PE VKF+K++ GGF++LL  GAILC+IA  I    +    RDNLYLG VL  +V+ TG F YYQE+KSS I++SF  +VPQ++NV+R      V   NLV+GDVV VK GDR+P DIRI++  SFKVDNS+LTGESEPQSR P+CT+EN LET N+AFFST A+EG   G+++  GDNT+MGRIA+L SGL  G+TPI  EI HF++IIT + + LGV FFIIA  L Y WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH WY N I E   SE +      +    W  L R+A LCNRA+FKADQEDK V KREC+GDASESALLK  E ++GN   +R+N+KK+ EIPFNS NKYQVSIHE  D+                + +++LVMKGAPERIL++C+TIL+   E  +DD  K+ FN AY++LGG+GERVLGFC + L   +FP GF+FD  D  NFPL+GL F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+ EV+   A A VVHGS LK+   E++D IL  H EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I + IPLPLG +TILCID+GTDM+P+ISLAYE +E++IMKR+PRDP+  KLV ERLI++ + Q+G+I+A+   F YF+IMAE GF P  L GLR QW+ +  + + DSY QEW Y+QRK LEYTC+T+FF++I++ QW +L++ KTRRNS+F  GM N  L F +FFET LA F  Y PGM   L+M PL + WW  AMPF + ++I+DE +++I+ +     W+ +E
Sbjct:   65 QELDVDWHRITVEELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPPPTTPEWVKFMKQMFGGFAMLLWIGAILCFIAQGIMEATEEEPLRDNLYLGIVLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLRSGGRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKSFKVDNSSLTGESEPQSRGPDCTHENPLETRNLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAFILKYKWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTSEDQKQASGEKKSTTWYALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVELAIGNVISFRKNHKKVCEIPFNSTNKYQVSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQAYLDLGGLGERVLGFCHFYLPTEQFPLGFEFDPEDNPNFPLEGLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQEKIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPRDPINDKLVNERLIAMAYGQIGMIQASAGFFTYFVIMAENGFRPSLLFGLRRQWDDKYNHSVVDSYGQEWGYSQRKILEYTCHTAFFVSIVIVQWADLIICKTRRNSLFTQGMTNKFLNFGLFFETALAAFFSYTPGMSNGLRMYPLNWQWWFPAMPFSLIIWIYDECRRWILRRY-PGCWLDKE 1064          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 586/991 (59.13%), Postives = 736/991 (74.27%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQA----EDRAAWQVLLRIAILCNRAQFKADQEDKVVWKREC-SGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRY--LLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++L+ D H +P+E L  RL S    GL+Q EA +RLE DGPN L PP   PE VKFLK L GGFSLLL  GAI C+I Y I+   +    +D+LYLG  L  +V+ T CF YYQE+KSS I+ SF  MVPQ++ ++R+ +    +   +V+GD++ V  GDR+PADIR+I++  FKVDNS+LTGESEPQ+R PE T+EN LET N+AFFSTNAVEGTC GI++  GDNT+MGRIA L SGL  G+TPI  EI HF++IIT + + LGV FFII+L LGY  L  ++FLIGIIVA +P GLLATVTV LTLTAKRMA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+  E     ++  EDQ+    E    W  L RIA LCNRA+F + Q++  V +R+   G+ASE+ALLKC E  +G+ +K RE   ++ EIPFNS NKY VSIHE  D++  Y   L+MKGAPER+L++C+TILI      +DD  K  F  AY++LGGMGERVLGF  + LD   FP GF+F+TDE NFP++GL F GL+SMIDPPR +VPDAV KCRSAGIKV MVTGDHPITAKAI++ VGII +G++T+ED++    IP+ EV+   A+A VVHG +LK+MT + +D+ILK H EIVFARTSPQQKL IV+GCQR G+IVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   IP PLG +TILCID+GTDM+P+ISLAYE +ES+IMKR PRDP   KLV ERLIS+T+ Q+G ++A+     YF+IMAE GFLP  L  +R  WE +T N L DSY QEW YAQRK LE+TC+++FF++I+V QW +L++ KTRRNSI    M N+ L   + FET LA FL+Y PG+   L +  L  +WW I +P+ + +F++DE ++YI+ K     W+ +E
Sbjct:   72 QELEVDWHKVPLEALVNRLDSSVEKGLSQEEAEVRLERDGPNCLTPPPTTPEWVKFLKLLFGGFSLLLWVGAIFCYIVYSIKMSVEEEPPQDDLYLGVTLTFVVVVTACFSYYQESKSSKIMDSFKNMVPQEATILRDGKKVVKNAEQVVIGDIIFVAIGDRVPADIRVIESKGFKVDNSSLTGESEPQARGPEFTHENPLETKNLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVALGVTFFIISLVLGYTILQAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFE-----ADTTEDQSGTAMEKTETWTALGRIAGLCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVELQVGSVTKMREEFHRVAEIPFNSTNKYHVSIHEINDENSTYSHHLLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVLGFAQHYLDKENFPIGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLISMTYGQIGFMQASAGFLTYFVIMAENGFLPGDLFNIRGLWEDKTNNTLLDSYGQEWGYAQRKVLEFTCHSAFFVSIVVVQWADLIICKTRRNSIITQKMNNHILIIGLIFETALAAFLLYTPGLSTALSLYGLNASWWFIGVPYSILIFVYDEVRRYILRKYPGG-WVEQE 1056          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 347.821 bits (891), Expect = 2.709e-104
Identity = 286/1001 (28.57%), Postives = 472/1001 (47.15%), Query Frame = 1
Query:  169 AHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRT----PEC-TNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLD--GIL--FLIGI--IVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHE-------YPLSESEIDED--QAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGD----ASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLIS-LTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLV-YCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYI---VSKSKKN 3084
            A  + +EE+ ++  +D   GL+ +E   R    G N     +E     K+L +      LLL+A     +++  +    D           F + V +L      + QE +S   +++  K+VP + + +R  ++       LV GD+V +  GDR+PADIR+ +A   ++D S+ TGE EP S+T    P   +   +    NIAF  T    G  +G++I  G+N+  G I  L    +  +TP+ + ++     ++           II L +   W+    IL  F IG+   VA IP GL   VTV L L   RMA++N +VK L  VETLG +SVICSDKTGTLT+N MTV+  + ++  +         PL E  ++ED       ++    +    LCN A  +    + V++ +   G     A +++   CG   +    +   + KK++ +     ++   ++ E A D    +  +KGAPE ++ +C +     +   +     +   +A + +   G RV+ F                        L+ L + G++ ++DPPR  V +AV     +G++V M+TGD   TA  I+  +GI  KG  T+                         G +L+ +   QL  I+   +  VF R SP+ K+ IV   Q+ G +VA+TGDGVND+ ALK+ADIGIAMG SG+DVSK+AA+MIL+DD+F +I+  IE+G+ IF N+K  V +    +I  +    +   + +P PL AM IL I+I  D  P+ SL  E  +S++M+R PR+ VK  ++T+ LI+ +  A + I+   G ++V++  M +    P                  +D+            + +TC+  F         +N L  +++  SIFQ G   N +       + +  FLV Y   +  + + + L  T  L+ +     +FI DE +K+I   VSK ++ 
