APOBEC1 complementation factor

Overview
NameAPOBEC1 complementation factor
Smed IDSMED30010061
Length (bp)2415
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of APOBEC1 complementation factor (SMED30010061) t-SNE clustered cells

Violin plots show distribution of expression levels for APOBEC1 complementation factor (SMED30010061) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of APOBEC1 complementation factor (SMED30010061) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for APOBEC1 complementation factor (SMED30010061) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010061

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010061SMESG000032489.1 Contig5391GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30010061SMESG000032489.1 dd_Smed_v4_2228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30010061SMESG000032489.1 dd_Smed_v4_2228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010061SMESG000032489.1 dd_Smed_v4_2228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010061SMESG000032489.1 dd_Smed_v6_2228_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 369.777 bits (948), Expect = 1.016e-117
Identity = 187/364 (51.37%), Postives = 244/364 (67.03%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG------PAMGSWSNSLNI------LGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE R+M+DFNG NRGY F  +  K ++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F     G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK +  +  +       +   +   +    +DP T  +Y+G      P   +   SL+       L + +I   P  R AAG R 
Sbjct:   29 YSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTT--TYLGAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRG 387          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 369.777 bits (948), Expect = 1.016e-117
Identity = 187/364 (51.37%), Postives = 244/364 (67.03%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG------PAMGSWSNSLNI------LGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE R+M+DFNG NRGY F  +  K ++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F     G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK +  +  +       +   +   +    +DP T  +Y+G      P   +   SL+       L + +I   P  R AAG R 
Sbjct:   29 YSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTT--TYLGAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRG 387          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 369.777 bits (948), Expect = 1.016e-117
Identity = 187/364 (51.37%), Postives = 244/364 (67.03%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG------PAMGSWSNSLNI------LGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE R+M+DFNG NRGY F  +  K ++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F     G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK +  +  +       +   +   +    +DP T  +Y+G      P   +   SL+       L + +I   P  R AAG R 
Sbjct:   29 YSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTT--TYLGAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRG 387          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 369.007 bits (946), Expect = 2.205e-117
Identity = 171/281 (60.85%), Postives = 215/281 (76.51%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE R+M+DFNG NRGY F  +  K ++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F     G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK
Sbjct:   29 YSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: RBM47 (RNA binding motif protein 47 [Source:HGNC Symbol;Acc:HGNC:30358])

HSP 1 Score: 362.073 bits (928), Expect = 2.316e-117
Identity = 179/319 (56.11%), Postives = 232/319 (72.73%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG 1253
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FE +G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTEDT+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK    + +  +     + +  Q +     DP T L+Y G
Sbjct:   44 YSMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYT-LAYYG 358          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: hrp-2 (HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3KYC2])

HSP 1 Score: 228.409 bits (581), Expect = 7.737e-65
Identity = 121/274 (44.16%), Postives = 167/274 (60.95%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIG---DPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIAN-KNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWA 1124
            G R+FG PP DW G    P  +G E+++G IP D  ED L+P+FE  G I++ RLM+D  +G +RGY F  Y  KED+  A +  + +EI  GK + V  S+ N RLF+G IPK K+K+EI  E++    GVV+VI Y    N K KNRGF FV++  HK+A+  +RK+   +I  +   + VDWAE + E  E  MS VK+LY RN+    TE+ L E F       Y+ ++RVKK+KDYAFIHF ER     A E  N  E++G++VE + A
Sbjct:  177 GQRKFGGPPPDWEGPATGPAGQGHEIYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCNKEDAAAAAKTYDGHEISTGKPLKVNVSIANTRLFIGNIPKTKSKDEILEELKTHAEGVVDVIVYSVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEHQEEPDEDTMSKVKVLYIRNIKEAVTEEKLNELFKE-----YASLDRVKKVKDYAFIHFNERDDCLKAMEEWNGKELEGTVVEASLA 445          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: hrp-2 (HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3KYC2])

