Formin-like protein 15

Overview
NameFormin-like protein 15
Smed IDSMED30010068
Length (bp)4961
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Formin-like protein 15 (SMED30010068) t-SNE clustered cells

Violin plots show distribution of expression levels for Formin-like protein 15 (SMED30010068) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Formin-like protein 15 (SMED30010068) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Formin-like protein 15 (SMED30010068) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010068

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010068SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010068SMESG000035694.1 SMESG000035692.1 Contig14096uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010068SMESG000035694.1 SMESG000035692.1 Contig14096newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 285.804 bits (730), Expect = 2.530e-77
Identity = 153/300 (51.00%), Postives = 213/300 (71.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFYDV D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 201.445 bits (511), Expect = 6.544e-56
Identity = 112/232 (48.28%), Postives = 163/232 (70.26%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            +++ VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +
Sbjct: 1148 QEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHE 1378          

HSP 3 Score: 39.2762 bits (90), Expect = 6.544e-56
Identity = 25/85 (29.41%), Postives = 37/85 (43.53%), Query Frame = 2
Query: 3791 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct: 1056 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKK 1140          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 285.034 bits (728), Expect = 2.533e-77
Identity = 153/300 (51.00%), Postives = 213/300 (71.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFYDV D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 204.142 bits (518), Expect = 7.228e-57
Identity = 112/226 (49.56%), Postives = 159/226 (70.35%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K
Sbjct:  977 VLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAK 1201          

HSP 3 Score: 39.6614 bits (91), Expect = 7.228e-57
Identity = 25/85 (29.41%), Postives = 37/85 (43.53%), Query Frame = 2
Query: 3791 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct:  881 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKK 965          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 284.648 bits (727), Expect = 3.203e-77
Identity = 153/300 (51.00%), Postives = 213/300 (71.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFYDV D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 204.527 bits (519), Expect = 6.709e-57
Identity = 112/226 (49.56%), Postives = 159/226 (70.35%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K
Sbjct:  960 VLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAK 1184          

HSP 3 Score: 39.6614 bits (91), Expect = 6.709e-57
Identity = 25/85 (29.41%), Postives = 37/85 (43.53%), Query Frame = 2
Query: 3791 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct:  864 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKK 948          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD1 (formin homology 2 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:17905])

HSP 1 Score: 258.455 bits (659), Expect = 1.709e-69
Identity = 139/284 (48.94%), Postives = 198/284 (69.72%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
            KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+ +++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  S+TI+WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME++ +  L  +  DVD+  Q  +YE AL++EDG+
Sbjct:   67 KLEDCALQV-------SPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGD 340          

HSP 2 Score: 189.889 bits (481), Expect = 6.056e-48
Identity = 105/244 (43.03%), Postives = 158/244 (64.75%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD + +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLL+H+ SLV+   P+++DL+SE+ AL RC +VD+E+L   L +LE+    +   L+ + K + +     +   F   C
Sbjct:  694 VLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLGQLERRSRAAEESLRSLAKHELAPALRARLTHFLDQC 936          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 204.527 bits (519), Expect = 5.068e-57
Identity = 112/226 (49.56%), Postives = 159/226 (70.35%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K
Sbjct:  738 VLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAK 962          

HSP 2 Score: 40.0466 bits (92), Expect = 5.068e-57
Identity = 25/85 (29.41%), Postives = 37/85 (43.53%), Query Frame = 2
Query: 3791 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct:  642 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKK 726          

HSP 3 Score: 112.079 bits (279), Expect = 6.503e-24
Identity = 56/131 (42.75%), Postives = 83/131 (63.36%), Query Frame = 2
Query: 2288 FIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            F+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFYDV D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:   16 FVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 143          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 229.18 bits (583), Expect = 2.393e-60
Identity = 124/258 (48.06%), Postives = 180/258 (69.77%), Query Frame = 2
Query: 1856 FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 2626
            +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+YD  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:   82 YLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 334          

HSP 2 Score: 183.341 bits (464), Expect = 3.598e-46
Identity = 105/240 (43.75%), Postives = 152/240 (63.33%), Query Frame = 1
Query: 4024 LHEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            + E   + L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S
Sbjct:  883 VAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNS 1122          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 228.024 bits (580), Expect = 3.337e-60
Identity = 124/258 (48.06%), Postives = 180/258 (69.77%), Query Frame = 2
Query: 1856 FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 2626
            +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+YD  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:   82 YLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 334          

HSP 2 Score: 183.341 bits (464), Expect = 2.487e-46
Identity = 105/240 (43.75%), Postives = 152/240 (63.33%), Query Frame = 1
Query: 4024 LHEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            + E   + L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S
Sbjct:  725 VAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNS 964          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 224.942 bits (572), Expect = 7.889e-59
Identity = 123/260 (47.31%), Postives = 175/260 (67.31%), Query Frame = 2
Query: 1880 QEQIEDL--------DGYIESG---NCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 2626
            Q+ +ED         D Y+ SG    C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L    ++ +I    +  G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+YD  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:  415 QDSVEDFHEDPFDWGDEYLNSGAKRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALL---VLTAIQTVDKSKGQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 669          

HSP 2 Score: 183.726 bits (465), Expect = 3.245e-46
Identity = 104/232 (44.83%), Postives = 149/232 (64.22%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S
Sbjct: 1226 LSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNS 1457          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 224.172 bits (570), Expect = 1.136e-58
Identity = 123/260 (47.31%), Postives = 175/260 (67.31%), Query Frame = 2
Query: 1880 QEQIEDL--------DGYIESG---NCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 2626
            Q+ +ED         D Y+ SG    C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L    ++ +I    +  G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+YD  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:  415 QDSVEDFHEDPFDWGDEYLNSGAKRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALL---VLTAIQTVDKSKGQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 669          

HSP 2 Score: 184.111 bits (466), Expect = 2.220e-46
Identity = 104/232 (44.83%), Postives = 149/232 (64.22%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S
Sbjct: 1068 LSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNS 1299          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 218.009 bits (554), Expect = 6.477e-57
Identity = 124/275 (45.09%), Postives = 180/275 (65.45%), Query Frame = 2
Query: 1856 FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGK-----------------FRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 2626
            +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL                    FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+YD  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:   82 YLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPLYIDEERKEMSPFRLEWFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 351          

HSP 2 Score: 183.341 bits (464), Expect = 3.547e-46
Identity = 105/240 (43.75%), Postives = 152/240 (63.33%), Query Frame = 1
Query: 4024 LHEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            + E   + L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S
Sbjct:  900 VAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNS 1139          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0302086)

HSP 1 Score: 247.669 bits (631), Expect = 3.805e-66
Identity = 142/326 (43.56%), Postives = 221/326 (67.79%), Query Frame = 2
Query: 1790 EKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 2767
            + +++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FYD +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:   62 QSIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 366          

HSP 2 Score: 191.43 bits (485), Expect = 3.148e-53
Identity = 111/232 (47.84%), Postives = 155/232 (66.81%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D
Sbjct:  951 KEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHD 1181          

HSP 3 Score: 39.6614 bits (91), Expect = 3.148e-53
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF 4018
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D 
Sbjct:  883 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDL 939          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0333889)

HSP 1 Score: 249.595 bits (636), Expect = 4.079e-66
Identity = 142/325 (43.69%), Postives = 221/325 (68.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 2767
            ++++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FYD +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct: 1198 RIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 1501          

HSP 2 Score: 190.66 bits (483), Expect = 9.739e-53
Identity = 111/232 (47.84%), Postives = 155/232 (66.81%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D
Sbjct: 2086 KEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLLN-MLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHD 2316          

HSP 3 Score: 38.5058 bits (88), Expect = 9.739e-53
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF 4018
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D 
Sbjct: 2018 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDL 2074          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0333888)

HSP 1 Score: 249.595 bits (636), Expect = 4.079e-66
Identity = 142/325 (43.69%), Postives = 221/325 (68.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 2767
            ++++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FYD +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct: 1198 RIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 1501          

HSP 2 Score: 190.66 bits (483), Expect = 9.739e-53
Identity = 111/232 (47.84%), Postives = 155/232 (66.81%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D
Sbjct: 2086 KEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLLN-MLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHD 2316          

HSP 3 Score: 38.5058 bits (88), Expect = 9.739e-53
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF 4018
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D 
Sbjct: 2018 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDL 2074          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0302584)

HSP 1 Score: 248.054 bits (632), Expect = 4.230e-66
Identity = 142/326 (43.56%), Postives = 221/326 (67.79%), Query Frame = 2
Query: 1790 EKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 2767
            + +++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FYD +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:   62 QSIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 366          

HSP 2 Score: 191.43 bits (485), Expect = 2.872e-53
Identity = 111/232 (47.84%), Postives = 155/232 (66.81%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D
Sbjct:  951 KEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHD 1181          

HSP 3 Score: 39.2762 bits (90), Expect = 2.872e-53
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF 4018
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D 
Sbjct:  883 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDL 939          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0302085)

HSP 1 Score: 248.054 bits (632), Expect = 5.203e-66
Identity = 142/326 (43.56%), Postives = 221/326 (67.79%), Query Frame = 2
Query: 1790 EKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 2767
            + +++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FYD +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:   62 QSIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 366          

HSP 2 Score: 191.43 bits (485), Expect = 3.225e-53
Identity = 111/232 (47.84%), Postives = 155/232 (66.81%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D
Sbjct:  951 KEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHD 1181          

HSP 3 Score: 39.2762 bits (90), Expect = 3.225e-53
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF 4018
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D 
Sbjct:  883 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDL 939          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 272.707 bits (696), Expect = 1.168e-81
Identity = 143/275 (52.00%), Postives = 202/275 (73.45%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYE 2605
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ E G  G    ++LRT+LS+RV A I+K+ N+ G+ELRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNG++  +ET++WLY+L+  KFRLVVK A+KLL+VF+EY    E +A  +I ++N    K G KPWS  ++IL + +  D+EL+ YA+T INK L+ +PDQD+FYDV D LEEQ ME++ +  +++   D+D+++QF IYE
Sbjct:   55 KLDDCALQL-------SHNGSYLDLESTLAEQKDELEGFQEDGGRGKKHSIVLRTQLSVRVHACIEKLYNSTGRELRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGLIGHNETVQWLYTLVGSKFRLVVKTAMKLLLVFVEYT---ESNAPLLIQAVNSVDTKQGSKPWSNAMEILDEKDGMDTELLVYAMTLINKTLAGLPDQDSFYDVVDSLEEQNMEAVAQRHISRKGTDLDLVEQFNIYE 319          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 277.715 bits (709), Expect = 1.445e-75
Identity = 146/281 (51.96%), Postives = 205/281 (72.95%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEK 2635
            KL++  LQL       +  G +LD + T+ EQ ++L+G+       VILRT+LS+RV A I+K+ N+NG++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +E+I+WLY L+  KFRLVVK +LKLL+VF+EY+   E +A+ +I +I+    K G K WS  ++IL + +  D+EL+ Y +T INK L+ +PDQD+FYD+ D LEEQ MES+++  L +   D+D+++Q  IYE  LR EDG++
Sbjct:   55 KLDDCALQL-------SHNGVYLDLESTLDEQRDELEGFQRGKKHSVILRTQLSVRVHACIEKLYNSNGRDLRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVIGHNESIQWLYQLIGSKFRLVVKTSLKLLLVFVEYS---ESNAALLIQAIDTVDNKRGCKSWSNAMEILAEKDGVDTELLVYVMTLINKTLAALPDQDSFYDMVDVLEEQGMESVSQRYLGRKGTDLDLLEQLNIYEATLRHEDGDE 325          

HSP 2 Score: 201.83 bits (512), Expect = 6.252e-55
Identity = 112/226 (49.56%), Postives = 154/226 (68.14%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSN+INIG+  L     +K AI+N     +N+EG+EK+L TM+PT EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G+ ++  ++TL Y+LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S V+     TTDL+SE+ A+ R  +VD+E+L   L  +E+    SW+HLK+I K
Sbjct:  824 VLDSKRSNSINIGLTVLPPPRTIKTAIVNFDEYALNKEGIEKIL-TMIPTAEETQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMDQLEKNKTLRYILSTLLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHVCSAVLENCSDTTDLYSEIGAITRSAKVDFEQLQENLTLMERRCKASWDHLKVIAK 1048          

HSP 3 Score: 35.039 bits (79), Expect = 6.252e-55
Identity = 18/62 (29.03%), Postives = 31/62 (50.00%), Query Frame = 2
Query: 3860 FNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            F K+K+T RL W    P      ++     ++WS+++ V  D  + E LFE+K  +  +  K
Sbjct:  751 FQKKKKTIRLFWSEVQPADWIYRNHKRSQESLWSRLEPVKIDTAKLEHLFESKSKEMPVAKK 812          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 275.018 bits (702), Expect = 9.334e-75
Identity = 147/287 (51.22%), Postives = 207/287 (72.13%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG------VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEK 2635
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G      VILRT+LS+RV A I+K+ N+NG++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +E+I+WLY L+  KFRLVVK +LKLL+VF+EY+   E +A+ +I +I+    K G K WS  ++IL + +  D+EL+ Y +T INK L+ +PDQD+FYD+ D LEEQ MES+++  L +   D+D+++Q  IYE  LR EDG++
Sbjct:   55 KLDDCALQL-------SHNGVYLDLESTLDEQRDELEGFQQDDCAGRGKKHSVILRTQLSVRVHACIEKLYNSNGRDLRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVIGHNESIQWLYQLIGSKFRLVVKTSLKLLLVFVEYS---ESNAALLIQAIDTVDNKRGCKSWSNAMEILAEKDGVDTELLVYVMTLINKTLAALPDQDSFYDMVDVLEEQGMESVSQRYLGRKGTDLDLLEQLNIYEATLRHEDGDE 331          