Sbjct:   11 ASAMAVEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASG---FVSICMGQFDD----------AFSITVAILIVVTVAFVQEYRSDKSVEAITKLVPPQCHCVRAGKMFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLEIDESSFTGEMEPASKTTLPIPAVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLSFYS------LCIIGLIVLLGWIQKRAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPLGEVILNEDPITYTSNSSIAKTVEAGYLCNNASIR----NGVLYGQPTEGAIVTVAQKASTFTCGIDFVRVDERPFSSEKKLMAVKCRRKHRSS-AMAEIARD----IYYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGDAVLAMSSRGLRVIAFAHGE-------------------DLQQLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPTLS------------------------GEELEALDGLQLSTIIDQVS--VFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRN-VKSPMITKTLIAKVISAALLIV--CGTLWVFWREMRDNIITP------------------RDT-----------TMTFTCFVFF-------DMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFITYRVSKRRRQ 899          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 336.265 bits (861), Expect = 2.895e-99
Identity = 290/1037 (27.97%), Postives = 489/1037 (47.16%), Query Frame = 1
Query:  169 AHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRE--SEISEVDTTNLVVGDVVEVKFGDRIPADIRI--IKASSFKVDNSALTGES-EPQSRTPECTNENIL--ETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYY--------WLDGILFLIGIIVAVI----PVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNR--------IHEYPLSESEIDE--DQAED-----RAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALL-----------------KCGEHSMGNSSKYRENNKKIVEIPFN----SLNKYQVSIHETADD--DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDE--VNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMT-SEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQ---RKKLEYTCYT-------SFFIAIMVQ-QWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLV-YCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYI 3063
            AH  P+ E+ +        GL   + +   +  GPN L      P     L++       +L+  A++ ++  L +   D            V+LVI++       +QE  + + I++  +  P+ + V R+  S I  +   +LV GD+VEV  GD++PADIRI  IK+++ +VD S LTGES      T    +E  +  + +N+ F  TN   G C G+++  G +T +G+I          RTP+ ++++ F   ++ +   + +  +  A+++G++        WL G ++   I VA+     P GL A VT+ L L  +RMA+KN +V++L +VETLG TSVICSDKTGTLT N M+V H ++  +         HE+ +  +  D   D  +D      + ++VL   A +C+     +   + V    E  G+++E+AL+                 K    ++ N S     NK+   + F+    S++ Y V   +  +   D +  + +KGAPE IL++C  + +G  ++ +    K +  +     G   + +       +D    P     +  E  VN+    + F G+  M+DPPRP V DA++ C  AGI+VI++TGD+  TA+AI R + +  +                      D       G +  ++T SEQ +  L+     +F+R  P  K +IV   Q +G I A+TGDGVND+PALKKA+IG+AMG SG+ V+K A++MIL DDNF++IV  +E+GR I+DN K+ + Y     I E+V   L  A+ +P  L  + +L +++ TD  P+ +L++   +S+IM + PR P       + LIS               +++F  +A   ++    +G    W     N  K SY Q   + Q          C         +  ++++V  + +N L       S+     W N         + L  FL+ Y P  + I ++ PL +  W+  + F   + + DE  K+I
Sbjct:    4 AHTKPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKPLWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTA---FVEPIVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQMIKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIPDERAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVW--AINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV-HKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFT-LEFSRDRKSMSVYCVPQKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYE-SHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQD--------------------EDTTGLSYSGREFDDLTPSEQREACLRAR---LFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMG-SGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSP------RQPLIS--------------GWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPSFGLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFI 988          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 194.126 bits (492), Expect = 1.793e-50
Identity = 189/645 (29.30%), Postives = 289/645 (44.81%), Query Frame = 1
Query:  991 WLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHE-YPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWK--REC----SGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATIL--IGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMI---------DPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDG-----CQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLIS--LTHAQMGIIEATGAMFVYFIIMA-----EQGFLPDRLIG----LRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIM 2820
            +++  +  + ++V  +P GL   VT+ L  + K+M   N LV++L+A ET+G+ + ICSDKTGTLT N MTV   +   + H+  P +  E   +  E            ILC      +      V    RE      G+ +E ALL            YR+NN +   +   + N  + S+       D  Y L  KGA E +L +C +I+   G+ E            +    +   G R +    YR    +FP   +   D  + P      AG++S +         DP R  VP A++KC+ AGI V MVTGD+  TA++I+   GI+      +     E N  I + N R              ++ ++ DEI  +    V AR+SP+ K  +V G           IVAVTGDG ND PALKKAD+G AMGI+G+DV+K+A+D+IL DDNF SIV  +  GR ++D++ K + +     +  +V   +   V    PL    +L +++  D   S++LA E     ++ RKP    K  L+T  +I   L H    II     +FV     A     E GFL +          + + T  +  L +  N    + +R   +       F+ IM