HSP 1 Score: 228.409 bits (581), Expect = 7.737e-65
Identity = 121/274 (44.16%), Postives = 167/274 (60.95%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIG---DPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIAN-KNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWA 1124
            G R+FG PP DW G    P  +G E+++G IP D  ED L+P+FE  G I++ RLM+D  +G +RGY F  Y  KED+  A +  + +EI  GK + V  S+ N RLF+G IPK K+K+EI  E++    GVV+VI Y    N K KNRGF FV++  HK+A+  +RK+   +I  +   + VDWAE + E  E  MS VK+LY RN+    TE+ L E F       Y+ ++RVKK+KDYAFIHF ER     A E  N  E++G++VE + A
Sbjct:  177 GQRKFGGPPPDWEGPATGPAGQGHEIYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCNKEDAAAAAKTYDGHEISTGKPLKVNVSIANTRLFIGNIPKTKSKDEILEELKTHAEGVVDVIVYSVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEHQEEPDEDTMSKVKVLYIRNIKEAVTEEKLNELFKE-----YASLDRVKKVKDYAFIHFNERDDCLKAMEEWNGKELEGTVVEASLA 445          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 73.9442 bits (180), Expect = 1.229e-13
Identity = 65/282 (23.05%), Postives = 120/282 (42.55%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLN-----------NYEIRPGKTIGVCFSVDNCRLFVGGIPK---NKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKL---IPGRIPL---WGQQIAVDWAEPER-------EVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATT 1148
            +++G +     ED +  +F  IG + + +++  F+G N  Y F  +     +++A++ +N           N+ + PG+      +  +  +FVG +     N+   E F     V+   V         N  K++G+ FV Y   + A  A  ++     GR  +   W  +   D  +P         E++         +Y  N+  + TED +R+ F  AS G  + + R+ KM+ YAF+ F  +  A  A   +NN ++ G +V  +W K  D   T
Sbjct:   48 LYVGNLDSTVTEDFIATLFNQIGSVTKTKVI--FDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKV-----IRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIA-SLTEDEIRQGF--ASFGRITEV-RIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGKTGDTGKT 318          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 67.0106 bits (162), Expect = 2.871e-11
Identity = 51/196 (26.02%), Postives = 95/196 (48.47%), Query Frame = 3
Query:  354 IGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCF--------------SVDNCRLFVGGIPKNKTKEEI------FMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGR-IPLWGQQIAVDWAEPERE 875
            + DP +   ++F+G+IPR+  E +L  +FE  G IYEF ++ D + G+++G  F  Y  ++ + R    L++ +  PG    +                 +D+ +LF+G + K ++++E+      F E+  VT     V+     A+K    G AFV+Y+    A +A   L   + +P     + V +A+ E+E
Sbjct:   23 VKDPDA--IKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDKMDDKKLFIGMLSKQQSEDEVRALFATFGELDEVT-----VLRGADGASK----GCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKE 207          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 65.4698 bits (158), Expect = 8.309e-11
Identity = 51/196 (26.02%), Postives = 95/196 (48.47%), Query Frame = 3
Query:  354 IGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCF--------------SVDNCRLFVGGIPKNKTKEEI------FMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGR-IPLWGQQIAVDWAEPERE 875
            + DP +   ++F+G+IPR+  E +L  +FE  G IYEF ++ D + G+++G  F  Y  ++ + R    L++ +  PG    +                 +D+ +LF+G + K ++++E+      F E+  VT     V+     A+K    G AFV+Y+    A +A   L   + +P     + V +A+ E+E
Sbjct:   23 VKDPDA--IKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDKMDDKKLFIGMLSKQQSEDEVRALFATFGELDEVT-----VLRGADGASK----GCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKE 207          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0113256)

HSP 1 Score: 287.73 bits (735), Expect = 1.444e-87
Identity = 142/285 (49.82%), Postives = 189/285 (66.32%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQS 1169
            G R++G PP  W G+ P  GCEVF GKIP+D  EDELIP+FE  G+I++ RLM+D   G NRGY F  +  +E +  AV +L+N+EI+PGK + +  SV N RLFVG IPK+K K+EI  E  ++T+G+  VI Y S  +K KNRGF F+EYESHK+A++A+R+L  GRI +WG  I VDWA+P+ E  E  MS VK+LY RNL    +ED L+E+F       Y  +ERVKK+KDYAFIHF +R  A  A   LN  EI  S +EV+ AKP      K+  +++
Sbjct:  149 GQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQ-----YGKVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRA 428          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0083961)

HSP 1 Score: 287.73 bits (735), Expect = 1.492e-87
Identity = 142/285 (49.82%), Postives = 189/285 (66.32%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQS 1169
            G R++G PP  W G+ P  GCEVF GKIP+D  EDELIP+FE  G+I++ RLM+D   G NRGY F  +  +E +  AV +L+N+EI+PGK + +  SV N RLFVG IPK+K K+EI  E  ++T+G+  VI Y S  +K KNRGF F+EYESHK+A++A+R+L  GRI +WG  I VDWA+P+ E  E  MS VK+LY RNL    +ED L+E+F       Y  +ERVKK+KDYAFIHF +R  A  A   LN  EI  S +EV+ AKP      K+  +++
Sbjct:  144 GQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQ-----YGKVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRA 423          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0083963)

HSP 1 Score: 288.115 bits (736), Expect = 2.823e-87
Identity = 142/285 (49.82%), Postives = 189/285 (66.32%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQS 1169
            G R++G PP  W G+ P  GCEVF GKIP+D  EDELIP+FE  G+I++ RLM+D   G NRGY F  +  +E +  AV +L+N+EI+PGK + +  SV N RLFVG IPK+K K+EI  E  ++T+G+  VI Y S  +K KNRGF F+EYESHK+A++A+R+L  GRI +WG  I VDWA+P+ E  E  MS VK+LY RNL    +ED L+E+F       Y  +ERVKK+KDYAFIHF +R  A  A   LN  EI  S +EV+ AKP      K+  +++
Sbjct:  186 GQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQ-----YGKVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRA 465          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0083958)

HSP 1 Score: 287.73 bits (735), Expect = 3.269e-87
Identity = 142/285 (49.82%), Postives = 189/285 (66.32%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQS 1169
            G R++G PP  W G+ P  GCEVF GKIP+D  EDELIP+FE  G+I++ RLM+D   G NRGY F  +  +E +  AV +L+N+EI+PGK + +  SV N RLFVG IPK+K K+EI  E  ++T+G+  VI Y S  +K KNRGF F+EYESHK+A++A+R+L  GRI +WG  I VDWA+P+ E  E  MS VK+LY RNL    +ED L+E+F       Y  +ERVKK+KDYAFIHF +R  A  A   LN  EI  S +EV+ AKP      K+  +++
Sbjct:  178 GQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQ-----YGKVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRA 457          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0334720)