HSP 2 Score: 201.445 bits (511), Expect = 7.080e-55
Identity = 112/226 (49.56%), Postives = 154/226 (68.14%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSN+INIG+  L     +K AI+N     +N+EG+EK+L TM+PT EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G+ ++  ++TL Y+LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S V+     TTDL+SE+ A+ R  +VD+E+L   L  +E+    SW+HLK+I K
Sbjct:  819 VLDSKRSNSINIGLTVLPPPRTIKTAIVNFDEYALNKEGIEKIL-TMIPTAEETQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMDQLEKNKTLRYILSTLLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHVCSAVLENCSDTTDLYSEIGAITRSAKVDFEQLQENLTLMERRCKASWDHLKVIAK 1043          

HSP 3 Score: 35.039 bits (79), Expect = 7.080e-55
Identity = 18/62 (29.03%), Postives = 31/62 (50.00%), Query Frame = 2
Query: 3860 FNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            F K+K+T RL W    P      ++     ++WS+++ V  D  + E LFE+K  +  +  K
Sbjct:  746 FQKKKKTIRLFWSEVQPADWIYRNHKRSQESLWSRLEPVKIDTAKLEHLFESKSKEMPVAKK 807          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 264.233 bits (674), Expect = 5.895e-71
Identity = 144/287 (50.17%), Postives = 203/287 (70.73%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG------VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEK 2635
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G      VILRT+LS+R      K+ N+NG++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +E+I+WLY L+  KFRLVVK +LKLL+VF+EY+   E +A+ +I +I+    K G K WS  ++IL + +  D+EL+ Y +T INK L+ +PDQD+FYD+ D LEEQ MES+++  L +   D+D+++Q  IYE  LR EDG++
Sbjct:   55 KLDDCALQL-------SHNGVYLDLESTLDEQRDELEGFQQDDCAGRGKKHSVILRTQLSVR------KLYNSNGRDLRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVIGHNESIQWLYQLIGSKFRLVVKTSLKLLLVFVEYS---ESNAALLIQAIDTVDNKRGCKSWSNAMEILAEKDGVDTELLVYVMTLINKTLAALPDQDSFYDMVDVLEEQGMESVSQRYLGRKGTDLDLLEQLNIYEATLRHEDGDE 325          

HSP 2 Score: 202.216 bits (513), Expect = 2.681e-56
Identity = 112/226 (49.56%), Postives = 154/226 (68.14%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSN+INIG+  L     +K AI+N     +N+EG+EK+L TM+PT EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G+ ++  ++TL Y+LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S V+     TTDL+SE+ A+ R  +VD+E+L   L  +E+    SW+HLK+I K
Sbjct:  930 VLDSKRSNSINIGLTVLPPPRTIKTAIVNFDEYALNKEGIEKIL-TMIPTAEETQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMDQLEKNKTLRYILSTLLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHVCSAVLENCSDTTDLYSEIGAITRSAKVDFEQLQENLTLMERRCKASWDHLKVIAK 1154          

HSP 3 Score: 39.2762 bits (90), Expect = 2.681e-56
Identity = 23/85 (27.06%), Postives = 37/85 (43.53%), Query Frame = 2
Query: 3791 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            PP P   S         K  +  F K+K+T RL W    P      ++     ++WS+++ V  D  + E LFE+K  +  +  K
Sbjct:  834 PPPPPCFSNQAPPPPEMKAELPLFQKKKKTIRLFWSEVQPADWIYRNHKRSQESLWSRLEPVKIDTAKLEHLFESKSKEMPVAKK 918          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod1 (formin homology 2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-110623-4])

HSP 1 Score: 259.225 bits (661), Expect = 1.676e-69
Identity = 149/314 (47.45%), Postives = 213/314 (67.83%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGY---IESGNCGV-ILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKR 2722
            KLE   LQL          G +LD D ++ EQ +D++     +E G   + ILRT+LS+RV ++++K+ N++G ELRR+LFSLKQ+FQDDKDLV EFV   GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNG++  +ET++WLY+L     RLVVK ALKLL+VF+EY    E ++  +I ++N    K G KPW+++I IL     +D+EL+ Y +T INK L+ +PDQD+FYDVTD LE+ EMESI +  +  S  + D+ +QF IYEKAL+ EDGE   +  N  +R   R  + ++ +G RKS+R
Sbjct:   55 KLEECALQLAS-------NGNYLDLDSSLAEQRDDVEQLYDDVEKGKKPILILRTQLSVRVHSILEKLYNSHGPELRRSLFSLKQLFQDDKDLVPEFVISEGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGIVNHNETVQWLYTLCGSLSRLVVKTALKLLIVFVEYT---ESNSPLLIQAVNIVDGKRGVKPWTILIDILSAKNGSDTELLIYTMTLINKTLAALPDQDSFYDVTDCLEQLEMESIIQKHMTSSGTEGDLKQQFTIYEKALKCEDGEMDETAPN--VRKDRRKLTPSEQEG-RKSRR 355          

HSP 2 Score: 200.675 bits (509), Expect = 7.492e-56
Identity = 111/234 (47.44%), Postives = 160/234 (68.38%), Query Frame = 1
Query: 4030 EVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            EV    + VLD KRSNAINIGM  L +I  +K+AIL      I++EG+EK+L TM PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLK G++++  ++T   +L+T+L +GNFLN +    F L YL+KV EVKDT H+ SLL+H  + VV  YP TTDL+SE+ A+ R  +V++E+L+  L +LE+    SW++LK++ K
Sbjct:  916 EVKKAAISVLDPKRSNAINIGMTVLPAIHVIKSAILTFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYETLEKEIAEPLFDLKQGMEQLAKNKTFKRILATLLAIGNFLNSSRAKGFELGYLEKVTEVKDTVHRQSLLHHTCNFVVENYPDTTDLYSEIPAITRSAKVEFEQLSENLIQLERKCKTSWDNLKVVAK 1148          

HSP 3 Score: 39.2762 bits (90), Expect = 7.492e-56
Identity = 20/63 (31.75%), Postives = 31/63 (49.21%), Query Frame = 2
Query: 3857 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
             F K+++T +L WK       P+      G T+W+ +  VD D  + E LFE+K  D  +  K
Sbjct:  852 AFVKKRKTVKLFWKELKQSDSPRKCKFGRG-TVWASLDKVDVDTAKLEHLFESKGKDLPVAKK 913          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 256.914 bits (655), Expect = 1.121e-68
Identity = 140/282 (49.65%), Postives = 198/282 (70.21%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 2626
            KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    +    PWS +I IL +    DSEL+ + +T INK LS +PDQD+FYDVTD LE+Q ME I +  +N    D D+ ++  +YE AL+ ED
Sbjct:   55 KLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRACSPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLYESALKQED 326          

HSP 2 Score: 206.068 bits (523), Expect = 9.210e-57
Identity = 114/246 (46.34%), Postives = 169/246 (68.70%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +       K  +F   C
Sbjct:  876 LVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHETKPGLKNKMTEFLKSC 1120          

HSP 3 Score: 37.3502 bits (85), Expect = 9.210e-57
Identity = 18/58 (31.03%), Postives = 30/58 (51.72%), Query Frame = 2
Query: 3854 SGFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDF 4018
            +   K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  + 
Sbjct:  805 TALTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKEL 862          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 253.062 bits (645), Expect = 2.310e-68
Identity = 158/364 (43.41%), Postives = 231/364 (63.46%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGP-RKSKRIRV----NETKNESHRSQKLVIEDQ----RKKNDKNFQKIEIIPKKNES 2845
            KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FYDVTD LE+Q ME I +  +N    D D+ ++  +YE             V NE ++S PR +      GP  +++ +++    N T   +  S++ V+  Q     + N KN +K  +IP K  S
Sbjct:   70 KLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLYENI-----------VSNEVLKS-PRERM-----GPIFRTEEVQIENSPNTTIENTAESRRTVMRAQYSIDAETNAKNLEKTLMIPFKKSS 406          

HSP 2 Score: 205.682 bits (522), Expect = 1.791e-56
Identity = 114/246 (46.34%), Postives = 169/246 (68.70%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +       K  +F   C
Sbjct:  564 LVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHETKPGLKNKMTEFLKSC 808          

HSP 3 Score: 36.965 bits (84), Expect = 1.791e-56
Identity = 19/63 (30.16%), Postives = 31/63 (49.21%), Query Frame = 2
Query: 3857 GFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDFKIYMKL 4036
               K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  +    + L
Sbjct:  491 SLTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKELPFTLCL 553          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 249.21 bits (635), Expect = 3.495e-67
Identity = 142/310 (45.81%), Postives = 205/310 (66.13%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPR 2710
            KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FYDVTD LE+Q ME I +  +N    D D+ ++  ++    R    E   +   E I +L + + E   +  R
Sbjct:   68 KLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLFSFTCRSRFLENLAATELEKISALSKGRQEVLAEAVR 367          

HSP 2 Score: 206.453 bits (524), Expect = 1.037e-56
Identity = 114/246 (46.34%), Postives = 169/246 (68.70%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +       K  +F   C
Sbjct:  530 LVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHETKPGLKNKMTEFLKSC 774          

HSP 3 Score: 37.3502 bits (85), Expect = 1.037e-56
Identity = 18/58 (31.03%), Postives = 30/58 (51.72%), Query Frame = 2
Query: 3854 SGFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDF 4018
            +   K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  + 
Sbjct:  465 TALTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKEL 522          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 250.751 bits (639), Expect = 4.147e-67
Identity = 166/444 (37.39%), Postives = 256/444 (57.66%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRK-----SKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQ-KIEIIPKKNESENSDVDEV-SKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLL 3091
            KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    +    PWS +I IL +    DSEL+ + +T INK LS +PDQD+FYDVTD LE+Q ME I +  +N    D D+ ++  ++    R    E   +   E I +L + + E   +  R       + +  ++ + +   S+K ++E    KN        EI+  KN   N  +     ++     TE+  I++  N         RR ++  +  ++   +  NL +       KS    +  PS+PQ++L
Sbjct:   62 KLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRACSPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLFSFTCRSRFLENLAATELEKISALSKGRQEVLAEAVRNGGDLCGEAMSPSQAEEDRSSSKKFMLEMLYSKNQSGTGLDTEILNAKNIVSNEVLKSPRERMGPIFRTEEVQIENSPNTTIENTAESRRTVMRAQYSIDAETNAKNLEKTLMIPFKKSSAILWEQPSKPQTVL 495          

HSP 2 Score: 205.682 bits (522), Expect = 1.479e-56
Identity = 114/246 (46.34%), Postives = 169/246 (68.70%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +       K  +F   C
Sbjct:  675 LVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHETKPGLKNKMTEFLKSC 919          

HSP 3 Score: 37.3502 bits (85), Expect = 1.479e-56
Identity = 18/58 (31.03%), Postives = 30/58 (51.72%), Query Frame = 2
Query: 3854 SGFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDF 4018
            +   K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  + 
Sbjct:  604 TALTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKEL 661          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 248.44 bits (633), Expect = 5.621e-67
Identity = 141/303 (46.53%), Postives = 203/303 (67.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSE 2689
            KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FYDVTD LE+Q ME I +  +N    D D+ ++  ++    R    E   +   E I +L + + E
Sbjct:   70 KLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLFSFTCRSRFLENLAATELEKISALSKGRQE 362          

HSP 2 Score: 205.682 bits (522), Expect = 3.651e-53
Identity = 114/246 (46.34%), Postives = 169/246 (68.70%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +       K  +F   C
Sbjct:  539 LVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHETKPGLKNKMTEFLKSC 783          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod3 (formin homology 2 domain containing 3 [Source:MGI Symbol;Acc:MGI:1925847])

HSP 1 Score: 285.804 bits (730), Expect = 1.621e-77
Identity = 154/300 (51.33%), Postives = 215/300 (71.67%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFYDV D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 200.675 bits (509), Expect = 5.333e-56
Identity = 112/232 (48.28%), Postives = 164/232 (70.69%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            +++ VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +
Sbjct: 1112 QEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHE 1342          

HSP 3 Score: 39.6614 bits (91), Expect = 5.333e-56
Identity = 22/66 (33.33%), Postives = 33/66 (50.00%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct: 1039 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKK 1104          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod3 (formin homology 2 domain containing 3 [Source:MGI Symbol;Acc:MGI:1925847])

HSP 1 Score: 285.419 bits (729), Expect = 1.998e-77
Identity = 154/300 (51.33%), Postives = 215/300 (71.67%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFYDV D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 201.445 bits (511), Expect = 3.766e-56
Identity = 112/232 (48.28%), Postives = 164/232 (70.69%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            +++ VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +
Sbjct: 1080 QEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHE 1310          

HSP 3 Score: 39.6614 bits (91), Expect = 3.766e-56
Identity = 22/66 (33.33%), Postives = 33/66 (50.00%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct: 1007 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKK 1072          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod3 (formin homology 2 domain containing 3 [Source:MGI Symbol;Acc:MGI:1925847])

HSP 1 Score: 284.648 bits (727), Expect = 2.368e-77
Identity = 154/300 (51.33%), Postives = 215/300 (71.67%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFYDV D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 205.682 bits (522), Expect = 1.699e-57
Identity = 112/226 (49.56%), Postives = 160/226 (70.80%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K
Sbjct:  965 VLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAK 1189          