Sbjct:  384 YVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTMGQHHKTIPENPKEFSPELLE------------ILCKGIALNSSYASNCVVNGGREILPMQVGNKTECALLGLVLDLGDTYQDYRDNNPESTFVKVYTFNSSRKSMSTAIRMPDGGYRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMA-YR----DFPPTGK---DHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRDSNGR--------------VSQKKFDEI--WPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTK-PLITRTMIRNILGHGVYQII----VLFVLVFKGAEFFDIEDGFLEETRCKPTQHSAVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIM 987          

HSP 2 Score: 64.6994 bits (156), Expect = 1.933e-10
Identity = 53/205 (25.85%), Postives = 97/205 (47.32%), Query Frame = 1
Query:  268 GPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPD-------NNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHL 861
            GPN + PPK      +FL +     +L+++  A +  +   I + P+       N    D   +   + ++ L T    Y +E +   +       +  K  VIR  +  E+  + +VVGD+ ++K+GD +PAD  +++++  KVD S+LTGES+   +          E   +    T+ +EG+ + I+ +VG N+  G I  L
Sbjct:   86 GPNVI-PPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGI-FAPEECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKI--ELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKKG---------EKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTL 277          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000046641.1 (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101159291])

HSP 1 Score: 1262.28 bits (3265), Expect = 0.000e+0
Identity = 616/985 (62.54%), Postives = 773/985 (78.48%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + IEE+  +L +D + GLT  +A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD++EVK GDRIPADIRI+ A   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI+I  GD T MGRIA L SGL  G+TPI +EI HF++IIT + + LG+ FFI+A+ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    WQ L RIA LCNRAQFKA Q+   + KR+ +GDASESALLKC E S G+    R+ NKK+ EIPFNS NKYQ+S+HET D +D RYLLVMKGAPERIL++C+TI++   E  +D+  K+ FNNAYMELGG+GERVLGFC   L   ++PKGF FDTD+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+++ EQ+D+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALK ADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P + KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+RI W+ +  NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ TWW  A+P+   +F++DE +K ++ ++    W+ RE
Sbjct:   24 KEVPITEHKMSIEEICRKLNTDIVQGLTNAKAAEFLIRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLTAVVVITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKVQINAEEVVAGDLIEVKGGDRIPADIRIVSAHGCKVDNSSLTGESEPQNRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVIYTGDRTAMGRIATLASGLDTGKTPIAKEIEHFIHIITGVAVFLGISFFILAIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSLTWQALSRIAALCNRAQFKAGQDPIPILKRDVAGDASESALLKCIELSCGSVRAMRDRNKKVAEIPFNSTNKYQLSVHETEDPNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFNNAYMELGGLGERVLGFCHILLPEDQYPKGFAFDTDDVNFQTSNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQEQIDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKMADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPFRDKLVNERLISIAYGQIGMIQALGGFFTYFVILAENGFLPSRLVGIRIDWDDRAQNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILVFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAVPYSFLIFVYDEVRKLLIRRNPGG-WVERE 1007          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101168472])

HSP 1 Score: 1254.97 bits (3246), Expect = 0.000e+0
Identity = 614/985 (62.34%), Postives = 770/985 (78.17%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADD-DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++    H + +EE+  +  +D + GLT   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+R+I +   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI++  GD T+MGRIA LTSGL+ G+TPI +EI HF+ IIT + + LGV FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FKA Q+   + KRE +GDASESALLKC E S G     R+ NKK+ EIPFNS NKYQ+SIHE  D+ D RYLLVMKGAPERIL++C+TI+I   E  +DD  ++ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF  + L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK++T EQ+D+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP  L+G+R+ W+ ++ NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ +S    W+ +E
Sbjct:   36 KEVPITEHKMSVEEVCRKYNTDIVQGLTNALAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEQVVAGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGSSFDKSSTTWVSLARIAALCNRAVFKAGQDALPILKREVAGDASESALLKCIELSCGPIKVIRDKNKKVAEIPFNSTNKYQLSIHENEDENDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDDEMREAFQNAYLELGGLGERVLGFCHLFMPEDKYPKGFAFDTDDVNFSTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLTQEQMDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKVILRRSPGG-WVEKE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101168472])

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 612/980 (62.45%), Postives = 768/980 (78.37%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADD-DPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNT 3087
            K++    H + +EE+  +  +D + GLT   A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD+VEVK GDRIPAD+R+I +   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI++  GD T+MGRIA LTSGL+ G+TPI +EI HF+ IIT + + LGV FFI+++ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    W  L RIA LCNRA FKA Q+   + KRE +GDASESALLKC E S G     R+ NKK+ EIPFNS NKYQ+SIHE  D+ D RYLLVMKGAPERIL++C+TI+I   E  +DD  ++ F NAY+ELGG+GERVLGFC   +   ++PKGF FDTD+VNF  + L F GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK++T EQ+D+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P++ KLV ERLIS+ + Q+G+I+A G  F YF+IMAE GFLP  L+G+R+ W+ ++ NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ +WW  A P+   +F++DE +K I+ +S  ++