HSP 1 Score: 287.345 bits (734), Expect = 5.438e-87
Identity = 142/285 (49.82%), Postives = 189/285 (66.32%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQS 1169
            G R++G PP  W G+ P  GCEVF GKIP+D  EDELIP+FE  G+I++ RLM+D   G NRGY F  +  +E +  AV +L+N+EI+PGK + +  SV N RLFVG IPK+K K+EI  E  ++T+G+  VI Y S  +K KNRGF F+EYESHK+A++A+R+L  GRI +WG  I VDWA+P+ E  E  MS VK+LY RNL    +ED L+E+F       Y  +ERVKK+KDYAFIHF +R  A  A   LN  EI  S +EV+ AKP      K+  +++
Sbjct:  144 GQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQ-----YGKVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRA 423          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: rbm47 (RNA binding motif protein 47 [Source:ZFIN;Acc:ZDB-GENE-030131-9612])

HSP 1 Score: 388.267 bits (996), Expect = 6.225e-125
Identity = 181/321 (56.39%), Postives = 240/321 (74.77%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE++G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNN+EIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+E+ LR+ F   + G   C+ERVKK++DYAF+HF  R  A  A ++LN +EI+GS +EVT AKP DK    + + +++    + + +++T Q Y    DP T L+Y G
Sbjct:   56 YGMVQENGQRKYGPPPGWQGTSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTQKHEAKRAVRELNNFEIRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEEILRQTFGQFNPG---CVERVKKIRDYAFVHFASRDDAVVAMDNLNGTEIEGSRIEVTLAKPVDKEQYTRYQ-KASKGTAAATTVESTQQSYVYQCDPYT-LAYYG 371          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: a1cf (apobec1 complementation factor [Source:ZFIN;Acc:ZDB-GENE-060824-3])

HSP 1 Score: 367.851 bits (943), Expect = 3.500e-117
Identity = 170/281 (60.50%), Postives = 216/281 (76.87%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            + +  +NG RR+G PP  W G PP RG E+F+GK+PRD  EDEL+P+ E  G IYE R+M+DFNG NRGY F  +  K+++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GV++VI YPS A+K KNRGFAFVEYE+H++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  M+TVKILY RNLML TTE+T+ ++F +   G    +ERVKK++DYAF+HF++R+ A NA  +LN   IDGS +EVT AKP DK
Sbjct:   29 YHIHQENGQRRYGGPPPGWEGSPPERGSEIFVGKLPRDLFEDELVPLCEKFGKIYEVRMMMDFNGNNRGYAFVTFSTKQEAKNAMKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILAEMKKVTDGVLDVIVYPSAADKAKNRGFAFVEYETHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMATVKILYVRNLMLPTTEETIEKEFNSIKPG---AVERVKKIRDYAFVHFSQREDAINAMNALNGKVIDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: a1cf (apobec1 complementation factor [Source:ZFIN;Acc:ZDB-GENE-060824-3])

HSP 1 Score: 367.851 bits (943), Expect = 3.500e-117
Identity = 170/281 (60.50%), Postives = 216/281 (76.87%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            + +  +NG RR+G PP  W G PP RG E+F+GK+PRD  EDEL+P+ E  G IYE R+M+DFNG NRGY F  +  K+++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GV++VI YPS A+K KNRGFAFVEYE+H++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  M+TVKILY RNLML TTE+T+ ++F +   G    +ERVKK++DYAF+HF++R+ A NA  +LN   IDGS +EVT AKP DK
Sbjct:   29 YHIHQENGQRRYGGPPPGWEGSPPERGSEIFVGKLPRDLFEDELVPLCEKFGKIYEVRMMMDFNGNNRGYAFVTFSTKQEAKNAMKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILAEMKKVTDGVLDVIVYPSAADKAKNRGFAFVEYETHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMATVKILYVRNLMLPTTEETIEKEFNSIKPG---AVERVKKIRDYAFVHFSQREDAINAMNALNGKVIDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: rbm46 (RNA binding motif protein 46 [Source:NCBI gene;Acc:566042])

HSP 1 Score: 346.665 bits (888), Expect = 6.529e-110
Identity = 175/306 (57.19%), Postives = 217/306 (70.92%), Query Frame = 3
Query:  249 NSRLTDSPPAKI---PNTCKFPVVHDNGHRRFGPPSDWIGDPPSRG-CEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQ 1154
            NSR+  S  A +    +   + +V +NG R+FG P      PP    CEVF+GKIPRD  EDEL+P+FE  G IYEFRLM++F+G NRGY F +Y  +E + RA++ L+NYEIRPGK IGVC S+DNCRLF+G IPK+K KEEI  EM +VT GV++VI YPS  ++ KNRGFAFVEYESHK+AA+ARRKLIPG   LWG  I VDWAEPE+E+ E  M  V++LY RNLML+TTE+TLR +F     G    +ERVKK+ DYAFIHF  R+ A  A ES+N   IDGS +EVT AKPA K   K+
Sbjct:   11 NSRMDSSKEAALLALMDRTGYSMVQENGQRKFGGPPPGWEGPPPPRGCEVFVGKIPRDMYEDELVPVFEQAGHIYEFRLMMEFSGENRGYAFVMYTTREKAQRAIQLLDNYEIRPGKFIGVCVSLDNCRLFIGSIPKDKKKEEIQEEMMKVTEGVMDVIVYPSAVDRMKNRGFAFVEYESHKAAAMARRKLIPGTFQLWGHTIQVDWAEPEKELDEETMQRVRVLYVRNLMLSTTEETLRSEFSQLKPG---SVERVKKLTDYAFIHFYNREDALTALESMNGKVIDGSPIEVTLAKPASKDGNKR 313          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: rbm46 (RNA binding motif protein 46 [Source:NCBI gene;Acc:566042])