HSP 3 Score: 39.6614 bits (91), Expect = 1.699e-57
Identity = 22/66 (33.33%), Postives = 33/66 (50.00%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct:  888 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKK 953          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod1 (formin homology 2 domain containing 1 [Source:MGI Symbol;Acc:MGI:2679008])

HSP 1 Score: 261.536 bits (667), Expect = 1.556e-70
Identity = 140/284 (49.30%), Postives = 198/284 (69.72%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
            KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+  ++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  SET++WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D+EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME++ +  L  +  DVD+  Q  +YE ALR+EDG+
Sbjct:   67 KLEDCALQV-------SPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIQAVNAVASATGTLPWANLVSILEEKNGADAELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRFLGTAGTDVDLRTQLTLYESALRLEDGD 340          

HSP 2 Score: 191.43 bits (485), Expect = 5.718e-53
Identity = 108/244 (44.26%), Postives = 157/244 (64.34%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD E +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLLYH+ SLV+   P ++DL+SE+ AL RC +VD+E+L   L +LE     + + L+ + K + S     +   F   C
Sbjct:  726 VLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDVPLGPAENFLMTLASIGGLAARLQLWAFKLDYESMEREIAEPLFDLKVGMEQLVHNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLYHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTENLGQLECRSQAAEDSLRSLAKHELSPALRARLTHFLAQC 968          

HSP 3 Score: 38.891 bits (89), Expect = 5.718e-53
Identity = 18/55 (32.73%), Postives = 29/55 (52.73%), Query Frame = 2
Query: 3869 QKRTTRLHWK----TFGPQVSNGDIGS--TIWSKMKNVDFDYERFESLFENKPHD 4015
            +++T +L W+    T GP  S    G   T+W+ ++ V  D  R E LFE++  D
Sbjct:  655 KRKTVKLFWRELKLTGGPGCSRSRFGPCPTLWASLEPVSVDTARLEHLFESRAKD 709          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q76LL6|FHOD3_MOUSE (FH1/FH2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fhod3 PE=1 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.134e-76
Identity = 154/300 (51.33%), Postives = 215/300 (71.67%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFYDV D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 200.675 bits (509), Expect = 3.259e-55
Identity = 112/232 (48.28%), Postives = 164/232 (70.69%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            +++ VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +
Sbjct: 1112 QEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHE 1342          

HSP 3 Score: 39.6614 bits (91), Expect = 3.259e-55
Identity = 22/66 (33.33%), Postives = 33/66 (50.00%), Query Frame = 2
Query: 3848 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct: 1039 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKK 1104          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q2V2M9|FHOD3_HUMAN (FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 1.538e-76
Identity = 153/300 (51.00%), Postives = 213/300 (71.00%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRA 2680
            KL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFYDV D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:   55 KLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 204.527 bits (519), Expect = 2.974e-56
Identity = 112/226 (49.56%), Postives = 159/226 (70.35%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K
Sbjct:  960 VLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAK 1184          

HSP 3 Score: 39.6614 bits (91), Expect = 2.974e-56
Identity = 25/85 (29.41%), Postives = 37/85 (43.53%), Query Frame = 2
Query: 3791 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +  +  K
Sbjct:  864 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKK 948          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q6P9Q4|FHOD1_MOUSE (FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3)

HSP 1 Score: 261.536 bits (667), Expect = 1.088e-69
Identity = 140/284 (49.30%), Postives = 198/284 (69.72%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
            KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+  ++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  SET++WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D+EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME++ +  L  +  DVD+  Q  +YE ALR+EDG+
Sbjct:   67 KLEDCALQV-------SPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIQAVNAVASATGTLPWANLVSILEEKNGADAELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRFLGTAGTDVDLRTQLTLYESALRLEDGD 340          

HSP 2 Score: 191.43 bits (485), Expect = 3.494e-52
Identity = 108/244 (44.26%), Postives = 157/244 (64.34%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD E +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLLYH+ SLV+   P ++DL+SE+ AL RC +VD+E+L   L +LE     + + L+ + K + S     +   F   C
Sbjct:  726 VLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDVPLGPAENFLMTLASIGGLAARLQLWAFKLDYESMEREIAEPLFDLKVGMEQLVHNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLYHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTENLGQLECRSQAAEDSLRSLAKHELSPALRARLTHFLAQC 968          

HSP 3 Score: 38.891 bits (89), Expect = 3.494e-52
Identity = 18/55 (32.73%), Postives = 29/55 (52.73%), Query Frame = 2
Query: 3869 QKRTTRLHWK----TFGPQVSNGDIGS--TIWSKMKNVDFDYERFESLFENKPHD 4015
            +++T +L W+    T GP  S    G   T+W+ ++ V  D  R E LFE++  D
Sbjct:  655 KRKTVKLFWRELKLTGGPGCSRSRFGPCPTLWASLEPVSVDTARLEHLFESRAKD 709          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q9Y613|FHOD1_HUMAN (FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3)

HSP 1 Score: 258.455 bits (659), Expect = 8.206e-69
Identity = 139/284 (48.94%), Postives = 198/284 (69.72%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
            KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+ +++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  S+TI+WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME++ +  L  +  DVD+  Q  +YE AL++EDG+
Sbjct:   67 KLEDCALQV-------SPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGD 340          

HSP 2 Score: 189.889 bits (481), Expect = 2.909e-47
Identity = 105/244 (43.03%), Postives = 158/244 (64.75%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD + +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLL+H+ SLV+   P+++DL+SE+ AL RC +VD+E+L   L +LE+    +   L+ + K + +     +   F   C
Sbjct:  694 VLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLGQLERRSRAAEESLRSLAKHELAPALRARLTHFLDQC 936          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q1ZXK2|FORG_DICDI (Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.333e-19
Identity = 67/236 (28.39%), Postives = 146/236 (61.86%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETN----VSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            K + ++D+K+SN+I   +  + + + +K AI  + +S++ +E ++ L+ T +PT+++   IK ++I+  +++L + E+++L+++   +++ERL  WLFQL+ +++  +I++ L  L+  IK+   S++L  +L  +L LGN++N  +       F+LE L  +   KD ++K SLL +V  + + +YPKT ++  EL +L +  ++   +++  ++ LEK  N S N+ K + +++
Sbjct:  705 KLVSLVDIKKSNSIAFMLAKIPTAEGLKKAIDTVDNSILGKEIIKTLI-TNVPTEQDYQLIKGSEIH--ESKLDKPERWILEIYGFPMMKERLVAWLFQLEYQEMYNNIIQILEKLQNAIKDTKSSDSLKKILGIVLVLGNYMNGGSGRGQADGFTLEILDSLATSKDVENKTSLLDYVSKISMEKYPKTMNVAQELDSL-KLVQLSISDMSTDINDLEKQFNISKNNCKKVLEAN 936          

HSP 2 Score: 22.7126 bits (47), Expect = 1.333e-19
Identity = 13/37 (35.14%), Postives = 20/37 (54.05%), Query Frame = 2
Query: 3887 LHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLF 3997
            L+WK      SN +   +IW ++    FD + FE+LF
Sbjct:  644 LYWKRIILPPSNRN--ESIWDQVLEPTFDSKDFENLF 678          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A5E4Q7R4 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS6258 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.087e-119
Identity = 226/787 (28.72%), Postives = 383/787 (48.67%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEG----IRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPK-KNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKR---------TKTLK-SLPTSYSPPSRPQSL---LLDQNENAIFLENVLNTIRERIT------STNSNDSIKAIK-PEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNF---------SDLAPINDYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMKLV 4039
            +L++A LQ+  FKD   +YG +LD D T+ EQ E+L+G  ++    ++LRT+LS+RV A+I+++ N+ GK+LRRALF++KQ+ Q DKDLV EFVA NGL CL Q+ +K DQ + +Y+LR +GQ+++YVDGM+GV+     I+WLYS +   FR++VK  LKLL +F+EY     L   + I  +++ H +    PW  V+KIL D +A+D+EL+  A+  IN  L  I D+D +YD  D L+EQ ++ I +  ++K   D+D+++Q +I++  L  EDG++  + I +     I+S+ R          RKSK+ +V E  N+S     +  E+    + K  Q+ +I+P  +N SE  ++    +  +     Q+   HH N++  L        +NN   +    SLG   +E R         T+T + +   SY+  ++  +L   L++ N+         N + +R+       S N+ND++ A++  +I + P+ ++                       VF++  EN            K I  + +S+   +N V +        ++GI+S AK+ L   + K + +   +E          S + L W+ L + CL  +  + + +F           ++   +  N      P +L  +  PPPLP                      P PP     ++      + +T  S   K K+T +L W+       P      +G  IW  +  V+ D    E LFE++ +D  I  KL+
Sbjct:   75 RLDDATLQV--FKDG--DYGPYLDIDSTLAEQDEELEGLQDNRKNALVLRTQLSVRVHAIIERLINSQGKDLRRALFAVKQMMQSDKDLVHEFVANNGLDCLMQVSAKEDQTYLDYVLRTVGQILIYVDGMHGVMNHKGCIQWLYSRIASNFRMIVKTTLKLLSIFVEYTETNSLLLVDAINFVDKSHNR---PPWYNVMKILQDFDASDTELLICAMNLINLCLINIQDRDVYYDQVDVLQEQGIDDIIQMYMSKQGTDLDLLRQLQIFDAVLLYEDGDESGTAIKQLDESIIKSMRRRSLSITNTDRRKSKKYQVKEKANQSS-VNSMETENTVTNDMKPTQERKILPSIRNNSECIEIKTSIRKRRDRFARQH---HHINQQEEL--------LNNLSNIYN-GSLGTKAEENRNGHKYDINVTETNRFTEDASYNKTTKFNNLPDVLINGNQRYT------NGLTQRMQNGTLGHSVNTNDNLAAVRQKQIDVTPEKDDR----------------------VFLVNRENR----------FKDISQRLTSS---SNHVSE----EKSKLAGIVSKAKEELAKSQSKEIIKSSTIEKSSKLHEIKVSENDLHWEELRKTCLNREFQLCDLDFSDLLQDSDDDVMSSSVNTANGPPPPPPFMLPSVG-PPPLPG------------------YFFPAPPANGSQNQSNLAEASMETDTSTIKKNKKTVKLFWREIQDNPIPPTVRPRVGGFIWDDLPQVNIDSAMLEHLFESRTNDLIIKQKLM 777          

HSP 2 Score: 206.068 bits (523), Expect = 1.087e-119
Identity = 120/235 (51.06%), Postives = 160/235 (68.09%), Query Frame = 1
Query: 4039 PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            PK+  +LD KRSNAINI MK L +   +K AIL M ++VI REG+EKLL TMLPT+EE   I+ AQ  N D  LG AE++LL L  IN L  RL++W+F+LD + LE++I EPLMDLK GI+ + D+ T   +LST+  +G+FLN + V  F LEYL KV EVKDT HKH LLYH+  +++ ++  TTD  SE+  + R  +VD++ L+  L KLE D   SW+HLK + K D S
Sbjct:  779 PKRNLILDTKRSNAINIAMKKLPTPQTIKAAILKMDATVIGREGIEKLL-TMLPTEEEKVKIQEAQYANPDLPLGSAEQFLLTLASINELSSRLKLWVFKLDFDNLEKEIAEPLMDLKQGIELLKDNRTFKVILSTLRSVGSFLNGSQVKGFRLEYLSKVMEVKDTVHKHPLLYHICEMIIEKFSDTTDFFSEVGPVIRASKVDFDVLSNNLLKLETDCKASWDHLKKVAKHDGS 1012          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A5E4QA11 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS6258 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 3.209e-117
Identity = 232/799 (29.04%), Postives = 385/799 (48.19%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEG----IRSLPRAKSETKLDGPRKSKRIRV----NETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPK-KNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKR---------TKTLK-SLPTSYSPPSRPQSL---LLDQNENAIFLENVLNTIRERIT------STNSNDSIKAIK-PEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISH--------FSSDILDWDALERECLEEQLIIKEWNFSDLAPIN---------DYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMKLV 4039
            +L++A LQ+  FKD   +YG +LD D T+ EQ E+L+G  ++    ++LRT+LS+RV A+I+++ N+ GK+LRRALF++KQ+ Q DKDLV EFVA NGL CL Q+ +K DQ + +Y+LR +GQ+++YVDGM+GV+     I+WLYS +   FR++VK  LKLL +F+EY     L   + I  +++ H +    PW  V+KIL D +A+D+EL+  A+  IN  L  I D+D +YD  D L+EQ ++ I +  ++K   D+D+++Q +I++  L  EDG++  + I +     I+S+ R          RKSK+ +V    N++   S  ++  V  D      K  Q+ +I+P  +N SE  ++    +  +     Q+   HH N++  L        +NN   +    SLG   +E R         T+T + +   SY+  ++  +L   L++ N+         N + +R+       S N+ND++ A++  +I + P+ ++                       VF++  EN            K I  + +S+   +N V +        ++GI+S AK+ L   K +        E  K  TI           S + L W+ L + CL  +  + + +FSDL   +         +  N      P +L  +  PPPLP                      P PP     ++      + +T  S   K K+T +L W+       P      +G  IW  +  V+ D    E LFE++ +D  I  KL+
Sbjct:   75 RLDDATLQV--FKDG--DYGPYLDIDSTLAEQDEELEGLQDNRKNALVLRTQLSVRVHAIIERLINSQGKDLRRALFAVKQMMQSDKDLVHEFVANNGLDCLMQVSAKEDQTYLDYVLRTVGQILIYVDGMHGVMNHKGCIQWLYSRIASNFRMIVKTTLKLLSIFVEYTETNSLLLVDAINFVDKSHNR---PPWYNVMKILQDFDASDTELLICAMNLINLCLINIQDRDVYYDQVDVLQEQGIDDIIQMYMSKQGTDLDLLRQLQIFDAVLLYEDGDESGTAIKQLDESIIKSMRRRSLSITNTDRRKSKKYQVKEKANQSSVNSMETENTVTNDM-----KPTQERKILPSIRNNSECIEIKTSIRKRRDRFARQH---HHINQQEEL--------LNNLSNIYN-GSLGTKAEENRNGHKYDINVTETNRFTEDASYNKTTKFNNLPDVLINGNQRYT------NGLTQRMQNGTLGHSVNTNDNLAAVRQKQIDVTPEKDDR----------------------VFLVNRENR----------FKDISQRLTSS---SNHVSE----EKSKLAGIVSKAKEELA--KSQSKVSSGFSEIIKSSTIEKSSKLHEIKVSENDLHWEELRKTCLNREFQLCDLDFSDLLQDSDDDVMSSSVNTANGPPPPPPFMLPSVG-PPPLPG------------------YFFPAPPANGSQNQSNLAEASMETDTSTIKKNKKTVKLFWREIQDNPIPPTVRPRVGGFIWDDLPQVNIDSAMLEHLFESRTNDLIIKQKLM 783          