Sbjct:   36 KEVPITEHKMSVEEVCRKYNTDIVQGLTNALAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEQVVAGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGSSFDKSSTTWVSLARIAALCNRAVFKAGQDALPILKREVAGDASESALLKCIELSCGPIKVIRDKNKKVAEIPFNSTNKYQLSIHENEDENDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDDEMREAFQNAYLELGGLGERVLGFCHLFMPEDKYPKGFAFDTDDVNFSTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLTQEQMDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKVILRRSPGDS 1015          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000016540.2 (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101159291])

HSP 1 Score: 1250.73 bits (3235), Expect = 0.000e+0
Identity = 617/989 (62.39%), Postives = 772/989 (78.06%), Query Frame = 1
Query:  148 NKDLDTDAHNIPI-EELYERLKSDP--ITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETAD-DDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
             KD+D     +PI  +++  L S     TGLT  +A   L  DGPNAL PP   PE VKF ++L GGFS+LL  GAILC++AY IQ   ++    DNLYLG VL  +V+ TGCF Y+QEAKSS I++SF  MVPQ++ VIRE E  +++   +V GD++EVK GDRIPADIRI+ A   KVDNS+LTGESEPQ+R+P+CT++N LET NIAFFSTN VEGT RGI+I  GD T MGRIA L SGL  G+TPI +EI HF++IIT + + LG+ FFI+A+ LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E +      +    WQ L RIA LCNRAQFKA Q+   + KR+ +GDASESALLKC E S G+    R+ NKK+ EIPFNS NKYQ+S+HET D +D RYLLVMKGAPERIL++C+TI++   E  +D+  K+ FNNAYMELGG+GERVLGFC   L   ++PKGF FDTD+VNF    L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIP+S+VNPRDA ACV+HG+DLK+++ EQ+D+IL+ H EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALK ADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL +I V+IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P + KLV ERLIS+ + Q+G+I+A G  F YF+I+AE GFLP RL+G+RI W+ +  NDL+DSY Q+WTY QRK +E+TC+T+FF++I+V QW ++++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+ TWW  A+P+   +F++DE +K ++ ++    W+ RE
Sbjct:   10 QKDMDDLKKEVPIVSKVFLDLISQMQFSTGLTNAKAAEFLIRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLTAVVVITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKVQINAEEVVAGDLIEVKGGDRIPADIRIVSAHGCKVDNSSLTGESEPQNRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVIYTGDRTAMGRIATLASGLDTGKTPIAKEIEHFIHIITGVAVFLGISFFILAIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSLTWQALSRIAALCNRAQFKAGQDPIPILKRDVAGDASESALLKCIELSCGSVRAMRDRNKKVAEIPFNSTNKYQLSVHETEDPNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFNNAYMELGGLGERVLGFCHILLPEDQYPKGFAFDTDDVNFQTSNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQEQIDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKMADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPFRDKLVNERLISIAYGQIGMIQALGGFFTYFVILAENGFLPSRLVGIRIDWDDRAQNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILVFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAVPYSFLIFVYDEVRKLLIRRNPGG-WVERE 997          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: atp1a1b (sodium/potassium-transporting ATPase subunit alpha-1 [Source:NCBI gene;Acc:101156309])

HSP 1 Score: 1238.4 bits (3203), Expect = 0.000e+0
Identity = 616/986 (62.47%), Postives = 768/986 (77.89%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHE--TADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            K++D + H + ++EL  + ++D   GLT   +   L  DGPNAL PP   PE VKF K++ GGFS+LL  GA+LC++AY IQ   +     DNLYLG VL  +V+ TGCF YYQEAKSS I+ SF  +VPQ++ V+R+ E   ++   +VVGD+VEVK GDRIPAD+RII A+  KVDNS+LTGESEPQ+RTP+ +NEN LET NIAFFSTN VEGT RGI+IS GD T+MGRIA L SGL+ GRTPI  EI HF++IIT + + LGV FFI++L LGY WL+ ++FLIGIIVA +P GLLATVTV LTLTAKRMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+IHE   +E++         A W  L RIA LCNRA F A+Q +  + KR+ +GDASESALLKC E   G+  + R+ + KI EIPFNS NKYQ+SIH+   +D + ++LLVMKGAPERIL++C+TI++   E  +DD  KD F NAY+ELGG+GERVLGFC + L   +FP+GF FDT+EVNFP + L F GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G++T+ED+A   NIPI+EVNPRDA ACVVHG DLK++  EQLD+ILKYH EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFLL+I  +IPLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKR+PR+P   KLV ERLIS+ + Q+G+I+A    F YF+I+AE GFLP  L+G+R+ W+ + INDL+DSY Q+WTY QRK +E+TC+T+FF +I++ QW +L++ KTRRNS+FQ GM N  L F +F ET LA FL YCPGMD+ L+M PL+  WW  A P+ + +FI+DE +K I+ +S    W+ RE
Sbjct:   38 KEVDMEDHKLTLDELSRKYETDLSNGLTGARSAEILARDGPNALTPPPTTPEWVKFCKQMFGGFSMLLWTGAVLCFLAYGIQAAMEEEPANDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKKSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRTPDFSNENPLETRNIAFFSTNCVEGTARGIVISTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTTFDRSSATWTALARIAGLCNRAVFLAEQSNIPILKRDVAGDASESALLKCIELCCGSVQEMRDRSPKIAEIPFNSTNKYQLSIHKNSASDSESKHLLVMKGAPERILDRCSTIMMQGKEQPLDDEMKDAFQNAYLELGGLGERVLGFCHFNLPDEQFPEGFAFDTEEVNFPTENLCFIGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPINEVNPRDAKACVVHGGDLKDLAPEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSTLVGIRVFWDNKYINDLEDSYGQQWTYEQRKIVEFTCHTAFFASIVIVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPNWWFCAFPYSLLIFIYDEIRKLILRRSPGG-WVERE 1022          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000008146.1 (SMESG000008146.1)

HSP 1 Score: 1996.48 bits (5171), Expect = 0.000e+0
Identity = 1016/1020 (99.61%), Postives = 1018/1020 (99.80%), Query Frame = 1
Query:   49 MTVIDGKNVNEIEXXXXXXXXXXXXXXXXXXXENKDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVREHT 3108