HSP 1 Score: 344.739 bits (883), Expect = 2.469e-109
Identity = 170/286 (59.44%), Postives = 209/286 (73.08%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRG-CEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQ 1154
            + +V +NG R+FG P      PP    CEVF+GKIPRD  EDEL+P+FE  G IYEFRLM++F+G NRGY F +Y  +E + RA++ L+NYEIRPGK IGVC S+DNCRLF+G IPK+K KEEI  EM +VT GV++VI YPS  ++ KNRGFAFVEYESHK+AA+ARRKLIPG   LWG  I VDWAEPE+E+ E  M  V++LY RNLML+TTE+TLR +F     G    +ERVKK+ DYAFIHF  R+ A  A ES+N   IDGS +EVT AKPA K   K+
Sbjct:   18 YSMVQENGQRKFGGPPPGWEGPPPPRGCEVFVGKIPRDMYEDELVPVFEQAGHIYEFRLMMEFSGENRGYAFVMYTTREKAQRAIQLLDNYEIRPGKFIGVCVSLDNCRLFIGSIPKDKKKEEIQEEMMKVTEGVMDVIVYPSAVDRMKNRGFAFVEYESHKAAAMARRKLIPGTFQLWGHTIQVDWAEPEKELDEETMQRVRVLYVRNLMLSTTEETLRSEFSQLKPG---SVERVKKLTDYAFIHFYNREDALTALESMNGKVIDGSPIEVTLAKPASKDGNKR 300          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 378.252 bits (970), Expect = 8.211e-123
Identity = 181/323 (56.04%), Postives = 236/323 (73.07%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG 1253
            + +V +NG R++G PP  W G PP RGCEVF+GKIPRD  EDEL+P+FE+ G I+E RLM+DF+G NRGY F ++ KK ++ +AV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+EDT+++ F   + G   C+ERVKK++DYAF+HF+ R+ A  +   LN +E++GS +EVT AKP DK   T+  K        + +  + T   Y    DP T L+Y G
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQFNPG---CVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATEVTQPNYIYSCDPYT-LAYYG 362          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 379.793 bits (974), Expect = 1.610e-122
Identity = 181/323 (56.04%), Postives = 236/323 (73.07%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG 1253
            + +V +NG R++G PP  W G PP RGCEVF+GKIPRD  EDEL+P+FE+ G I+E RLM+DF+G NRGY F ++ KK ++ +AV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+EDT+++ F   + G   C+ERVKK++DYAF+HF+ R+ A  +   LN +E++GS +EVT AKP DK   T+  K        + +  + T   Y    DP T L+Y G
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQFNPG---CVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATEVTQPNYIYSCDPYT-LAYYG 362          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 381.719 bits (979), Expect = 2.104e-122
Identity = 189/356 (53.09%), Postives = 250/356 (70.22%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG-PAMGSWSNSLNILGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G PP  W G PP RGCEVF+GKIPRD  EDEL+P+FE+ G I+E RLM+DF+G NRGY F ++ KK ++ +AV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+EDT+++ F   + G   C+ERVKK++DYAF+HF+ R+ A  +   LN +E++GS +EVT AKP DK   T+  K        + +  + T   Y    DP T L+Y G P       + +     S+R +   R AAG+R+
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQFNPG---CVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATEVTQPNYIYSCDPYT-LAYYGYPYNALIGPNRDYFVKGSLRGR--GRGAAGNRS 393          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 379.407 bits (973), Expect = 6.531e-122
Identity = 181/323 (56.04%), Postives = 236/323 (73.07%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG 1253
            + +V +NG R++G PP  W G PP RGCEVF+GKIPRD  EDEL+P+FE+ G I+E RLM+DF+G NRGY F ++ KK ++ +AV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+EDT+++ F   + G   C+ERVKK++DYAF+HF+ R+ A  +   LN +E++GS +EVT AKP DK   T+  K        + +  + T   Y    DP T L+Y G
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQFNPG---CVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATEVTQPNYIYSCDPYT-LAYYG 362          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 380.178 bits (975), Expect = 1.093e-121
Identity = 181/323 (56.04%), Postives = 236/323 (73.07%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG 1253
            + +V +NG R++G PP  W G PP RGCEVF+GKIPRD  EDEL+P+FE+ G I+E RLM+DF+G NRGY F ++ KK ++ +AV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+EDT+++ F   + G   C+ERVKK++DYAF+HF+ R+ A  +   LN +E++GS +EVT AKP DK   T+  K        + +  + T   Y    DP T L+Y G
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQFNPG---CVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATEVTQPNYIYSCDPYT-LAYYG 362          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: A1cf (APOBEC1 complementation factor [Source:MGI Symbol;Acc:MGI:1917115])

HSP 1 Score: 357.066 bits (915), Expect = 8.298e-116
Identity = 177/320 (55.31%), Postives = 231/320 (72.19%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG 1253
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE RLM+DFNG NRGY F  +  K+++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARR+L+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F +   G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK +  +  +     N +   +        +DP T  +Y+G
Sbjct:   29 YSLVQENGQRKYGGPPPGWDSTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRTGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRNTMLQGEYTYPLSHVYDPTT--TYLG 343          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: Rbm47 (RNA binding motif protein 47 [Source:MGI Symbol;Acc:MGI:2384294])

HSP 1 Score: 360.918 bits (925), Expect = 2.127e-115
Identity = 172/281 (61.21%), Postives = 218/281 (77.58%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FET+G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K + EI  E+ +VT GV+NVI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTE+T+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDK 321          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: Rbm47 (RNA binding motif protein 47 [Source:MGI Symbol;Acc:MGI:2384294])