HSP 2 Score: 206.068 bits (523), Expect = 3.209e-117
Identity = 120/235 (51.06%), Postives = 160/235 (68.09%), Query Frame = 1
Query: 4039 PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQS 4743
            PK+  +LD KRSNAINI MK L +   +K AIL M ++VI REG+EKLL TMLPT+EE   I+ AQ  N D  LG AE++LL L  IN L  RL++W+F+LD + LE++I EPLMDLK GI+ + D+ T   +LST+  +G+FLN + V  F LEYL KV EVKDT HKH LLYH+  +++ ++  TTD  SE+  + R  +VD++ L+  L KLE D   SW+HLK + K D S
Sbjct:  785 PKRNLILDTKRSNAINIAMKKLPTPQTIKAAILKMDATVIGREGIEKLL-TMLPTEEEKVKIQEAQYANPDLPLGSAEQFLLTLASINELSSRLKLWVFKLDFDNLEKEIAEPLMDLKQGIELLKDNRTFKVILSTLRSVGSFLNGSQVKGFRLEYLSKVMEVKDTVHKHPLLYHICEMIIEKFSDTTDFFSEVGPVIRASKVDFDVLSNNLLKLETDCKASWDHLKKVAKHDGS 1018          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A4Z2DHF2 (FH1/FH2 domain-containing protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001058 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 3.405e-105
Identity = 200/412 (48.54%), Postives = 286/412 (69.42%), Query Frame = 2
Query: 1421 YVTKYTDLDLLLEDQFIINKDCKKQ----NSNVKLNSYNSNLEDSTSLSNESTLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKFSDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHE--KLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKY 2638
            Y +K+TD+D +L+D     +D K      N  +K   Y        S  ++  +++ S  +KE F  MP E+Q++++KS  R+I    L+++CRN+N+ +KF+D  E++F+GY    E+LI+ G++++KLE++ LQL KF   Q+E+G +LD D T+QEQ EDL+   +  N  V+LRTKL +RV+A+I+K+ ++NG+EL+R+LFSLKQIFQDDKDLV EFV  +GL CL  +GS+SDQN QNYILRALGQ+MLYVDGM GV+E    + WLYSLL  KFRLV+K ALKL ++F++YA   E++A   + S+  YH      G+PWS +I IL ++EA+DSEL+ YA+T +NK L+ IPDQDTFYDVTD LEE  M+ I +  L K N D ++ +Q  +YE +LR EDGE +
Sbjct:  505 YFSKHTDIDDILKDSVSSKQDRKASKDLSNDIMKRRDY-YEDGSGDSDDDQCKIVYKSWKAKEAFQKMPTEIQNLLMKSHKRQITIPMLLNVCRNKNHDRKFTDLEEKNFRGYRTMDELLIESGIDVKKLEDSTLQLYKFGQAQSEFGSYLDLDSTLQEQWEDLEISADQEN-SVVLRTKLVVRVKAIIEKLLDSNGRELKRSLFSLKQIFQDDKDLVHEFVTHSGLDCLVNVGSRSDQNIQNYILRALGQIMLYVDGMAGVIEHPNILRWLYSLLTSKFRLVMKTALKLQLLFVDYA---EMNAMIFVKSVEAYHANTPTSGRPWSYLINIL-NNEASDSELLIYAMTLLNKTLNSIPDQDTFYDVTDCLEEMGMQKIVQCHLAKKNCDPELAEQLNLYEASLRYEDGEDF 910          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: G7YCZ9 (FH1/FH2 domain-containing protein 3 OS=Clonorchis sinensis OX=79923 GN=CLF_105116 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 3.418e-104
Identity = 208/427 (48.71%), Postives = 295/427 (69.09%), Query Frame = 2
Query: 1421 YVTKYTDLDLLLEDQFIINKDC---KKQNSNVKLNSYNSNLEDSTSLSNES--TLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKFSDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKL--GGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKY-LSVINEGIRSLPR 2677
            Y  ++TD+D LL+D+     D    KK+  +   +       D +  S+E    L++ S  SKE+F  M  ++Q++++KS  R I  R LMDICRN+ + ++F+D  E++F+GY  A+E+L + G++++KLE + LQLC+F   Q+E+G +LD D ++QEQ E+L+   +  N  ++LRTKL +RV+A+I+K+ N+ G+ELRRALFSLKQIFQDDKDLV EFV+ +GL CL  +GS+SDQN QNYILRALGQ+MLYVDGM GV+E  ET+ WLYSLL  KFRLV+K AL+LL+VF+EY    + +A   I ++N YH      G+PWS  I I+ +D A+ +EL  YA+  +NK L+ IPDQDTFYDVTD LEE  M+ I ++ L+K+N D ++++QF IYE  LR EDGE+Y LS +  G R   R
Sbjct:  503 YAMQHTDIDDLLKDRPSSRSDAISSKKKEVSGPPSPRREYYRDESGDSDEEEVKLVYKSWKSKEMFQRMTTDVQNLLMKSHKRPINVRMLMDICRNKYHDRRFTDAEEKNFRGYKTANELLTESGVDVKKLEESALQLCRFAQAQSEFGAYLDLDSSLQEQWEELEISPDQENS-IVLRTKLVVRVKAIIEKLLNSTGRELRRALFSLKQIFQDDKDLVPEFVSNSGLDCLISVGSRSDQNLQNYILRALGQIMLYVDGMTGVIEHLETLRWLYSLLSSKFRLVMKTALRLLLVFVEYV---DTNALVFIQAVNTYHATFPSTGRPWSYFISIMTND-ASGTELPIYAMVLLNKTLNAIPDQDTFYDVTDCLEEMGMQQIVQSNLSKANNDPELVEQFHIYEAMLRSEDGEEYDLSALPAGSRECIR 924          

HSP 2 Score: 263.462 bits (672), Expect = 6.532e-68
Identity = 132/254 (51.97%), Postives = 183/254 (72.05%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYCM 4788
             + G +K+EVLDVKRSNAINIGMK L     +  AIL M  S+INREG+EKLL +MLPT EE + I  A+       LGQAE++L+ L EI  L+ RLE+WLF+LD E  E+++ +PL DLK GI E+   +TL YV+ST+L +GNFLN T+   F+ +YL ++PEVKDTK+K+S+L+HV  +V+ Q+P +TD+HS+L AL RCHR+DWEEL  KL+KLE+D  ++W H ++IF S++  Q+N K ++F    M
Sbjct: 1562 QDAGLRKIEVLDVKRSNAINIGMKVLPPPRAISTAILKMDPSIINREGIEKLLTSMLPTPEECEAILKAKAEQNGLPLGQAEQFLITLSEITFLKPRLELWLFKLDYESTEKEVADPLADLKQGINEVVQCKTLRYVISTLLSIGNFLNGTSFRGFTFDYLARLPEVKDTKNKNSMLHHVCCIVLDQFPDSTDIHSDLGALCRCHRIDWEELPEKLNKLERDSKQAWEHYRVIFSSEKEKQKNAKLYEFVTDAM 1815          

HSP 3 Score: 27.335 bits (59), Expect = 6.532e-68
Identity = 10/30 (33.33%), Postives = 17/30 (56.67%), Query Frame = 2
Query: 3935 STIWSKMKNVDFDYERFESLFENKPHDFKI 4024
            S IWS++  +  D +  +  FENK  + K+
Sbjct: 1530 SIIWSELVPIKLDADYLQECFENKSAELKV 1559          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A419QHV7 (FH1/FH2 domain-containing protein 3 OS=Clonorchis sinensis OX=79923 GN=FHOD3 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 3.742e-104
Identity = 208/427 (48.71%), Postives = 295/427 (69.09%), Query Frame = 2
Query: 1421 YVTKYTDLDLLLEDQFIINKDC---KKQNSNVKLNSYNSNLEDSTSLSNES--TLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKFSDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKL--GGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKY-LSVINEGIRSLPR 2677
            Y  ++TD+D LL+D+     D    KK+  +   +       D +  S+E    L++ S  SKE+F  M  ++Q++++KS  R I  R LMDICRN+ + ++F+D  E++F+GY  A+E+L + G++++KLE + LQLC+F   Q+E+G +LD D ++QEQ E+L+   +  N  ++LRTKL +RV+A+I+K+ N+ G+ELRRALFSLKQIFQDDKDLV EFV+ +GL CL  +GS+SDQN QNYILRALGQ+MLYVDGM GV+E  ET+ WLYSLL  KFRLV+K AL+LL+VF+EY    + +A   I ++N YH      G+PWS  I I+ +D A+ +EL  YA+  +NK L+ IPDQDTFYDVTD LEE  M+ I ++ L+K+N D ++++QF IYE  LR EDGE+Y LS +  G R   R
Sbjct:  544 YAMQHTDIDDLLKDRPSSRSDAISSKKKEVSGPPSPRREYYRDESGDSDEEEVKLVYKSWKSKEMFQRMTTDVQNLLMKSHKRPINVRMLMDICRNKYHDRRFTDAEEKNFRGYKTANELLTESGVDVKKLEESALQLCRFAQAQSEFGAYLDLDSSLQEQWEELEISPDQEN-SIVLRTKLVVRVKAIIEKLLNSTGRELRRALFSLKQIFQDDKDLVPEFVSNSGLDCLISVGSRSDQNLQNYILRALGQIMLYVDGMTGVIEHLETLRWLYSLLSSKFRLVMKTALRLLLVFVEYV---DTNALVFIQAVNTYHATFPSTGRPWSYFISIMTND-ASGTELPIYAMVLLNKTLNAIPDQDTFYDVTDCLEEMGMQQIVQSNLSKANNDPELVEQFHIYEAMLRSEDGEEYDLSALPAGSRECIR 965          

HSP 2 Score: 263.462 bits (672), Expect = 6.266e-68
Identity = 131/249 (52.61%), Postives = 182/249 (73.09%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKF 4773
             + G +K+EVLDVKRSNAINIGMK L     +  AIL M  S+INREG+EKLL +MLPT EE + I  A+       LGQAE++L+ L EI  L+ RLE+WLF+LD E  E+++ +PL DLK GI E+   +TL YV+ST+L +GNFLN T+   F+ +YL ++PEVKDTK+K+S+L+HV  +V+ Q+P +TD+HS+L AL RCHR+DWEEL  KL+KLE+D  ++W H ++IF S++  Q+N K ++F
Sbjct: 1603 QDAGLRKIEVLDVKRSNAINIGMKVLPPPRAISTAILKMDPSIINREGIEKLLTSMLPTPEECEAILKAKAEQNGLPLGQAEQFLITLSEITFLKPRLELWLFKLDYESTEKEVADPLADLKQGINEVVQCKTLRYVISTLLSIGNFLNGTSFRGFTFDYLARLPEVKDTKNKNSMLHHVCCIVLDQFPDSTDIHSDLGALCRCHRIDWEELPEKLNKLERDSKQAWEHYRVIFSSEKEKQKNAKLYEF 1851          

HSP 3 Score: 27.335 bits (59), Expect = 6.266e-68
Identity = 10/30 (33.33%), Postives = 17/30 (56.67%), Query Frame = 2
Query: 3935 STIWSKMKNVDFDYERFESLFENKPHDFKI 4024
            S IWS++  +  D +  +  FENK  + K+
Sbjct: 1571 SIIWSELVPIKLDADYLQECFENKSAELKV 1600          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod1 (FH1/FH2 domain-containing protein 1-like [Source:NCBI gene;Acc:103022245])