            MTVIDGKNVNEIEKPPIKDGKKTKNKGSKTPIENKDLDTD+H IPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNV RDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQ+RTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFVNIITVIGITLGVVFFIIALSLGYYWLDGILFLIGIIVAVIPVGLLATVTVMLTLTAKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVREHT
Sbjct:    1 MTVIDGKNVNEIEKPPIKDGKKTKNKGSKTPIENKDLDTDSHKIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVARDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQNRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFVNIITVIGITLGVVFFIIALSLGYYWLDGILFLIGIIVAVIPVGLLATVTVMLTLTAKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVREHT 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000032753.1 (SMESG000032753.1)

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 710/985 (72.08%), Postives = 836/985 (84.87%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVREH 3105
            +D+++D+H I IEELY R ++DP  GLT  EA  RLE DG N+L P +  PEIVKF+K L GGFS+LL  GAILC+IAY IQ     +   DNLYLG VL+ +V+FTGCFCYYQ+AKSS I+ SFGKMVPQK++V R   + +V T  LVVGD+VEVKFGDRIPAD+RIIK+S FKVDN+ALTGESEPQSRTPECT+ NILETSNIAFFSTNAVEGTCR +++  GDNT+MGRIA+LTS L  G+TPIG+EI HF++II+ IG++LG++FFIIA  LG +WLD +LFLIG+IVA +P G+LATVTVMLTLTAK+MARKNCLVKNLEAVETLGSTS+ICSDKTGTLTQNVMTVAHTWY+N+I++ P SE++I     +   +W +L+R+AILCNRA FKA +EDKVVWKRECSGDASESALLK GE + G +++YRE N K++E+PFNS NKYQVSIHET D DPRYLLVMKGAPERILE+  TILI   E EID+HWKDEFNNAYME+GGMGERVLGFCDYRLD   FPKGF FD DEVNFPL G RF GLISMIDPPRPSVPDAV KCRSAGIKVIMVTGDHPITAKAI++AVGI    +KTIED+A  + +PISEVNPR+A ACV+HGSDLKEMTS QLDEIL+YH EIVFARTSPQQKLQIV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIV GIEQGR IFDNLKK+++Y  +KTIPE+VPFL Y  +SIPL LG +TILCID+GTDM+P+I+LAYE +ESNIM+RKPR+P+K  LVT RLISLTH Q+GII+A G+ F +F+IMAE GFLPDRL+G+R  WE   INDLKDSY QEWTY QRK+LEYTCY+++F+++MVQQW N+LVVKTRRNS+FQ GMWN+ LTF+MFFET LA+F+VY PG++ +LK+  LRFTWWLIA+PF  YL  FDE +K+I+ + K   W  RE+
Sbjct:   32 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFIHIISGIGVSLGIIFFIIAFLLGSFWLDAVLFLIGVIVANVPEGMLATVTVMLTLTAKKMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTREN 1016          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000008152.1 (SMESG000008152.1)

HSP 1 Score: 1414.82 bits (3661), Expect = 0.000e+0
Identity = 689/984 (70.02%), Postives = 812/984 (82.52%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +DL+ D H I + +L+ERL SDPI GL+Q EA++R + +GPNALKPPK++PEIVKFLKELTGGFSLLL+AG+ILC+++Y+IQ   D +  +DNL LG  LLVIVLFTGCFCY+QEAKSS IIKSFG MVP K+NVIR+ E+SE+ TT LVVGD+VEVK+GDRIPAD+R++K+SSFKVDNSALTGESEPQ RT E TNENILETSN+AFFSTNAVEGTCRG++I+ GDNT+MGRIA LTS LK G+TPIG EIN+FVNIIT IGI+LGV+FFI++LS+GY+WLD  LFLIGII AVIPVGLL                                 ++  S K  +++ N                  SE+E+D        AW  LLR+A+LCNRAQFKADQEDK+VWKREC+GDASESALLKC EH      K+R  N K+ EIPFNS NKYQ+SIHET D D R LLVMKGAPE+ILE+C++I I   E EIDD+W++EF NAYM LGGMGERVLGF D RLD  ++PKG++F+ +EVNFPL G RF GLISMIDPPRPSVPDAV KCRSAG+KV+MVTGDHPITAKAIS+AVGII + SKT+ED+A E+N+ +S+VNPR+ANACVV+GS+LK+M+SEQLDEILKYH+EIVFARTSPQQKLQIV+G QRQG+IVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIVTGIEQGR+IFDNLKK+V+YNFIKTIPEL+P +LYI +SIPLPLG +TILCIDIGTDMLP+ISLAYE +ESNIM+RKPRDP+ GKLVT +LISLTH QMGIIEA G MFVYF+IMAE GF+P RLIG+R QWE+ T NDL DSY QEWTY QRK LEYTCYT+FF+AI+VQQW+NLL+VKTRRNSIFQSGMWNNHLTFA+FFET LALF+VYCPGMD++LK QPL+F+WW IA+PFGVY+F+ DE KK+I+      +W  RE
Sbjct:   32 QDLEIDLHKISLTDLFERLNSDPIKGLSQEEAKIRYDKNGPNALKPPKDVPEIVKFLKELTGGFSLLLLAGSILCFVSYIIQAETDPSAPKDNLCLGLALLVIVLFTGCFCYFQEAKSSKIIKSFGNMVPDKANVIRDGELSEILTTFLVVGDIVEVKYGDRIPADLRLLKSSSFKVDNSALTGESEPQIRTVEFTNENILETSNVAFFSTNAVEGTCRGVVINTGDNTIMGRIALLTSSLKMGKTPIGNEINNFVNIITGIGISLGVIFFIVSLSIGYFWLDCFLFLIGIICAVIPVGLL--------------------------------ATLTVSLKIQSISLNTK----------------SENEVD------NIAWSNLLRVAMLCNRAQFKADQEDKIVWKRECTGDASESALLKCAEHENQGVMKFRTENPKVFEIPFNSTNKYQISIHETTDQDERLLLVMKGAPEQILERCSSIFIDGKEIEIDDYWRNEFTNAYMSLGGMGERVLGFSDCRLDLEKYPKGYEFNGEEVNFPLNGFRFVGLISMIDPPRPSVPDAVSKCRSAGVKVVMVTGDHPITAKAISKAVGIISETSKTLEDIALERNVNLSQVNPREANACVVNGSELKKMSSEQLDEILKYHDEIVFARTSPQQKLQIVEGFQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGIEQGRIIFDNLKKSVIYNFIKTIPELIPVMLYIVLSIPLPLGTITILCIDIGTDMLPAISLAYEEAESNIMRRKPRDPISGKLVTNKLISLTHGQMGIIEAVGGMFVYFVIMAENGFMPGRLIGIRPQWESTTNNDLMDSYGQEWTYHQRKNLEYTCYTAFFVAIVVQQWFNLLIVKTRRNSIFQSGMWNNHLTFALFFETTLALFIVYCPGMDIVLKTQPLKFSWWFIALPFGVYIFLCDELKKFILRHQNSKSWFSRE 961          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000041937.1 (SMESG000041937.1)

HSP 1 Score: 1412.51 bits (3655), Expect = 0.000e+0
Identity = 674/983 (68.57%), Postives = 820/983 (83.42%), Query Frame = 1
Query:  154 DLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            +LD D+H I I++LY RL++DP  GL+  EA++RL  DGPNAL PPK  PE VKF ++L GGFSLLL  GA LC++AY I      +  +DNLYLG VL  +V+ TGCF YYQEAKSS I++SFGKMVPQK+NVIR+ +I E+   NLV GD+++VKFGDR+PADIR+I+ASSFKVDNSALTGESE Q R+ E TN+N LET NIAFFSTNAVEGTC+G++IS GDNT+MGRIA+L SGL+ G TPI +EINHF++IIT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   SE++I     ++   W++L R+A+LCNRAQFK+ +E+K V KREC+GDASESALLKC E S+G  +KYR  NKKIVEIPFNS NKYQVSIHET+D +  YLL MKGAPERILE+C+TILI   E E+DDHW+ EFNNAY+ELGGMGERVLGFCDYRLD   FP+GF F+ DEVNFPL GLRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G+KT++D+A E+ I  SEVNPRDA ACV+HGSDL++M+SEQLDE+LK+H+EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKRKPRDP   KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAEQGF P RL+GLR +W++  +NDL DSY QEWT+ QRKKLEYTC+T+FF++I++ QW +L++ KTRRNSIFQ GMWN+ +TF +FFET LA FL YCPG+D+ LKMQPLRFTWWL A+PF   +FI+DE +K+++ K K  +W+  E