HSP 1 Score: 361.688 bits (927), Expect = 9.029e-115
Identity = 190/355 (53.52%), Postives = 247/355 (69.58%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIGPAMGSW--SNSLNILGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FET+G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K + EI  E+ +VT GV+NVI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTE+T+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK   ++  K        + +  Q  + +Y  DP T L+Y G    +    N    +   SIR +   R AAG+R 
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYT-LAYYGYPYNALIGPNRDYFVKTGSIRGR--GRGAAGNRT 392          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: Rbm47 (RNA binding motif protein 47 [Source:MGI Symbol;Acc:MGI:2384294])

HSP 1 Score: 361.688 bits (927), Expect = 9.029e-115
Identity = 190/355 (53.52%), Postives = 247/355 (69.58%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIGPAMGSW--SNSLNILGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FET+G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K + EI  E+ +VT GV+NVI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTE+T+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK   ++  K        + +  Q  + +Y  DP T L+Y G    +    N    +   SIR +   R AAG+R 
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYT-LAYYGYPYNALIGPNRDYFVKTGSIRGR--GRGAAGNRT 392          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: Rbm47 (RNA binding motif protein 47 [Source:MGI Symbol;Acc:MGI:2384294])

HSP 1 Score: 361.688 bits (927), Expect = 9.029e-115
Identity = 190/355 (53.52%), Postives = 247/355 (69.58%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIGPAMGSW--SNSLNILGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FET+G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K + EI  E+ +VT GV+NVI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTE+T+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK   ++  K        + +  Q  + +Y  DP T L+Y G    +    N    +   SIR +   R AAG+R 
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYT-LAYYGYPYNALIGPNRDYFVKTGSIRGR--GRGAAGNRT 392          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q5R9H4|A1CF_PONAB (APOBEC1 complementation factor OS=Pongo abelii OX=9601 GN=A1CF PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 5.830e-117
Identity = 187/364 (51.37%), Postives = 244/364 (67.03%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG------PAMGSWSNSLNI------LGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE R+M+DFNG NRGY F  +  K ++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F     G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK +  +  +       +   +   +    +DP T  +Y+G      P   +   SL+       L + +I   P  R AAG R 
Sbjct:   29 YSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKLEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTT--TYLGAPVFYAPQAYAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRG 387          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q9NQ94|A1CF_HUMAN (APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.059e-116
Identity = 171/281 (60.85%), Postives = 215/281 (76.51%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            + +V +NG R++G PP  W   PP RGCE+FIGK+PRD  EDELIP+ E IG IYE R+M+DFNG NRGY F  +  K ++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K +EEI  EM++VT GVV+VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  MS+VKILY RNLML+T+E+ + ++F     G    +ERVKK++DYAF+HF+ R+ A  A ++LN   +DGS +EVT AKP DK
Sbjct:   29 YSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPG---AVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q91WT8|RBM47_MOUSE (RNA-binding protein 47 OS=Mus musculus OX=10090 GN=Rbm47 PE=1 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 6.315e-114
Identity = 190/355 (53.52%), Postives = 247/355 (69.58%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIGPAMGSW--SNSLNILGDPSIRNKPVRRNAAGSRN 1349
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FET+G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K + EI  E+ +VT GV+NVI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTE+T+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK   ++  K        + +  Q  + +Y  DP T L+Y G    +    N    +   SIR +   R AAG+R 
Sbjct:   44 YTMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYSCDPYT-LAYYGYPYNALIGPNRDYFVKTGSIRGR--GRGAAGNRT 392          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q5R5P4|RBM47_PONAB (RNA-binding protein 47 OS=Pongo abelii OX=9601 GN=RBM47 PE=2 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 6.669e-114