HSP 1 Score: 250.366 bits (638), Expect = 8.114e-67
Identity = 137/287 (47.74%), Postives = 196/287 (68.29%), Query Frame = 2
Query: 1784 NIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
             + KL  A L+L +     +  G +LD D ++ EQ ++L+ + E    G    +ILRT+LS+RV ++++K+ N+ G ELRR+LFSLKQ+FQDDKDLV EFV  +GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNGV+  +ET++WLY+L     RLVVK ALKLL+VF+EY    E +   +I ++N    K G K WS +  +L +   +D+EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME I +  ++    D D+ +QF IYE AL+ EDGE
Sbjct:   45 GVHKLLQAPLKLEECALQVSPNGNYLDLDSSLTEQRDELEQFYEDIAIGKKPILILRTQLSVRVHSILEKLYNSQGPELRRSLFSLKQLFQDDKDLVPEFVNSDGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGVINHNETVQWLYTLTGSMSRLVVKTALKLLIVFVEYT---ESNGPLLIQAVNTVDVKRGVKSWSYLTDMLEEKNGSDTELLVYTMTLINKTLAALPDQDSFYDVTDSLEQQGMERIMQKHMSSRGIDPDLKQQFTIYENALKYEDGE 328          

HSP 2 Score: 202.216 bits (513), Expect = 5.432e-56
Identity = 115/252 (45.63%), Postives = 170/252 (67.46%), Query Frame = 1
Query: 4030 EVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            EV   ++ VLD KRSNAINIGM  L ++  +K AILN     I++EG+EK+L TM PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  ++T   +L+T+L +GNFLN ++   F L YL+KV EVKDT H+ SLL+H  + VV  YP T+D++SE+SA+ R  +VD+E+L+  L +LE+    SW++LK++ K +   Q   K  +F   C
Sbjct:  904 EVKRAEIHVLDSKRSNAINIGMTVLPAVHIIKTAILNFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLASPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYESLEKEIAEPLFDLKLGMEQLAKNKTFKRILATLLAIGNFLNSSSAKGFELSYLEKVIEVKDTVHRQSLLHHCCNFVVENYPDTSDVYSEISAITRSAKVDFEQLSDNLVQLERKCKTSWDNLKVMAKHETKLQLKNKMTEFLKDC 1154          

HSP 3 Score: 37.7354 bits (86), Expect = 5.432e-56
Identity = 19/63 (30.16%), Postives = 31/63 (49.21%), Query Frame = 2
Query: 3857 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
             F K+++T +L WK       P+      G T+W+ +  V  D ++ E LFE+K  D  +  K
Sbjct:  840 AFVKKRKTVKLFWKELKQPDSPRKCKFGRG-TVWASLDKVSVDTDKLEHLFESKAKDLPVAKK 901          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod1 (FH1/FH2 domain-containing protein 1-like [Source:NCBI gene;Acc:103022245])

HSP 1 Score: 250.366 bits (638), Expect = 9.584e-67
Identity = 137/287 (47.74%), Postives = 196/287 (68.29%), Query Frame = 2
Query: 1784 NIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
             + KL  A L+L +     +  G +LD D ++ EQ ++L+ + E    G    +ILRT+LS+RV ++++K+ N+ G ELRR+LFSLKQ+FQDDKDLV EFV  +GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNGV+  +ET++WLY+L     RLVVK ALKLL+VF+EY    E +   +I ++N    K G K WS +  +L +   +D+EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME I +  ++    D D+ +QF IYE AL+ EDGE
Sbjct:   45 GVHKLLQAPLKLEECALQVSPNGNYLDLDSSLTEQRDELEQFYEDIAIGKKPILILRTQLSVRVHSILEKLYNSQGPELRRSLFSLKQLFQDDKDLVPEFVNSDGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGVINHNETVQWLYTLTGSMSRLVVKTALKLLIVFVEYT---ESNGPLLIQAVNTVDVKRGVKSWSYLTDMLEEKNGSDTELLVYTMTLINKTLAALPDQDSFYDVTDSLEQQGMERIMQKHMSSRGIDPDLKQQFTIYENALKYEDGE 328          

HSP 2 Score: 202.601 bits (514), Expect = 5.477e-56
Identity = 115/252 (45.63%), Postives = 170/252 (67.46%), Query Frame = 1
Query: 4030 EVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            EV   ++ VLD KRSNAINIGM  L ++  +K AILN     I++EG+EK+L TM PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  ++T   +L+T+L +GNFLN ++   F L YL+KV EVKDT H+ SLL+H  + VV  YP T+D++SE+SA+ R  +VD+E+L+  L +LE+    SW++LK++ K +   Q   K  +F   C
Sbjct:  922 EVKRAEIHVLDSKRSNAINIGMTVLPAVHIIKTAILNFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLASPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYESLEKEIAEPLFDLKLGMEQLAKNKTFKRILATLLAIGNFLNSSSAKGFELSYLEKVIEVKDTVHRQSLLHHCCNFVVENYPDTSDVYSEISAITRSAKVDFEQLSDNLVQLERKCKTSWDNLKVMAKHETKLQLKNKMTEFLKDC 1172          

HSP 3 Score: 37.7354 bits (86), Expect = 5.477e-56
Identity = 19/63 (30.16%), Postives = 31/63 (49.21%), Query Frame = 2
Query: 3857 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
             F K+++T +L WK       P+      G T+W+ +  V  D ++ E LFE+K  D  +  K
Sbjct:  858 AFVKKRKTVKLFWKELKQPDSPRKCKFGRG-TVWASLDKVSVDTDKLEHLFESKAKDLPVAKK 919          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod1 (FH1/FH2 domain-containing protein 1-like [Source:NCBI gene;Acc:103022245])

HSP 1 Score: 250.366 bits (638), Expect = 1.005e-66
Identity = 137/287 (47.74%), Postives = 196/287 (68.29%), Query Frame = 2
Query: 1784 NIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
             + KL  A L+L +     +  G +LD D ++ EQ ++L+ + E    G    +ILRT+LS+RV ++++K+ N+ G ELRR+LFSLKQ+FQDDKDLV EFV  +GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNGV+  +ET++WLY+L     RLVVK ALKLL+VF+EY    E +   +I ++N    K G K WS +  +L +   +D+EL+ Y +T INK L+ +PDQD+FYDVTD LE+Q ME I +  ++    D D+ +QF IYE AL+ EDGE
Sbjct:   45 GVHKLLQAPLKLEECALQVSPNGNYLDLDSSLTEQRDELEQFYEDIAIGKKPILILRTQLSVRVHSILEKLYNSQGPELRRSLFSLKQLFQDDKDLVPEFVNSDGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGVINHNETVQWLYTLTGSMSRLVVKTALKLLIVFVEYT---ESNGPLLIQAVNTVDVKRGVKSWSYLTDMLEEKNGSDTELLVYTMTLINKTLAALPDQDSFYDVTDSLEQQGMERIMQKHMSSRGIDPDLKQQFTIYENALKYEDGE 328          

HSP 2 Score: 202.216 bits (513), Expect = 6.099e-56
Identity = 115/252 (45.63%), Postives = 170/252 (67.46%), Query Frame = 1
Query: 4030 EVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            EV   ++ VLD KRSNAINIGM  L ++  +K AILN     I++EG+EK+L TM PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  ++T   +L+T+L +GNFLN ++   F L YL+KV EVKDT H+ SLL+H  + VV  YP T+D++SE+SA+ R  +VD+E+L+  L +LE+    SW++LK++ K +   Q   K  +F   C
Sbjct:  939 EVKRAEIHVLDSKRSNAINIGMTVLPAVHIIKTAILNFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLASPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYESLEKEIAEPLFDLKLGMEQLAKNKTFKRILATLLAIGNFLNSSSAKGFELSYLEKVIEVKDTVHRQSLLHHCCNFVVENYPDTSDVYSEISAITRSAKVDFEQLSDNLVQLERKCKTSWDNLKVMAKHETKLQLKNKMTEFLKDC 1189          

HSP 3 Score: 37.7354 bits (86), Expect = 6.099e-56
Identity = 19/63 (30.16%), Postives = 31/63 (49.21%), Query Frame = 2
Query: 3857 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
             F K+++T +L WK       P+      G T+W+ +  V  D ++ E LFE+K  D  +  K
Sbjct:  875 AFVKKRKTVKLFWKELKQPDSPRKCKFGRG-TVWASLDKVSVDTDKLEHLFESKAKDLPVAKK 936          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 204.912 bits (520), Expect = 3.892e-56
Identity = 110/226 (48.67%), Postives = 157/226 (69.47%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K+AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G++++  ++TL Y+L+ +L +GNFLN +N   F L YL+KVPEVKDT HK SLL+H  S V+  +P+T+DL+SE+ A+ R  +VD+++L   L  +E+    SW +LKLI K
Sbjct:  163 VLDSKRSNAINIGLTVLPPPRTIKSAILNFDEYALNKEGIEKIL-TMIPTEEEKQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMEQLEKNKTLRYILAALLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHACSTVLENFPQTSDLYSEIGAVTRSAKVDFDQLQENLTLMERRCKASWENLKLIAK 387          

HSP 2 Score: 35.8094 bits (81), Expect = 3.892e-56
Identity = 18/61 (29.51%), Postives = 31/61 (50.82%), Query Frame = 2
Query: 3863 NKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            +K+K+T RL W    P     + +     ++WSK++ V  D  + E LFE+K  +  +  K
Sbjct:   91 SKKKKTIRLFWSEVRPAEYQFLGHKRGHMSLWSKLETVKLDTSKLEHLFESKSKEIPVTKK 151          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 207.223 bits (526), Expect = 6.752e-56
Identity = 112/226 (49.56%), Postives = 161/226 (71.24%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I  L  RL++W F++D E LE+++ EPL DLK G+ ++  ++TL ++LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S+VV ++P+++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K
Sbjct:  150 VLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPDTPLGSAEQFLLTLSSITELNARLQLWAFKMDYEVLEKEVAEPLQDLKEGMNQLEKNKTLRFILSTLLAIGNFLNGSNAKGFELSYLEKVPEVKDTVHKQSLLHHVCSIVVEKFPESSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKVIAK 374          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006679.1 (pep scaffold:Pmarinus_7.0:GL477506:4953:65657:1 gene:ENSPMAG00000006009.1 transcript:ENSPMAT00000006679.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.453 bits (524), Expect = 9.545e-57
Identity = 112/230 (48.70%), Postives = 160/230 (69.57%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFK 4731
            ++L VLD KRSNAINIG+  L     +K AILN     +N+EG+EKLL TM+PT+EE   I  AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E+++ EPL D+K G+ ++  + TL  +L+T+L +GNFLN TN   F L YL+KVPEVKDT HK SLL+HV ++VV ++P TTDL+SE+ A+ R  +VD++++   L+++E+     W+HLK I K
Sbjct:  963 QELIVLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKLL-TMIPTEEEKQKITEAQLVNPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYETMEKEVAEPLQDIKEGMDQVEKNRTLRCILTTLLAVGNFLNGTNAKGFELHYLEKVPEVKDTVHKQSLLHHVCNMVVEKFPDTTDLYSEIGAITRSAKVDFDQVQENLNQMERRCRACWDHLKAIAK 1191          

HSP 2 Score: 33.8834 bits (76), Expect = 9.545e-57
Identity = 24/88 (27.27%), Postives = 40/88 (45.45%), Query Frame = 2
Query: 3782 LPKPPV---PYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGP---QVSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDFKI 4024
            LP PP+   P   ++  T        ++   K+K+T RL W        Q  N   G S++W+ +  V+ D  + E LFE+K  +  +
Sbjct:  865 LPPPPLFASPAHQAREGTPGGPGSPALAHSLKKKKTVRLFWSEVRHTEWQHRNHRYGKSSLWASLDPVEVDTNKLEILFESKSKELPV 952          