Sbjct:   37 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000078146.1 (SMESG000078146.1)

HSP 1 Score: 1153.27 bits (2982), Expect = 0.000e+0
Identity = 577/992 (58.17%), Postives = 751/992 (75.71%), Query Frame = 1
Query:  151 KDLDTDAHNIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQ-------YIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFXXXXXXXXXXXXXXFFIIALSLGYYWLDGILFLIGIIVAVIPVGXXXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDK-VVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 3102
            ++LD + H IPI++LY +L +DP  G+T+ EA +RL+  G N L P    P  + + K L GGF+LLL  G+ILC+IA+ I+       Y+P       NL++G VL+VIV+ +  F +YQE KS+ I++SF ++VP K+ VIR     E+   NLVVGDV+ VK GDRIPADIRII A+SFKVDNS+LTGESE Q R+ E TNEN LET N+AFFSTNAVEG CRG++I+ GD+T+MGRIA+L SGL+ G TPI +EIN F+ IIT+I + L V+F I A  LGYYW+D I+FLI II+A +P GLLATVTV LTLTAKRMA+KNCLVK+LEA+ETLGST VIC DKTGTLT N MTV+H ++ + ++E  ++ +E++ +    +  W++L R  +LCN + F   +ED+ ++  R C+GD+SESALLK  E S GN  K+RE NKK+ E+PFNS+NKYQ S+HET D +   LLV+KGAPE++LE C+T+LI E E++I D W+  F   Y +LG +GERV+GF D RL    FP GF F+ +E N    G+RF G+ISM+DPPR +VPDAVEKCRSAGIKVIMVTGDHPITAKA+++ VGII +G+KT+EDLA E+ I + +V+P+DA ACV+HG+DLK+M+ E LDE++ +HNEIVFART+PQQKL IV+ CQR G +VAVTGDGVNDSPALKKADIGIAMG+SGSDVSKQ+ADMILLDDNFA+IV GIE+GR+IFDNLKK++ Y     IPE+ PFLL+I + +PLPLG +T+L ID+GTDM P+ISLAYE +ES+IM+R PRDP   KLVT  L+S+ + Q+GI+EA    F YFI+MAE GF P RL+GLR +W++  IND+ DSY QEW + QRK+LE+TC T+FF+AI+  QW NLL+ KTRR S+F  GMWN++LT AMF    LAL   Y PG+D  L   PLRFTWWL A+P+ + + ++DE +KYI+ + K N+W+ RE
Sbjct:   41 QELDLEDHRIPIDDLYYKLDTDPDNGITEEEANIRLKEYGQNLLTPVSSTPTSIIYCKNLFGGFNLLLWIGSILCFIAFGIEAGSYAYTYLP-----MRNLWMGIVLIVIVVLSATFSFYQEIKSNKIMESFVRLVPHKATVIRNGRTKEILAENLVVGDVITVKCGDRIPADIRIISATSFKVDNSSLTGESEAQVRSTEYTNENSLETKNLAFFSTNAVEGVCRGVVINTGDSTVMGRIANLASGLEIGMTPIAKEINFFIYIITIISVILAVIFIIAAFLLGYYWIDAIIFLIAIIIASVPEGLLATVTVCLTLTAKRMAKKNCLVKHLEAIETLGSTKVICCDKTGTLTMNKMTVSHVFFDDIVYEVDMNNNELEGEIDVTKTGWKMLARGCMLCNHSNFIQSEEDEALILNRLCTGDSSESALLKFMEISYGNVEKFREENKKVYEMPFNSINKYQFSVHETNDGNESLLLVLKGAPEKVLEYCSTVLIDEEEHKITDEWRKLFYKNYDDLGILGERVIGFADTRLSEKIFPHGFDFNEEEHNVLNGGMRFLGMISMVDPPRSTVPDAVEKCRSAGIKVIMVTGDHPITAKAVAKLVGIIDEGNKTVEDLAKERGITVHDVDPKDARACVIHGNDLKDMSPETLDEVINHHNEIVFARTTPQQKLLIVESCQRLGDVVAVTGDGVNDSPALKKADIGIAMGLSGSDVSKQSADMILLDDNFATIVIGIEEGRLIFDNLKKSIAYTLTSNIPEVTPFLLFIILGLPLPLGTITVLLIDLGTDMFPAISLAYEEAESDIMQRSPRDPKTDKLVTHSLLSMAYGQIGIMEAVAGFFAYFIVMAENGFWPQRLVGLRQEWDSPAINDVIDSYGQEWGFRQRKQLEHTCQTAFFVAIVTTQWANLLICKTRRISLFTQGMWNHYLTGAMFISATLALIFTYVPGLDTALHTAPLRFTWWLPALPYFLIILVYDEIRKYIIRRMKPNSWLERE 1027          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1A20.000e+063.41ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
ATP1A30.000e+062.54ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+062.54ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+062.54ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
AC010616.10.000e+062.91novel protein, ATP1A3-RABAC1 readthrough[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-60.000e+062.60Sodium/potassium-transporting ATPase subunit alpha... [more]
eat-60.000e+062.60Sodium/potassium-transporting ATPase subunit alpha... [more]
catp-40.000e+046.94Sodium/potassium-transporting ATPase subunit alpha... [more]
catp-30.000e+036.22Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-24.616e-17735.01Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atpalpha0.000e+063.76gene:FBgn0002921 transcript:FBtr0089516[more]
Atpalpha0.000e+063.76gene:FBgn0002921 transcript:FBtr0089514[more]
Atpalpha0.000e+063.65gene:FBgn0002921 transcript:FBtr0089510[more]
Atpalpha0.000e+063.65gene:FBgn0002921 transcript:FBtr0089515[more]
Atpalpha0.000e+063.65gene:FBgn0002921 transcript:FBtr0089511[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3b0.000e+062.13ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
atp1a3b0.000e+062.13ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
atp1a2a0.000e+063.01ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
atp1a2a0.000e+063.01ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
atp1a2a0.000e+063.01ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk20.000e+062.91cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-G... [more]
naif10.000e+062.00nuclear apoptosis inducing factor 1 [Source:Xenbas... [more]
rab8b0.000e+062.23RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
rab8b0.000e+062.60RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
cdk20.000e+062.22cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1a30.000e+062.64ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a30.000e+062.64ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a30.000e+063.01ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a20.000e+063.01ATPase, Na+/K+ transporting, alpha 2 polypeptide [... [more]
Atp1a10.000e+062.34ATPase, Na+/K+ transporting, alpha 1 polypeptide [... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6RWA9|AT1A_TAESO0.000e+064.97Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P13607|ATNA_DROME0.000e+063.65Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P28774|AT1B_ARTSF0.000e+063.59Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P50993|AT1A2_HUMAN0.000e+063.41Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|D2WKD8|AT1A2_PIG0.000e+063.01Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