Identity = 188/352 (53.41%), Postives = 245/352 (69.60%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAMGSW--SNSLNILGDPSIRNKPVRRNAAGSR 1346
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FE +G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTEDT+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK    + +  +     + +  Q +     DP T L+Y G    +    N    +   SIR +   R AAG+R
Sbjct:   44 YSMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYT-LAYYGYPYNALIGPNRDYFVKAGSIRGR--GRGAAGNR 389          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|A0AV96|RBM47_HUMAN (RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 6.669e-114
Identity = 188/352 (53.41%), Postives = 245/352 (69.60%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPP-SRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAMGSW--SNSLNILGDPSIRNKPVRRNAAGSR 1346
            + +V +NG R++G P      P   RGCEVF+GKIPRD  EDEL+P+FE +G IYE RLM+DF+G NRGY F +Y  K ++ RAV +LNNYEIRPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ TTEDT+++ F   + G   C+ERVKK++DYAF+HFT R+ A +A  +LN +E++GS +EVT AKP DK    + +  +     + +  Q +     DP T L+Y G    +    N    +   SIR +   R AAG+R
Sbjct:   44 YSMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPG---CVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYT-LAYYGYPYNALIGPNRDYFVKAGSIRGR--GRGAAGNR 389          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A4V3SFH3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004239 PE=4 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.002e-163
Identity = 250/462 (54.11%), Postives = 318/462 (68.83%), Query Frame = 3
Query:  297 KFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSN----LNELSLS-DLQATTQIYFDP-----------------NTGLSYIGPAMGSWSNSLNIL-------------------GDPSIRNKPV-RRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDI--DINGVKTPLFSAQVFLPNINTKQVTQVLYSTP 1550
            K+P+V +NG RR+GPP +W  +PP RGCEVFIGKIPRDC E+ELIP+FE IG IY FRLM++FNG NRGYGFCVY  +ED+ +AV+ L+NYEIR GKTIGVCFSVDNCRLFVGGIPKNKT+EEI  EM+RVT GV +VI+YPS+ +K+KNRGFAFVEYESHK+AA+ARRKL+PG+I LW QQIAVDWAEPEREV+E IMS VKILY RNLML+TTED LRE F+ A+GG  +CIERVKK+ DYAFIHF ER+ A    E+LN++ IDGS +EVTWAKP DK T    + QSN    LN+L+L  D++A   +  DP                 +  +S++ P +G    + +IL                   G P +    + RRNAAGSR++   +++K  +E LEE +    WG P ++    ++    +G K  L+  QV LPN+  +  T   Y+TP
Sbjct:   75 KYPIVQENGQRRYGPPRNWRAEPPPRGCEVFIGKIPRDCFEEELIPVFEQIGPIYMFRLMMEFNGTNRGYGFCVYTNREDTKKAVQALDNYEIRKGKTIGVCFSVDNCRLFVGGIPKNKTREEIMAEMKRVTEGVKDVISYPSVTDKSKNRGFAFVEYESHKAAAMARRKLMPGKIQLWNQQIAVDWAEPEREVNEDIMSKVKILYVRNLMLSTTEDGLREHFVCAAGGDPNCIERVKKISDYAFIHFKEREQAARCLEALNDTLIDGSKIEVTWAKPVDK-TEANARQQSNSGKLLNDLALGKDIRANNPLLLDPRANAAALAAVGGFMPHLDPAISFLLPPVGQQPVASDILSINPSALIPPGAGMSVGSPGGPRLNGTRMGRRNAAGSRSAGIQRDRKHPVEILEEQSRLAGWGPPNFSVLPVELIDSASGNKLQLYIGQVALPNLGMQCQTNRCYATP 535          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A4S2LX77 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004239 PE=4 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 2.471e-162
Identity = 250/462 (54.11%), Postives = 318/462 (68.83%), Query Frame = 3
Query:  297 KFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSN----LNELSLS-DLQATTQIYFDP-----------------NTGLSYIGPAMGSWSNSLNIL-------------------GDPSIRNKPV-RRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDI--DINGVKTPLFSAQVFLPNINTKQVTQVLYSTP 1550
            K+P+V +NG RR+GPP +W  +PP RGCEVFIGKIPRDC E+ELIP+FE IG IY FRLM++FNG NRGYGFCVY  +ED+ +AV+ L+NYEIR GKTIGVCFSVDNCRLFVGGIPKNKT+EEI  EM+RVT GV +VI+YPS+ +K+KNRGFAFVEYESHK+AA+ARRKL+PG+I LW QQIAVDWAEPEREV+E IMS VKILY RNLML+TTED LRE F+ A+GG  +CIERVKK+ DYAFIHF ER+ A    E+LN++ IDGS +EVTWAKP DK T    + QSN    LN+L+L  D++A   +  DP                 +  +S++ P +G    + +IL                   G P +    + RRNAAGSR++   +++K  +E LEE +    WG P ++    ++    +G K  L+  QV LPN+  +  T   Y+TP
Sbjct:   75 KYPIVQENGQRRYGPPRNWRAEPPPRGCEVFIGKIPRDCFEEELIPVFEQIGPIYMFRLMMEFNGTNRGYGFCVYTNREDTKKAVQALDNYEIRKGKTIGVCFSVDNCRLFVGGIPKNKTREEIMAEMKRVTEGVKDVISYPSVTDKSKNRGFAFVEYESHKAAAMARRKLMPGKIQLWNQQIAVDWAEPEREVNEDIMSKVKILYVRNLMLSTTEDGLREHFVCAAGGDPNCIERVKKISDYAFIHFKEREQAARCLEALNDTLIDGSKIEVTWAKPVDK-TEANARQQSNSGKLLNDLALGKDIRANNPLLLDPRANAAALAAVGGFMPHLDPAISFLLPPVGQQPVASDILSINPSALIPPGAGMSVGSPGGPRLNGTRMGRRNAAGSRSAGIQRDRKHPVEILEEQSRLAGWGPPNFSVLPVELIDSASGNKLQLYIGQVALPNLGMQCQTNRCYATP 535          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A4S2LX89 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004239 PE=4 SV=1)