HSP 3 Score: 115.546 bits (288), Expect = 6.514e-26
Identity = 69/130 (53.08%), Postives = 91/130 (70.00%), Query Frame = 2
Query: 2243 KFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 2632
            +FRLVVK ALKLLVVF+EY    E +A   I ++N    K G KPWS ++ IL + +  D+EL+ +A+T +NK L+ +PDQDTFYDVTD LEEQ ME+I +  L K   D D+ +QF IYE ALR+EDG+
Sbjct:    1 QFRLVVKTALKLLVVFVEYT---ESNAPLFIKAVNTTDRKSGVKPWSNILAILDEKDGIDTELLVFAMTLLNKTLAVLPDQDTFYDVTDCLEEQGMEAIAQRHLAKRGGDRDLAEQFDIYEVALRLEDGD 127          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001318.1 (pep scaffold:Pmarinus_7.0:GL481857:28229:37996:-1 gene:ENSPMAG00000001186.1 transcript:ENSPMAT00000001318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 1.586e-53
Identity = 106/242 (43.80%), Postives = 155/242 (64.05%), Query Frame = 1
Query: 4060 DVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            D +R     IG+  L +   +KNAI+      +NRE VEKLL TM+PT EE   I  AQ+ N D  LG AE +L  L  I+ L  RL++W F+LD E +E+++ +PLMDLK G++++  + TL  +LST+L +GNFLN ++   F L YLQKVPEVKDT HK SL+YH+ ++VV ++P+ +DL+SE+ A+ R  +VD+ +LA  L +LE+    SW+HLK + K +  +Q   +   F   C
Sbjct:    4 DTERGTTFYIGLTTLPAPGVIKNAIITFDEFALNRESVEKLL-TMMPTDEEKRRITEAQMANPDMHLGSAESFLFMLSSISELSARLQLWAFKLDYETMEKEVADPLMDLKDGMEQLRKNYTLKCILSTLLAIGNFLNGSSAKGFELSYLQKVPEVKDTVHKRSLIYHICNVVVEKFPEASDLYSEIGAITRIAKVDFNQLAENLAQLERRCKASWDHLKAVAKHEARAQLKTRLCDFLCDC 244          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000191.1 (pep scaffold:Pmarinus_7.0:GL476590:204154:283609:-1 gene:ENSPMAG00000000170.1 transcript:ENSPMAT00000000191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 1.498e-33
Identity = 63/103 (61.17%), Postives = 79/103 (76.70%), Query Frame = 2
Query: 1856 FLDFDLTVQEQIEDLDGYIESGN----CGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRA 2152
            +LD + T+ EQIEDLDG+ E         VILRTKLS+RV A I+K+ N +G+ELRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+Q+YILR 
Sbjct:    2 YLDPECTLAEQIEDLDGFQEQNGKVKKHTVILRTKLSVRVHACIEKLYNCSGRELRRALFSLKQIFQDDKDLVHEFVNAEGLTCLIKVGTEADQNNQSYILRG 104          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000190.1 (pep scaffold:Pmarinus_7.0:GL476590:194598:199001:-1 gene:ENSPMAG00000000169.1 transcript:ENSPMAT00000000190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 3.233e-27
Identity = 64/150 (42.67%), Postives = 92/150 (61.33%), Query Frame = 2
Query: 2165 MLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINR---YHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYE 2605
            ML+VDGMNGV+  + T++WLY L     RLVVK ALKLL+VF+EY           + +++R   +    G KPW  ++ +L + ++ D EL+  A+T INK L  +PDQD+FYD+TDWLE Q ME I K  L+   ++ +  +Q   YE
Sbjct:    1 MLFVDGMNGVIAHNLTVQWLYELTASDSRLVVKTALKLLLVFVEYTATNPRLLIQAVGTVDRRRVFSPPPGAKPWCNMMALLSERDSGDPELLVIAMTVINKTLVSLPDQDSFYDMTDWLEAQGMEDIVKNHLSTKTSNPEFAEQLHAYE 150          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000679.1 (pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 gene:ENSPMAG00000000612.1 transcript:ENSPMAT00000000679.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 3.549e-7
Identity = 49/169 (28.99%), Postives = 88/169 (52.07%), Query Frame = 1
Query: 4051 EVLDVKRSNAINIGMKNL-VSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQE--EIDNIKTAQINNKDA-QLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETN-----VSAFSLEYLQKVPEVK 4530
            ++LD KRS A+ I M ++ + I  +++A+L + SS+++ E ++ L +     +E  +I    T++   +D  QL + E++L +L +I    ER+   +FQ    +  + I   L  +    K +  S  +  VLS IL  GN++N  N        F+LE L K+ +VK
Sbjct:  313 KILDGKRSQAVGILMSSIHLEIKDIQHAVLQLDSSLVDLETLQALYENRGEKEELGKIMQFVTSKQGAEDTRQLDKPEQFLYELSQIPCFFERVFCIVFQSTFTEHIKSIHCRLELVHRNSKLLKTSAGVHKVLSLILTFGNYMNGGNRTRGQADGFALEILPKLRDVK 481          

HSP 2 Score: 21.9422 bits (45), Expect = 3.549e-7
Identity = 10/37 (27.03%), Postives = 14/37 (37.84%), Query Frame = 2
Query: 3887 LHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLF 3997
            L+W     +    D   TIW  +     +   FE LF
Sbjct:  250 LYWVRVQLRDRRSDTAKTIWDGLDEAKINPLEFEELF 286          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO36709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT8])

HSP 1 Score: 256.144 bits (653), Expect = 8.032e-69
Identity = 141/283 (49.82%), Postives = 194/283 (68.55%), Query Frame = 2
Query: 1850 GQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYD-DEANDSELVTYAITFINK---VLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKS 2686
            G +LD + T++EQ + L+G+++S    +ILRT LS+RV   I K+  A+G+ELRRALFSLKQIFQDDKDLV EFV  +GL  L  +G  +DQN+QNYILRA+GQ+MLYVDGMNGV+  +ETI+WLYSL   KFRLV K ALKLL+VFIEY  D   ++  ++ ++    +  G K WS ++ IL + D   D E++ YA+T +NK   +L   PDQDTFYD+TD LEE +ME+  K   ++   ++D+++Q  IYE ALRIEDG++ L          PR ++
Sbjct:  123 GCYLDLENTLEEQADLLEGFLDSRKNTIILRTSLSVRVHNCIAKLLAASGRELRRALFSLKQIFQDDKDLVHEFVNSDGLNALITVGQDADQNYQNYILRAIGQIMLYVDGMNGVINHNETIQWLYSLTASKFRLVAKTALKLLLVFIEYTED---NSRLLVEAVQCVDDAQGIKRWSEIVGILSEKDSLGDEEILIYAMTLVNKASDILYATPDQDTFYDITDDLEELDMENTVKMHQDRRGTNIDLLEQLNIYETALRIEDGDEELPAYGSSPSIRPRKRT 402          

HSP 2 Score: 207.994 bits (528), Expect = 8.659e-58
Identity = 116/236 (49.15%), Postives = 163/236 (69.07%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQ 4749
            K++ VLDVKRS  INI +  L  I  +K AI++M S+VI+REGV+KLL+ M P  EE   I+ AQ+ N D  LG AE++LL +  +N L  RL +W F+LD E LE+++ EPLMDLK  ++E+  + T  ++L+T+L +GNFLN   V  F L+YL KVPEVKDT HK SLLYH+  +V+ ++P TTDL+SEL AL+R  RVD+E +A  L  L+++  +SW HL ++ K D + Q
Sbjct: 1054 KEIVVLDVKRSQQINIALTKLPPIRTLKQAIISMDSTVIDREGVDKLLQ-MQPLPEEKMKIQEAQLANPDVPLGTAEQFLLTMASLNELAPRLHLWAFKLDYEMLEKEVAEPLMDLKEALEELNKNNTFKHILATLLAIGNFLNGKKVKGFQLDYLSKVPEVKDTVHKQSLLYHLCCMVMEKFPDTTDLYSELGALHRSSRVDFEVVAENLKNLKENCKRSWEHLSVVAKHDSTKQ 1288          

HSP 3 Score: 36.5798 bits (83), Expect = 8.659e-58
Identity = 22/54 (40.74%), Postives = 30/54 (55.56%), Query Frame = 2
Query: 3851 VSGFNKQKRTTRLHWKTF--GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENK 4006
            +S  NK K+  RL W+     P + NG +  TIW  +  VD D ++ E LFENK
Sbjct:  987 LSTLNK-KKMVRLFWQEVKNSPLI-NG-VNKTIWGSIDQVDIDTKKLEHLFENK 1037          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO27929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7W7])

HSP 1 Score: 98.5969 bits (244), Expect = 3.643e-24
Identity = 53/107 (49.53%), Postives = 72/107 (67.29%), Query Frame = 1
Query: 4042 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLER 4362
            K++ VLDVKRS  INI +  L  I  +K AI++M S+VI+REGV+KLL+ M P  EE   I+ AQ+ N D  LG AE++LL +  +N L  RL +W F+LD E LE+
Sbjct:    3 KEIVVLDVKRSQQINIALTKLPPIRTLKQAIISMDSTVIDREGVDKLLQ-MQPLPEEKMKIQEAQLANPDVPLGTAEQFLLTMASLNELAPRLHLWAFKLDYEMLEK 108          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO27387 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9E0])

HSP 1 Score: 52.373 bits (124), Expect = 2.358e-7
Identity = 55/176 (31.25%), Postives = 92/176 (52.27%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLV-SIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDI----LEPLMD-LKLGIKEIYDSETLIYVLSTILKLGNFLNE----TNVSAFSLEYLQKVPEVKDTKHK 4545
            + +LD KRS  +NI +K    S + + + I+   S V + + ++  +K +LP   E++ +K    N     LG AEK+L++L  +   E R+   L     ++ E DI    L+P ++ +K  I+EI +SETL  VL  IL +GNF+N      N  AF +  L K+ + +  K +
Sbjct:    1 ITLLDPKRSLNLNIFLKQFKKSNEEIISTIVKGDSKVFDVDVLKGFIK-LLPDNSEVEMLKG--FNGDTKMLGSAEKFLIELIAVKSYELRINAML-----QKAELDINLQTLKPNIECMKKAIEEILNSETLPEVLQLILIIGNFMNSGGYAGNAIAFKISSLVKLVDTRANKPR 168          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO45866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ1])

HSP 1 Score: 53.5286 bits (127), Expect = 5.364e-7
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 1
Query: 4147 SSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVS-----AFSLEYLQKVPEVKDTKHK 4545
              +++   + KL + +  T+EE+  I+    +N DA L + E++LLD+ +I   EERL   + +        +I + L + +L  +E+   + +  ++  IL  GNF+N  N++      F LE    +P++KD K +
Sbjct:   80 GKLVSSNSMSKLKQKVRGTKEELSTIEQYLEDNPDAILDRPEQFLLDVSKIVCYEERLACLIARTTVRDGLEEIGQMLTNFRLVCEELQKGKNVHNIMGLILAFGNFMNGGNIARGQADGFDLEI---IPKLKDVKSR 214          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 53.1434 bits (126), Expect = 1.067e-6
Identity = 58/226 (25.66%), Postives = 117/226 (51.77%), Query Frame = 1
Query: 4039 PKKLEVLDVKRSNAINIGMKNL-VSIDCMKNAILNMTSSV-INREGVEKLLKTMLPTQEEIDNIKTAQINNKDA-QLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLN---ETNVSAFSLEYLQKVPEVKDTKH-KXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDI 4695
            PK+L ++D +R+    I +  L +S + +  AIL +     ++++ VE+LLK  +PT  E + +     NNK+     +A+K+L D+  I   E+RL+   F+    +   D+   +  + +  KE+  S+ +  +L  IL  GN++N     N + F L  L ++ + K + + + +LL ++V+++   YP    L  +L+ +    +V+  EL  ++  L K++
Sbjct:  747 PKELSLIDSRRAQNCGILLTKLKLSDEEITKAILTIDEEEELSKDMVEQLLK-YVPTAAEKNLLNE---NNKEKDNFARADKFLYDMSRIVHYEQRLKALFFKKKFPERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARGNATGFKLASLNRIVDTKSSANSRITLLNYLVTVLEKSYPDVLKLEEDLANVRTAAKVNLAELESEIVALRKEL 968          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 214.542 bits (545), Expect = 3.111e-60
Identity = 118/244 (48.36%), Postives = 166/244 (68.03%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EKLL TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL +W F++D E  E++++EPL DLK G++++  ++TL Y+LST+L +GNFLN TN   F L YL+KVPEVKDT HK SLL+HV ++VV  +P++TDL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K +   Q   K   F   C
Sbjct:  109 VLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKLL-TMIPTEEEKQKIQEAQLANPDVPLGSAEQFLLTLSSISELSARLHLWAFKMDQEATEKEVVEPLQDLKEGMEQLEKNKTLRYILSTLLSIGNFLNGTNAKGFELTYLEKVPEVKDTVHKQSLLHHVCTVVVENFPQSTDLYSEIGAITRSAKVDFDQLQENLCQMERRCKASWDHLKVIAKHEMKPQLKQKMSDFLKDC 351          

HSP 2 Score: 39.6614 bits (91), Expect = 3.111e-60
Identity = 22/64 (34.38%), Postives = 30/64 (46.88%), Query Frame = 2
Query: 3860 FNKQKRTTRLHWKTFGP------QVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMK 4033
            FNK+K+T RL W    P          G  G + WSK+  V  D  + E+LFE K  +  +  K
Sbjct:   36 FNKKKKTIRLFWSEVRPTDCQYRDYKRG--GDSFWSKLDTVKLDTAKLENLFETKSKEISVTKK 97          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 206.453 bits (524), Expect = 1.148e-56
Identity = 114/244 (46.72%), Postives = 163/244 (66.80%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I  L  RL++W F++D E +E+++ EPL DLK G+ ++  + TL Y+L+T+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+H  S+VV ++P +TDL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K +  +    K   F   C
Sbjct:  151 VLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLVNPDIPLGSAEQFLLTLSSITELSARLQLWAFKMDYELMEKEVAEPLQDLKEGMDQLEKNRTLRYLLATLLAIGNFLNGSNAKGFELSYLEKVPEVKDTVHKQSLLHHACSIVVEKFPDSTDLYSEIGAITRLTKVDFDQLQDNLSQMERRCRASWDHLKVISKYEMKAALKQKMSDFLKEC 393          

HSP 2 Score: 35.8094 bits (81), Expect = 1.148e-56
Identity = 19/65 (29.23%), Postives = 32/65 (49.23%), Query Frame = 2
Query: 3860 FNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKIYMKLVL 4042
            F K+K+T RL W    P      S+     ++WSK++ +  D  + E LFE+K  +  +  K  +
Sbjct:   78 FQKKKKTIRLFWNEVRPVDWQCKSHKFCKESMWSKLEPIKVDTSKLEQLFESKSKELHVTKKAAV 142          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: fhod1 (formin homology 2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-110623-4])

HSP 1 Score: 206.068 bits (523), Expect = 5.321e-56
Identity = 114/244 (46.72%), Postives = 169/244 (69.26%), Query Frame = 1
Query: 4054 VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYC 4785
            VLD KRSNAINIGM  L +I  +K+AIL+     I++EG+EK+L TM+PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  + T   +L+T+L +GNFLN T+V  F L YL+KV EVKDT H+ SLLYH   LVV +YP+++D++SE++A++R  +VD+E L+  L +LE+    SW++LK++ K +       K  +F   C
Sbjct:  105 VLDPKRSNAINIGMTVLPAIHVIKSAILSFDEFAISKEGIEKIL-TMVPTEEEKQKIQEAQLADPDVPLGSAEQFLLSLASISALTARLQLWSFKLNYEALEKEIAEPLFDLKLGMEQLASNRTFRRILATLLAIGNFLNSTSVKGFELSYLEKVAEVKDTVHRQSLLYHTCKLVVDKYPESSDVYSEIAAISRSAKVDFELLSENLVQLERRCKASWDNLKVVAKHETKVALKTKMTEFLKDC 347          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: ENSORLT00000029213.1 (FH1/FH2 domain-containing protein 1 [Source:NCBI gene;Acc:105356456])