O761540.000e+070.19Sodium/potassium-transporting ATPase subunit alpha... [more]
M4LUP70.000e+068.57Sodium/potassium-transporting ATPase subunit alpha... [more]
A0A068WQ070.000e+066.16Sodium/potassium-transporting ATPase subunit alpha... [more]
A0A068Y2K70.000e+066.26Sodium/potassium-transporting ATPase subunit alpha... [more]
W6UUP90.000e+066.16Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3b0.000e+061.73ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
atp1a3a0.000e+062.13sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3b0.000e+061.87ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
atp1a3a0.000e+063.13sodium/potassium-transporting ATPase subunit alpha... [more]
ENSAMXT00000037921.10.000e+062.64sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002888.10.000e+063.15pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.10.000e+066.10pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
ENSPMAT00000009058.18.666e-14859.86pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene... [more]
ENSPMAT00000001612.13.462e-8247.24pep scaffold:Pmarinus_7.0:GL478157:83838:93675:1 g... [more]
ENSPMAT00000010373.12.718e-7428.52pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR12.081e-11830.47High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA22.009e-8128.43P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA52.411e-8128.43Protein with similarity to P-type ATPase sodium pu... [more]
ENA12.434e-8128.43P-type ATPase sodium pump; involved in Na+ and Li+... [more]
PMA18.197e-5526.49Plasma membrane P2-type H+-ATPase; pumps protons o... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406800.000e+060.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364550.000e+059.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356162.709e-10428.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474652.895e-9927.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417751.793e-5029.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046641.10.000e+062.54sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3a0.000e+062.34sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3a0.000e+062.45sodium/potassium-transporting ATPase subunit alpha... [more]
ENSORLT00000016540.20.000e+062.39sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a1b0.000e+062.47sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008146.10.000e+099.61SMESG000008146.1[more]
SMESG000032753.10.000e+072.08SMESG000032753.1[more]
SMESG000008152.10.000e+070.02SMESG000008152.1[more]
SMESG000041937.10.000e+068.57SMESG000041937.1[more]
SMESG000078146.10.000e+058.17SMESG000078146.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010071 ID=SMED30010071|Name=Sodium/potassium-transporting ATPase subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=3187bp
GTTTTATTTTCAATTTAGATTTTTTTTGCTTGATCATTAAAACGATAAAT
GACTGTGATAGATGGGAAAAATGTTAATGAAATAGAGAAGCCACCGATTA
AGGATGGTAAGAAAACTAAAAATAAAGGTAGTAAGACACCGATAGAAAAT
AAAGATTTGGACACTGATGCTCACAATATTCCAATTGAAGAATTATATGA
AAGATTGAAATCAGATCCGATCACCGGATTGACCCAAAACGAAGCCAGAC
TTCGATTAGAAACAGATGGTCCGAATGCTCTTAAACCGCCGAAAGAATTA
CCGGAAATAGTAAAATTTCTCAAAGAACTTACCGGAGGATTTTCATTGTT
ATTAATTGCCGGTGCTATATTGTGCTGGATAGCATATTTAATACAATACA
TACCAGATAATAATGTCACCAGAGACAATCTATATTTGGGATTTGTATTA
TTGGTCATCGTATTGTTCACGGGTTGTTTTTGCTATTACCAGGAAGCCAA
ATCATCTGCAATTATTAAGTCTTTCGGCAAAATGGTTCCCCAGAAATCGA
ATGTCATAAGAGAGAGCGAAATATCCGAGGTCGACACAACCAATTTGGTC
GTGGGTGACGTTGTTGAAGTGAAATTCGGTGATCGAATTCCGGCGGATAT
TCGGATCATAAAAGCCAGCTCTTTTAAGGTCGATAATTCGGCATTAACTG
GAGAATCAGAACCCCAGAGCAGAACACCGGAATGCACCAACGAAAACATT
TTAGAAACGTCTAATATTGCATTTTTTTCAACGAATGCAGTTGAGGGTAC
TTGCAGAGGAATCATTATCAGTGTAGGGGATAATACTATGATGGGTCGGA
TTGCGCACCTCACTAGTGGCTTGAAGCAGGGTAGAACACCGATAGGGAGA
GAAATTAATCATTTTGTTAATATAATTACTGTGATTGGAATTACACTTGG
TGTGGTATTTTTCATAATTGCGCTTTCACTAGGGTATTATTGGCTGGATG
GGATTTTATTTTTAATTGGTATTATTGTCGCTGTTATTCCGGTTGGGTTG
CTGGCCACGGTAACGGTCATGTTAACGTTAACAGCCAAACGAATGGCTAG
AAAAAATTGTCTTGTGAAAAACCTTGAAGCCGTGGAGACTCTTGGATCGA
CAAGCGTTATTTGTTCAGATAAAACTGGTACATTGACTCAAAACGTGATG
ACAGTCGCCCATACTTGGTATAGCAATAGAATTCACGAATACCCTTTATC
AGAATCAGAAATTGATGAAGATCAAGCAGAGGATAGGGCTGCATGGCAAG
TTTTACTAAGAATTGCCATACTATGCAATAGAGCTCAATTCAAAGCCGAC
CAAGAAGATAAAGTTGTTTGGAAAAGAGAATGTTCTGGAGATGCGTCCGA
ATCAGCTCTTTTAAAGTGTGGAGAACACTCAATGGGAAATTCGTCCAAAT
ACCGAGAAAATAACAAGAAAATTGTGGAAATACCCTTTAACTCCTTGAAC
AAATATCAGGTCTCTATTCATGAAACAGCAGACGACGATCCAAGATATTT
ACTCGTAATGAAAGGCGCTCCAGAAAGAATATTGGAAAAATGTGCAACGA
TTCTAATAGGAGAGACTGAATATGAAATCGACGATCATTGGAAAGACGAA
TTTAATAATGCGTATATGGAACTTGGAGGAATGGGTGAAAGAGTTTTGGG
ATTCTGTGATTATCGATTAGATGCAACGGAATTTCCCAAAGGATTTCAAT
TTGATACAGATGAAGTCAACTTCCCTTTGAAAGGGTTAAGATTCGCAGGA
TTGATATCTATGATTGACCCTCCTCGACCATCGGTACCAGATGCCGTTGA
AAAATGTCGATCAGCTGGCATCAAAGTAATAATGGTAACGGGAGACCATC
CAATCACGGCAAAAGCTATTTCTAGAGCGGTTGGTATTATAAGAAAAGGT
AGTAAAACAATTGAAGATCTGGCTCATGAAAAGAATATACCGATCTCTGA
AGTCAATCCGAGAGACGCAAATGCTTGTGTCGTCCATGGATCAGATTTAA
AAGAAATGACTTCTGAACAATTGGATGAAATATTAAAATATCACAATGAA
ATTGTATTTGCAAGAACAAGTCCACAACAAAAATTGCAGATTGTCGACGG
GTGCCAACGACAAGGATCTATTGTGGCTGTCACTGGCGATGGTGTAAACG
ACAGTCCAGCACTCAAAAAAGCAGACATTGGTATTGCTATGGGGATTTCG
GGAAGTGATGTAAGCAAACAAGCTGCTGATATGATTTTATTGGATGACAA
CTTTGCTTCAATCGTCACCGGAATTGAGCAAGGCCGAATGATTTTCGACA
ACCTCAAAAAAGCTGTTATGTATAATTTTATCAAAACTATACCCGAGTTA
GTTCCATTTCTCCTATACATCGCTGTGTCGATCCCCTTACCACTTGGAGC
AATGACAATTCTCTGCATTGATATAGGAACGGACATGTTGCCATCAATTT