HSP 1 Score: 494.582 bits (1272), Expect = 5.324e-160
Identity = 250/476 (52.52%), Postives = 318/476 (66.81%), Query Frame = 3
Query:  297 KFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSN----LNELSLS-DLQATTQIYFDP-----------------NTGLSYIGPAMGSWSNSLNIL-------------------GDPSIRNKPV-RRNAAGSRNSNSFKEKKQSI--------------EYLEELANTYNWGMPQYTASASDI--DINGVKTPLFSAQVFLPNINTKQVTQVLYSTP 1550
            K+P+V +NG RR+GPP +W  +PP RGCEVFIGKIPRDC E+ELIP+FE IG IY FRLM++FNG NRGYGFCVY  +ED+ +AV+ L+NYEIR GKTIGVCFSVDNCRLFVGGIPKNKT+EEI  EM+RVT GV +VI+YPS+ +K+KNRGFAFVEYESHK+AA+ARRKL+PG+I LW QQIAVDWAEPEREV+E IMS VKILY RNLML+TTED LRE F+ A+GG  +CIERVKK+ DYAFIHF ER+ A    E+LN++ IDGS +EVTWAKP DK T    + QSN    LN+L+L  D++A   +  DP                 +  +S++ P +G    + +IL                   G P +    + RRNAAGSR++   +++K  +              E LEE +    WG P ++    ++    +G K  L+  QV LPN+  +  T   Y+TP
Sbjct:   75 KYPIVQENGQRRYGPPRNWRAEPPPRGCEVFIGKIPRDCFEEELIPVFEQIGPIYMFRLMMEFNGTNRGYGFCVYTNREDTKKAVQALDNYEIRKGKTIGVCFSVDNCRLFVGGIPKNKTREEIMAEMKRVTEGVKDVISYPSVTDKSKNRGFAFVEYESHKAAAMARRKLMPGKIQLWNQQIAVDWAEPEREVNEDIMSKVKILYVRNLMLSTTEDGLREHFVCAAGGDPNCIERVKKISDYAFIHFKEREQAARCLEALNDTLIDGSKIEVTWAKPVDK-TEANARQQSNSGKLLNDLALGKDIRANNPLLLDPRANAAALAAVGGFMPHLDPAISFLLPPVGQQPVASDILSINPSALIPPGAGMSVGSPGGPRLNGTRMGRRNAAGSRSAGIQRDRKHPVEKLQQRQLNPFSYFEILEEQSRLAGWGPPNFSVLPVELIDSASGNKLQLYIGQVALPNLGMQCQTNRCYATP 549          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: G7Y9F5 (APOBEC1 complementation factor OS=Clonorchis sinensis OX=79923 GN=A1CF PE=4 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 2.014e-158
Identity = 250/476 (52.52%), Postives = 318/476 (66.81%), Query Frame = 3
Query:  297 KFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSN----LNELSLS-DLQATTQIYFDP-----------------NTGLSYIGPAMGSWSNSLNIL-------------------GDPSIRNKPV-RRNAAGSRNSNSFKEKKQSI--------------EYLEELANTYNWGMPQYTASASDI--DINGVKTPLFSAQVFLPNINTKQVTQVLYSTP 1550
            K+P+V +NG RR+GPP +W  +PP RGCEVFIGKIPRDC E+ELIP+FE IG IY FRLM++FNG NRGYGFCVY  +ED+ +AV+ L+NYEIR GKTIGVCFSVDNCRLFVGGIPKNKT+EEI  EM+RVT GV +VI+YPS+ +K+KNRGFAFVEYESHK+AA+ARRKL+PG+I LW QQIAVDWAEPEREV+E IMS VKILY RNLML+TTED LRE F+ A+GG  +CIERVKK+ DYAFIHF ER+ A    E+LN++ IDGS +EVTWAKP DK T    + QSN    LN+L+L  D++A   +  DP                 +  +S++ P +G    + +IL                   G P +    + RRNAAGSR++   +++K  +              E LEE +    WG P ++    ++    +G K  L+  QV LPN+  +  T   Y+TP
Sbjct:   75 KYPIVQENGQRRYGPPRNWRAEPPPRGCEVFIGKIPRDCFEEELIPVFEQIGPIYMFRLMMEFNGTNRGYGFCVYTNREDTKKAVQALDNYEIRKGKTIGVCFSVDNCRLFVGGIPKNKTREEIMAEMKRVTEGVKDVISYPSVTDKSKNRGFAFVEYESHKAAAMARRKLMPGKIQLWNQQIAVDWAEPEREVNEDIMSKVKILYVRNLMLSTTEDGLREHFVCAAGGDPNCIERVKKISDYAFIHFKEREQAARCLEALNDTLIDGSKIEVTWAKPVDK-TEANARQQSNSGKLLNDLALGKDIRANNPLLLDPRANAATLAAVGGFMPHLDPAISFLLPPVGQQPVASDILSINPSALIPPGAGMSVGSPGGPRLNGTRMGRRNAAGSRSAGIQRDRKHPVEKLQQRQLNPFSYFEILEEQSRLAGWGPPNFSVLPVELVDSASGNKLQLYIGQVALPNLGMQCQTNRCYATP 549          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A4S2LX84 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004239 PE=4 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 2.314e-158
Identity = 250/476 (52.52%), Postives = 318/476 (66.81%), Query Frame = 3
Query:  297 KFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSN----LNELSLS-DLQATTQIYFDP-----------------NTGLSYIGPAMGSWSNSLNIL-------------------GDPSIRNKPV-RRNAAGSRNSNSFKEKKQSI--------------EYLEELANTYNWGMPQYTASASDI--DINGVKTPLFSAQVFLPNINTKQVTQVLYSTP 1550
            K+P+V +NG RR+GPP +W  +PP RGCEVFIGKIPRDC E+ELIP+FE IG IY FRLM++FNG NRGYGFCVY  +ED+ +AV+ L+NYEIR GKTIGVCFSVDNCRLFVGGIPKNKT+EEI  EM+RVT GV +VI+YPS+ +K+KNRGFAFVEYESHK+AA+ARRKL+PG+I LW QQIAVDWAEPEREV+E IMS VKILY RNLML+TTED LRE F+ A+GG  +CIERVKK+ DYAFIHF ER+ A    E+LN++ IDGS +EVTWAKP DK T    + QSN    LN+L+L  D++A   +  DP                 +  +S++ P +G    + +IL                   G P +    + RRNAAGSR++   +++K  +              E LEE +    WG P ++    ++    +G K  L+  QV LPN+  +  T   Y+TP
Sbjct:   75 KYPIVQENGQRRYGPPRNWRAEPPPRGCEVFIGKIPRDCFEEELIPVFEQIGPIYMFRLMMEFNGTNRGYGFCVYTNREDTKKAVQALDNYEIRKGKTIGVCFSVDNCRLFVGGIPKNKTREEIMAEMKRVTEGVKDVISYPSVTDKSKNRGFAFVEYESHKAAAMARRKLMPGKIQLWNQQIAVDWAEPEREVNEDIMSKVKILYVRNLMLSTTEDGLREHFVCAAGGDPNCIERVKKISDYAFIHFKEREQAARCLEALNDTLIDGSKIEVTWAKPVDK-TEANARQQSNSGKLLNDLALGKDIRANNPLLLDPRANAAALAAVGGFMPHLDPAISFLLPPVGQQPVASDILSINPSALIPPGAGMSVGSPGGPRLNGTRMGRRNAAGSRSAGIQRDRKHPVEKLQQRQLNPFSYFEILEEQSRLAGWGPPNFSVLPVELIDSASGNKLQLYIGQVALPNLGMQCQTNRCYATP 549          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:103026221])