HSP 1 Score: 166.007 bits (419), Expect = 6.991e-43
Identity = 91/230 (39.57%), Postives = 144/230 (62.61%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            + VL +KRSN I I + +L +   +  AI  M SSV++RE V++L + ++PT++E+  IK A+  N  A L QAE  LL L EI  L  RLE+W F LD + LE++I EPL  LKL ++++  S+T  Y+L+T+L +GNFLN      F L YL K+ +V+DT  +  LL+HV  L++   P ++DLHS+++A+ +  + D+ ++     +LE     SW  LK++ K++
Sbjct:  107 VSVLGMKRSNIITIALSSLPAPRLLPPAIYAMDSSVLDREDVQRL-RALIPTEDELGLIKEAKAQNPHAPLAQAELCLLTLGEIPHLSTRLELWAFALDYDSLEKEIAEPLFHLKLAMEQLAASQTFRYILATVLTIGNFLNGCKARGFELSYLSKLSQVRDTHTRQPLLHHVCLLLLQLRPDSSDLHSDIAAVTKAAKYDYSQVQSSFTQLETMCKASWEQLKILEKAE 335          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: ENSORLT00000026828.1 (FH1/FH2 domain-containing protein 1 [Source:NCBI gene;Acc:105356456])

HSP 1 Score: 164.851 bits (416), Expect = 2.465e-42
Identity = 91/230 (39.57%), Postives = 144/230 (62.61%), Query Frame = 1
Query: 4048 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD 4737
            + VL +KRSN I I + +L +   +  AI  M SSV++RE V++L + ++PT++E+  IK A+  N  A L QAE  LL L EI  L  RLE+W F LD + LE++I EPL  LKL ++++  S+T  Y+L+T+L +GNFLN      F L YL K+ +V+DT  +  LL+HV  L++   P ++DLHS+++A+ +  + D+ ++     +LE     SW  LK++ K++
Sbjct:  162 VSVLGMKRSNIITIALSSLPAPRLLPPAIYAMDSSVLDREDVQRL-RALIPTEDELGLIKEAKAQNPHAPLAQAELCLLTLGEIPHLSTRLELWAFALDYDSLEKEIAEPLFHLKLAMEQLAASQTFRYILATVLTIGNFLNGCKARGFELSYLSKLSQVRDTHTRQPLLHHVCLLLLQLRPDSSDLHSDIAAVTKAAKYDYSQVQSSFTQLETMCKASWEQLKILEKAE 390          

HSP 2 Score: 29.6462 bits (65), Expect = 2.465e-42
Identity = 17/54 (31.48%), Postives = 26/54 (48.15%), Query Frame = 2
Query: 3857 GFNKQKRTTRLHWKT---FGPQVSNGDIG-STIWSKMKNVDFDYERFESLFENK 4006
            G   ++RT +LHWK      P       G  TIW++++ V+ D      LF+ K
Sbjct:   93 GTVTKRRTLKLHWKELPNLAPLPRMTHFGMQTIWAELEPVNLDTSLLGILFKAK 146          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 2037.31 bits (5277), Expect = 0.000e+0
Identity = 1080/1109 (97.39%), Postives = 1085/1109 (97.84%), Query Frame = 2
Query:  695 MISKTSRGTCTYSNIFEDCDKECSLISRTRIRKYPKQNVRIEMGSTVLVGSLTHIGKDISTQTSDDIFLPSPRIRPPXXXXXXXXXXXXXXXHYNRGLDNIKYTKTPKSSWKHHIAETIHSGVQKMEENMHFEDYSKSSSREKLQSPKSPIHKRTTPVVSIKDSIEKVNEWQIQNQILEXXXXXXXXXXXXXXXYHDLHAVTKPFYQKKNATDENQMXXXXXXXXXXXXXXXXVLHPLKENLYVTKYTDLDLLLEDQFIINKDCKKQNSNVKLNSYNSNLEDSTSLSNESTLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKFSDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 4021
            MISKTSRGTCTYSNIFEDCDKECSLISRTRIRKYPKQNVRIEMGSTVLVGSLTHIGKDISTQTSDDIFLPSPRIRPPSYKSGSSKGSISTSSHYNRGLDNIKYTKTP+SSWKHHIA+TIHSGVQKMEENMHFEDYSKSSSREKLQSPKSPIHKRTTPVVSIKDSIEKVNEWQIQNQILESQSNSNRSPVPRSPNYHDLHAVTKPFYQKKN TDENQMNEKKECSESNNKETKNVLHPLKENLYVTKYTDLDLLLEDQFIINKDCKKQNSNVKLNSYNSNLEDSTSLSNESTLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKFSDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFY+VTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYL+VINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNG LLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK
Sbjct:    1 MISKTSRGTCTYSNIFEDCDKECSLISRTRIRKYPKQNVRIEMGSTVLVGSLTHIGKDISTQTSDDIFLPSPRIRPPSYKSGSSKGSISTSSHYNRGLDNIKYTKTPRSSWKHHIADTIHSGVQKMEENMHFEDYSKSSSREKLQSPKSPIHKRTTPVVSIKDSIEKVNEWQIQNQILESQSNSNRSPVPRSPNYHDLHAVTKPFYQKKNVTDENQMNEKKECSESNNKETKNVLHPLKENLYVTKYTDLDLLLEDQFIINKDCKKQNSNVKLNSYNSNLEDSTSLSNESTLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKFSDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 1092          

HSP 2 Score: 466.848 bits (1200), Expect = 9.373e-138
Identity = 246/248 (99.19%), Postives = 246/248 (99.19%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHK 4770
            HE GPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKR K
Sbjct: 1094 HEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLK 1341          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1390.56 bits (3598), Expect = 0.000e+0
Identity = 717/743 (96.50%), Postives = 720/743 (96.90%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 4021
            KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFY+VTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYL+VINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNG LLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK
Sbjct:   56 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 781          

HSP 2 Score: 466.463 bits (1199), Expect = 4.522e-140
Identity = 246/248 (99.19%), Postives = 246/248 (99.19%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHK 4770
            HE GPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKR K
Sbjct:  783 HEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLK 1030          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 717/743 (96.50%), Postives = 720/743 (96.90%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 4021
            KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFY+VTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYL+VINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNG LLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK
Sbjct:   56 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 781          

HSP 2 Score: 514.612 bits (1324), Expect = 2.551e-157
Identity = 264/267 (98.88%), Postives = 265/267 (99.25%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYCMALWQECFNPNGGM 4827
            HE GPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCG CMALWQECFNPNGG+
Sbjct:  783 HEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGCCMALWQECFNPNGGI 1049          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1385.93 bits (3586), Expect = 0.000e+0
Identity = 717/743 (96.50%), Postives = 720/743 (96.90%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 4021
            KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFY+VTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYL+VINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNG LLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK
Sbjct:   56 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 781          

HSP 2 Score: 513.457 bits (1321), Expect = 2.857e-159
Identity = 265/267 (99.25%), Postives = 265/267 (99.25%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGYCMALWQECFNPNGGM 4827
            HE GPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCG CMALWQECFNPNGGM
Sbjct:  783 HEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHKFCGCCMALWQECFNPNGGM 1049          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1384.78 bits (3583), Expect = 0.000e+0
Identity = 717/747 (95.98%), Postives = 720/747 (96.39%), Query Frame = 2
Query: 1793 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIES----GNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGPLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 4021
            KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIES    GNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFY+VTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYL+VINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNG LLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK
Sbjct:   56 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESINIIGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKHHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYSPPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFK 785          