CGCTTGCTTATGAATTTTCGGAATCAAATATTATGAAAAGAAAGCCTCGT
GATCCAGTAAAAGGGAAACTTGTGACAGAACGGTTAATATCGCTTACTCA
TGCCCAAATGGGAATTATAGAAGCAACAGGAGCCATGTTTGTATATTTTA
TAATAATGGCCGAACAAGGCTTTTTGCCAGATAGATTAATCGGTTTGAGA
ATTCAGTGGGAAACCCAAACTATAAATGATTTAAAGGACTCATACAATCA
AGAATGGACATATGCTCAGAGAAAAAAATTAGAATATACTTGTTACACTT
CCTTTTTCATTGCCATTATGGTACAACAATGGTGGAACTTGTTGGTCGTC
AAGACTAGAAGGAACTCGATCTTTCAATCAGGAATGTGGAATAATCACCT
GACTTTTGCCATGTTCTTCGAAACTTGTCTTGCTCTATTTTTGGTTTATT
GTCCCGGGATGGACCTCATTTTAAAAATGCAACCTTTAAGATTTACCTGG
TGGCTCATTGCTATGCCTTTTGGAGTTTATTTATTCATTTTTGATGAATT
TAAGAAGTATATCGTTAGCAAATCTAAGAAAAATACATGGATTGTGAGAG
AACATACCTAATTTTTTCATTTCTTAATGTGAATAATTTTTGTAAGAATT
ATTTTAAGTATTGTGATAAATAAATTTAATTTTTCGG
back to top

protein sequence of SMED30010071-orf-1

>SMED30010071-orf-1 ID=SMED30010071-orf-1|Name=SMED30010071-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1021bp
MTVIDGKNVNEIEKPPIKDGKKTKNKGSKTPIENKDLDTDAHNIPIEELY
ERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSL
LLIAGAILCWIAYLIQYIPDNNVTRDNLYLGFVLLVIVLFTGCFCYYQEA
KSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPAD
IRIIKASSFKVDNSALTGESEPQSRTPECTNENILETSNIAFFSTNAVEG
TCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFVNIITVIGITL
GVVFFIIALSLGYYWLDGILFLIGIIVAVIPVGLLATVTVMLTLTAKRMA
RKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPL
SESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDAS
ESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRY
LLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVL
GFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAV
EKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPIS
EVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVD
GCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDD
NFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLG
AMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLT
HAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYN
QEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNH
LTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDE
FKKYIVSKSKKNTWIVREHT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008556potassium-transporting ATPase activity
GO:0000166nucleotide binding
GO:0046872metal ion binding
GO:0005391sodium:potassium-exchanging ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0006814sodium ion transport
GO:0010248establishment or maintenance of transmembrane electrochemical gradient
GO:0090662ATP hydrolysis coupled transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005775P-type_ATPase_IIC
IPR001757P_typ_ATPase
IPR036412HAD-like_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR018303ATPase_P-typ_P_site
IPR023214HAD_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR023299ATPase_P-typ_cyto_dom_N
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00121NAKATPASEcoord: 101..115
score: 61.71
coord: 913..933
score: 49.28
coord: 365..386
score: 91.75
coord: 784..805
score: 61.84
coord: 128..148
score: 63.79
coord: 292..314
score: 48.23
coord: 851..871
score: 45.07
coord: 947..971
score: 53.86
coord: 502..520
score: 78.58
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 736..748
score: 54.06
coord: 372..386
score: 78.62
coord: 712..731
score: 84.33
coord: 212..226
score: 55.48
coord: 584..595
score: 53.07
coord: 606..616
score: 73.19
NoneNo IPR availablePFAMPF00702Hydrolasecoord: 678..726
e-value: 6.5E-7
score: 29.8
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 40..274
e-value: 0.0
score: 1425.1
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 424..518
e-value: 4.0E-22
score: 78.1
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 161..352
e-value: 2.9E-46
score: 157.3
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 92..1011
e-value: 0.0
score: 1425.1
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 353..764
e-value: 0.0
score: 262.8
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 353..764
e-value: 0.0
score: 262.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..39
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..39
NoneNo IPR availablePANTHERPTHR43294FAMILY NOT NAMEDcoord: 21..1017
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 945..967
NoneNo IPR availableTMHMMTMhelixcoord: 982..1001
NoneNo IPR availableTMHMMTMhelixcoord: 784..806
NoneNo IPR availableTMHMMTMhelixcoord: 847..869
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 128..147
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 40..114
e-value: 1.3E-18
score: 77.8
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 42..109
e-value: 4.9E-18
score: 64.6
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 796..1005
e-value: 7.5E-39
score: 133.3
IPR005775P-type ATPase subfamily IIC, subunit alphaTIGRFAMTIGR01106TIGR01106coord: 34..1018
e-value: 0.0
score: 1608.5
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 382..591
e-value: 0.0
score: 1425.1
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 381..592
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 369..752
e-value: 0.0
score: 1425.1
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 134..394
e-value: 2.8E-42
score: 142.7
coord: 686..804
e-value: 2.9E-32
score: 109.7
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 374..380
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 370..816
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 164..271
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 39..1008