HSP 2 Score: 466.077 bits (1198), Expect = 5.636e-140
Identity = 246/248 (99.19%), Postives = 246/248 (99.19%), Query Frame = 1
Query: 4027 HEVGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRHK 4770
            HE GPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKR K
Sbjct:  787 HEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLK 1034          
The following BLAST results are available for this feature:
BLAST of Formin-like protein 15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FHOD32.530e-7751.00formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD32.533e-7751.00formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD33.203e-7751.00formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD11.709e-6948.94formin homology 2 domain containing 1 [Source:HGNC... [more]
FHOD35.068e-5749.56formin homology 2 domain containing 3 [Source:HGNC... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod-12.393e-6048.06Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-13.337e-6048.06Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-17.889e-5947.31Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-11.136e-5847.31Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-16.477e-5745.09Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fhos3.805e-6643.56gene:FBgn0266084 transcript:FBtr0302086[more]
Fhos4.079e-6643.69gene:FBgn0266084 transcript:FBtr0333889[more]
Fhos4.079e-6643.69gene:FBgn0266084 transcript:FBtr0333888[more]
Fhos4.230e-6643.56gene:FBgn0266084 transcript:FBtr0302584[more]
Fhos5.203e-6643.56gene:FBgn0266084 transcript:FBtr0302085[more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod3b1.168e-8152.00formin homology 2 domain containing 3b [Source:ZFI... [more]
fhod3a1.445e-7551.96formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3a9.334e-7551.22formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3a5.895e-7150.17formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod11.676e-6947.45formin homology 2 domain containing 1 [Source:ZFIN... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rexo11.121e-6849.65REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
rexo12.310e-6843.41REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
rexo13.495e-6745.81REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
rexo14.147e-6737.39REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
rexo15.621e-6746.53REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Fhod31.621e-7751.33formin homology 2 domain containing 3 [Source:MGI ... [more]
Fhod31.998e-7751.33formin homology 2 domain containing 3 [Source:MGI ... [more]
Fhod32.368e-7751.33formin homology 2 domain containing 3 [Source:MGI ... [more]
Fhod11.556e-7049.30formin homology 2 domain containing 1 [Source:MGI ... [more]
back to top
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q76LL6|FHOD3_MOUSE1.134e-7651.33FH1/FH2 domain-containing protein 3 OS=Mus musculu... [more]
sp|Q2V2M9|FHOD3_HUMAN1.538e-7651.00FH1/FH2 domain-containing protein 3 OS=Homo sapien... [more]
sp|Q6P9Q4|FHOD1_MOUSE1.088e-6949.30FH1/FH2 domain-containing protein 1 OS=Mus musculu... [more]
sp|Q9Y613|FHOD1_HUMAN8.206e-6948.94FH1/FH2 domain-containing protein 1 OS=Homo sapien... [more]
sp|Q1ZXK2|FORG_DICDI1.333e-1928.39Formin-G OS=Dictyostelium discoideum OX=44689 GN=f... [more]
back to top
BLAST of Formin-like protein 15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4Q7R41.087e-11928.72Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
A0A5E4QA113.209e-11729.04Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
A0A4Z2DHF23.405e-10548.54FH1/FH2 domain-containing protein isoform 2 OS=Sch... [more]
G7YCZ93.418e-10448.71FH1/FH2 domain-containing protein 3 OS=Clonorchis ... [more]
A0A419QHV73.742e-10448.71FH1/FH2 domain-containing protein 3 OS=Clonorchis ... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod18.114e-6747.74FH1/FH2 domain-containing protein 1-like [Source:N... [more]
fhod19.584e-6747.74FH1/FH2 domain-containing protein 1-like [Source:N... [more]
fhod11.005e-6647.74FH1/FH2 domain-containing protein 1-like [Source:N... [more]
fhod3a3.892e-5648.67formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3b6.752e-5649.56formin homology 2 domain containing 3b [Source:ZFI... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006679.19.545e-5748.70pep scaffold:Pmarinus_7.0:GL477506:4953:65657:1 ge... [more]
ENSPMAT00000001318.11.586e-5343.80pep scaffold:Pmarinus_7.0:GL481857:28229:37996:-1 ... [more]
ENSPMAT00000000191.11.498e-3361.17pep scaffold:Pmarinus_7.0:GL476590:204154:283609:-... [more]
ENSPMAT00000000190.13.233e-2742.67pep scaffold:Pmarinus_7.0:GL476590:194598:199001:-... [more]
ENSPMAT00000000679.13.549e-728.99pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 ge... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367098.032e-6949.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279293.643e-2449.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273872.358e-731.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458665.364e-726.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328681.067e-625.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod3a3.111e-6048.36formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3b1.148e-5646.72formin homology 2 domain containing 3b [Source:ZFI... [more]
fhod15.321e-5646.72formin homology 2 domain containing 1 [Source:ZFIN... [more]
ENSORLT00000029213.16.991e-4339.57FH1/FH2 domain-containing protein 1 [Source:NCBI g... [more]
ENSORLT00000026828.12.465e-4239.57FH1/FH2 domain-containing protein 1 [Source:NCBI g... [more]
back to top
BLAST of Formin-like protein 15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035694.19.373e-13897.39SMESG000035694.1[more]
SMESG000035694.14.522e-14096.50SMESG000035694.1[more]
SMESG000035694.12.551e-15796.50SMESG000035694.1[more]
SMESG000035694.12.857e-15996.50SMESG000035694.1[more]
SMESG000035694.15.636e-14095.98SMESG000035694.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010068 ID=SMED30010068|Name=Formin-like protein 15|organism=Schmidtea mediterranea sexual|type=transcript|length=4961bp
CAAATTTCGTTTGTTTGATTTCTTTTCGATTTTCGAAATAAGTATTTATT
ACTTTTGACAAATTATGTCATACAACTATAGGAAAACGGGTTTAGCGGCA
CGTGATTTTGGAGGATCTTATTACACCCCATCAAATTCTTCAGTTAAAAA
TTACAGTACCTCAACAAACAATTCAATGTTTCGAAATTATGAATCTTCAT
ATCCATCGAAGTATAATACAAGTAAATCTTATTCGAGACCAATTTCAGAA
CAAATATCTAAAAATAGCTACGGAATAAGTGGAAAATACAATACAAACGA
ATATAATTTTGAATATAAGCCAATTAGAAAATCTATACGAGATTTATCAA
ATTCTCCGTCTGTTAAATATTCGTCAATGCGAATTTCTGAAACATCACCC
TACTCTACATATAGTAGTCGACAAGGAAGTAATTCATATCTTTCTGATAA
AGATTCATCAAAGTATATTCCTAGCTCAATTTCATCGCGAGAATCATTTA
TAAGTCCTTCTAATTCTTATTCAATAATTAATCGAGAATCAGTACAAAAA
GAAACACAGTCAAAAAATAAAGAAACAATACAAAGTCCTAAACAGTCGAG
TTTTGTCTCAAAGTATAAAAGGAATAATGACGACAATGTTGACGATTCAC
TTCATAAAAATGAAGTTAAACAAGCAAATGAATCAAAGTACGATATGATT
AGTAAAACAAGTAGAGGAACATGTACTTATTCAAATATTTTTGAAGACTG
TGATAAAGAATGTAGTCTCATATCTCGAACAAGAATAAGAAAATATCCCA
AACAAAATGTTCGAATCGAAATGGGCAGTACAGTTTTAGTTGGTAGTTTA
ACACATATAGGAAAAGATATATCTACACAAACTAGTGACGATATATTTTT
ACCGTCTCCAAGAATTAGACCACCTTCTTATAAAAGTGGAAGTTCGAAGG
GCTCAATTTCAACATCATCGCATTACAACCGTGGGTTGGATAATATTAAA
TACACTAAAACACCAAAAAGTAGTTGGAAACATCATATTGCAGAAACCAT
TCATAGCGGTGTTCAGAAAATGGAAGAAAACATGCATTTCGAAGATTATT
CCAAATCATCGTCAAGGGAAAAACTTCAGTCTCCAAAATCTCCAATACAT
AAAAGAACAACACCAGTTGTTTCAATCAAAGATTCAATAGAAAAAGTAAA
TGAATGGCAAATTCAAAATCAAATCTTAGAATCTCAGAGTAATTCTAATA
GATCTCCAGTTCCAAGATCTCCCAATTATCATGACCTTCATGCTGTTACT
AAGCCCTTTTACCAGAAGAAAAATGCAACTGATGAAAATCAAATGAATGA
GAAAAAGGAATGTTCAGAGTCAAACAATAAAGAAACTAAAAACGTTTTAC
ATCCACTGAAGGAAAATTTATATGTAACTAAATACACCGACTTGGATTTA
CTTTTAGAAGATCAATTTATTATTAACAAAGATTGTAAAAAACAAAACTC
AAACGTTAAACTCAATTCATATAATAGCAATTTAGAAGACTCAACATCTT
TATCAAACGAATCTACTTTATTATTTAATTCTAAGGCTTCAAAAGAAATT
TTTAATTCTATGCCGATTGAACTGCAGCATATTATTGTGAAATCAAAAAG
TCGAAAGATAAAATTCAGAGAACTAATGGATATTTGTAGAAATGAAAATT
ACATGCAAAAGTTTTCGGATGAAAGTGAACGATCATTCAAAGGGTATACA
AATGCGAGCGAAATGCTTATTGATTTGGGATTAAATATAGAAAAATTAGA
AAATGCAGTTTTGCAATTATGTAAATTTAAAGACACCCAAACTGAATACG
GGCAATTTCTCGACTTTGATTTAACTGTACAAGAACAAATTGAAGATCTT
GATGGATATATAGAAAGTGGAAACTGTGGAGTTATATTGAGGACGAAATT
GTCAATTAGAGTTGAAGCTTTAATAGATAAAATAAACAATGCTAATGGCA
AAGAACTTAGAAGAGCTTTATTTTCATTAAAGCAAATTTTTCAAGACGAT
AAAGATTTAGTACAAGAATTTGTTGCTCGAAATGGATTACAATGTTTAAG
GCAGATTGGATCAAAAAGCGATCAAAATCATCAAAATTATATTTTGCGAG
CATTGGGTCAATTAATGTTGTATGTTGATGGAATGAACGGAGTTCTTGAA
GACTCAGAAACAATAGAATGGCTCTATAGCTTATTACAGGGAAAATTTCG
ATTGGTTGTTAAATTAGCTTTGAAACTTCTCGTAGTATTCATTGAATATG
CTATAGATCAAGAATTACATGCATCAAATATTATTGCCTCAATAAATAGA
TATCATGAAAAATTAGGTGGGAAACCTTGGAGTCTTGTCATCAAGATTCT
ATATGACGATGAAGCAAATGACTCTGAACTTGTTACTTATGCAATTACAT
TTATAAATAAAGTTCTAAGTTTTATTCCTGATCAAGATACATTTTACGAT
GTTACTGATTGGTTAGAAGAACAAGAAATGGAGTCCATTACTAAAGCAAT
TTTAAATAAATCAAATGCTGATGTTGATATGATAAAACAGTTTAAAATTT
ATGAAAAAGCTTTGCGAATTGAAGACGGAGAAAAATATCTTTCTGTCATT
AATGAGGGTATTAGAAGTTTACCTAGGGCTAAGTCGGAAACTAAATTAGA
TGGACCTAGGAAATCAAAAAGAATTCGGGTAAACGAAACAAAAAATGAAT
CTCATCGCTCCCAAAAATTAGTTATTGAAGATCAAAGAAAGAAAAATGAT
AAAAATTTTCAAAAAATTGAAATAATTCCTAAAAAAAATGAAAGCGAAAA
TTCAGATGTTGATGAAGTTAGTAAAGTTGAAAAATTCTTGGAAACGGAAC
AAAATTCAATAAAACATCATGAAAATGAAGAAAGTTCCTTGCATCAAATA
ATTAGACGTAAAATTGTTAACAATGAAAAACCTTTGGAACGATTCAAATC
ACTTGGAAATCTTTACCAAGAGAAACGTACTAAAACTTTGAAATCTCTAC
CTACGTCATACTCCCCACCTTCAAGACCTCAAAGTCTTCTTTTAGATCAA
AATGAAAATGCAATTTTCCTTGAAAATGTTTTAAACACCATAAGAGAAAG
AATCACTAGTACAAATAGTAATGATTCTATAAAAGCAATAAAGCCTGAAA
TAAGAATCCATCCTGATTCTGAAGAATCTTCTCGAATAGTGTCTCCAGTA
AATAATCTACATTATCAAAATACACCTCAAACTAGTGAAGAAGATGTTTT
TATTATGAAGGATGAAAACAATAAATGCAATATTGAAACGTCAAAACACA
GTGTGAAAGCAATCAAGAATCAATTTTCATCGACGATTAAACAAAATAAC
GAAGTTGGAAAACTGCAACATACTCGTAGTGGAGATGTGTCAGGTATTAT
TTCAAATGCTAAGGATAATCTTATGAATCAGAAAATGAAACTGTTAACAG
AACCTAAGTTACTAGAACCTAAAAAGGATTGCACAATTAGTCATTTTTCT
TCCGATATTCTTGACTGGGATGCATTAGAAAGAGAATGCCTGGAAGAACA
ACTTATAATCAAAGAATGGAACTTTTCAGATTTAGCACCAATAAATGATT
ATGTTAATATAAAAGAAAATAATGGGCCTTTACTTTTAAATGGTATTCCG
GTACCCCCACCATTACCAACAAATTCTTTTGTTGTTCCCCCAGCTCCTCC
ATCTCCTTTTGCAGTTCCTCAAGCTCCATCCTTACCTAAACCTCCCGTAC
CATATTTAGTTTCTAAATTTCAAACTAAAACAGACAATTCTAAAACTGGA
GTTTCTGGATTTAATAAGCAAAAGCGCACAACGCGATTGCATTGGAAAAC
CTTTGGACCACAAGTTTCTAATGGAGACATTGGCTCAACAATCTGGTCAA
AAATGAAAAATGTGGATTTCGATTATGAAAGATTTGAATCACTCTTTGAA
AATAAACCACATGATTTTAAGATTTACATGAAGTTGGTCCTAAAAAACTT
GAAGTTCTCGATGTAAAACGGTCAAATGCTATAAATATAGGGATGAAAAA
TCTAGTATCGATTGACTGCATGAAAAATGCAATTTTAAATATGACTTCAA
GTGTTATTAATCGCGAAGGAGTTGAAAAACTTTTGAAAACAATGCTTCCT
ACTCAAGAAGAAATTGATAACATCAAAACCGCTCAAATAAATAATAAAGA
TGCTCAATTAGGTCAAGCTGAAAAATATTTATTAGATCTTCACGAAATTA
ATTTATTAGAAGAACGATTAGAAGTTTGGCTATTTCAGCTTGATTCCGAA
CAATTGGAAAGAGATATTCTTGAGCCCCTAATGGATTTAAAGTTAGGAAT
CAAAGAAATATATGATAGTGAAACTCTGATTTATGTTCTTTCAACCATAT
TAAAATTAGGAAATTTTCTTAATGAAACAAATGTAAGCGCATTTAGCTTA
GAATATTTGCAAAAAGTTCCAGAAGTAAAGGACACTAAACACAAGCACAG
TTTGCTTTATCACGTTGTTAGCCTGGTTGTTATTCAATATCCAAAAACTA
CAGATCTCCATTCTGAGTTAAGTGCTTTAAATAGATGTCATAGAGTAGAT
TGGGAAGAATTAGCAAGAAAATTGGATAAACTCGAAAAAGATATCAATAA
ATCTTGGAATCATTTAAAGTTAATTTTTAAATCAGATCAAAGTAGTCAGG
AAAATATTAAAAGGCATAAATTTTGCGGGTATTGTATGGCTTTGTGGCAG
GAGTGTTTCAACCCCAATGGGGGGATGTAGCGGAATCCCTGATTTCAACT
CGATGGTTAGAACAGTAAATAGAAATGATATAATCTTTGGTTTATCTAAT
GTTTATTAATCCATTCATATTCTACACATAAATGACTCTTCAAATAAGGA
CATTTAAACAT
back to top

protein sequence of SMED30010068-orf-1

>SMED30010068-orf-1 ID=SMED30010068-orf-1|Name=SMED30010068-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=246bp
MKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQIN
NKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLK
LGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKH
KHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKD
INKSWNHLKLIFKSDQSSQENIKRHKFCGYCMALWQECFNPNGGM*
back to top

protein sequence of SMED30010068-orf-2

>SMED30010068-orf-2 ID=SMED30010068-orf-2|Name=SMED30010068-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1334bp
MSYNYRKTGLAARDFGGSYYTPSNSSVKNYSTSTNNSMFRNYESSYPSKY
NTSKSYSRPISEQISKNSYGISGKYNTNEYNFEYKPIRKSIRDLSNSPSV
KYSSMRISETSPYSTYSSRQGSNSYLSDKDSSKYIPSSISSRESFISPSN
SYSIINRESVQKETQSKNKETIQSPKQSSFVSKYKRNNDDNVDDSLHKNE
VKQANESKYDMISKTSRGTCTYSNIFEDCDKECSLISRTRIRKYPKQNVR
IEMGSTVLVGSLTHIGKDISTQTSDDIFLPSPRIRPPSYKSGSSKGSIST
SSHYNRGLDNIKYTKTPKSSWKHHIAETIHSGVQKMEENMHFEDYSKSSS
REKLQSPKSPIHKRTTPVVSIKDSIEKVNEWQIQNQILESQSNSNRSPVP
RSPNYHDLHAVTKPFYQKKNATDENQMNEKKECSESNNKETKNVLHPLKE
NLYVTKYTDLDLLLEDQFIINKDCKKQNSNVKLNSYNSNLEDSTSLSNES
TLLFNSKASKEIFNSMPIELQHIIVKSKSRKIKFRELMDICRNENYMQKF
SDESERSFKGYTNASEMLIDLGLNIEKLENAVLQLCKFKDTQTEYGQFLD
FDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRR
ALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQL
MLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQE
LHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKV
LSFIPDQDTFYDVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKAL
RIEDGEKYLSVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQ
KLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK
HHENEESSLHQIIRRKIVNNEKPLERFKSLGNLYQEKRTKTLKSLPTSYS
PPSRPQSLLLDQNENAIFLENVLNTIRERITSTNSNDSIKAIKPEIRIHP
DSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAI
KNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLL
EPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIK
ENNGPLLLNGIPVPPPLPTNSFVVPPAPPSPFAVPQAPSLPKPPVPYLVS
KFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNV
DFDYERFESLFENKPHDFKIYMKLVLKNLKFSM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005865striated muscle thin filament
GO:0030017sarcomere
GO:0030018Z disc
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR015425FH2_Formin
IPR014768GBD/FH3_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
GO:0030837negative regulation of actin filament polymerization
GO:0045214sarcomere organization
GO:0051639actin filament network formation
GO:0055003cardiac myofibril assembly