HSP 1 Score: 389.808 bits (1000), Expect = 1.965e-125
Identity = 183/321 (57.01%), Postives = 238/321 (74.14%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYF---DPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE +G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNNYE+RPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T+E+ LR+ F   + G   C+ERVKK++DYAF+HFT R  A  A ++LN +EI+GS +EVT AKP DK    + + +++    +L   + T Q Y    DP T L+Y G
Sbjct:   56 YRMVQENGQRKYGPPPGWQGPSPPRGCEIFVGKIPRDVYEDELVPVFEMVGRIYEMRLMMDFDGKNRGYAFVMYTQKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILDEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEEILRQTFGQFNPG---CVERVKKIRDYAFVHFTSRDDAVVAMDNLNGTEIEGSCIEVTLAKPVDKEQYTRYQ-KASKGSTALPSTETTQQNYLYQCDPYT-LTYYG 371          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: rbm46 (RNA binding motif protein 46 [Source:NCBI gene;Acc:566042])

HSP 1 Score: 358.607 bits (919), Expect = 1.117e-115
Identity = 169/281 (60.14%), Postives = 208/281 (74.02%), Query Frame = 3
Query:  300 FPVVHDNGHRRFG-PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            + +V +NG R+FG PP  W G PP RGCEVF+GKIPRD  EDEL+P+FE  G +YEFRLM++F+G NRGY F  Y  +E + RA+  L+NYEI PGK IGVC S+DNCRLF+G +PK+KTKEEI  EM +VT GVV+VI YPS  +K+KNRGFAFVEYESHK+AA+ARRKLIP    LWG  + V WAEPE++V E  M  V++LY RNLML TTE+TLR +F     G    +ERVKK+ DYAFIHF  R+ A  A+ES+N   IDGS +EV+ AKP  K
Sbjct:   26 YSMVQENGQRKFGGPPPGWEGLPPPRGCEVFVGKIPRDIYEDELVPVFERAGRMYEFRLMMEFSGENRGYAFVRYTTQEAAQRAINLLDNYEIHPGKFIGVCVSLDNCRLFIGSLPKDKTKEEIQEEMMKVTDGVVDVIVYPSTTDKSKNRGFAFVEYESHKAAAMARRKLIPETFQLWGHTLQVHWAEPEKDVDEETMQRVRVLYVRNLMLHTTEETLRLEFSRQKPG---SVERVKKLTDYAFIHFHSREDALAAQESMNGKLIDGSPIEVSLAKPVGK 303          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: ENSAMXT00000021508.2 (probable RNA-binding protein 46 [Source:NCBI gene;Acc:103038610])

HSP 1 Score: 329.717 bits (844), Expect = 1.435e-103
Identity = 165/297 (55.56%), Postives = 212/297 (71.38%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPS-RGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELS 1187
            + +V +NG R+FG P      PP  RGCE+F+GKIPRD  EDEL+P+FE  G IYEFRLM++F+G NRGY F  Y   E + +A+  L++YEIRPGK IGVC S++NCRLF+G IPK+  KEEI  EM +VT GVV+VI YPS A+K+ NRGFAFVEYESHK+AA+ARRKL+PG   +WG  I VDWAEPER V + IM  V++LY RNLML TTE+TL  +F     G    +ERVKK+ DYAFIHF  R+ A  AK+ +N   IDGS +EVT AKP+ K   ++   +++ N ++
Sbjct:   18 YGMVQENGQRKFGGPPPDWEGPPPPRGCEIFVGKIPRDMYEDELVPLFERAGCIYEFRLMMEFSGENRGYAFVRYTTPEAAQQAIYLLDHYEIRPGKFIGVCVSLNNCRLFIGSIPKDMKKEEIQEEMMKVTDGVVDVIVYPSAADKSMNRGFAFVEYESHKAAAMARRKLVPGTFQMWGHTIQVDWAEPERNVDDEIMQKVRVLYVRNLMLHTTEETLCSEFSRLKPG---SVERVKKLSDYAFIHFHSREDALTAKQFMNGKLIDGSQIEVTLAKPSSKDRNRRFNTRASRNGIA 311          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: a1cf (apobec1 complementation factor [Source:ZFIN;Acc:ZDB-GENE-060824-3])

HSP 1 Score: 308.531 bits (789), Expect = 9.464e-95
Identity = 150/248 (60.48%), Postives = 185/248 (74.60%), Query Frame = 3
Query:  396 KIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADK 1139
            KI    L+  L  I    G +YE R+M+DFNG NRGY F  +  K+++  A+++LNNYEIR G+ +GVC SVDNCRLFVGGIPK K KEEI  EM++VT GVV VI YPS A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG  IAVDWAEPE EV E  M+TVKILY RNLML TTE+T+ ++F +   G    +ERVKK++DYAF+HF++R+ A  A  +LN   IDGS +EVT AKP DK
Sbjct:   41 KITCGLLKYCLFFISLQFGKLYEVRMMMDFNGNNRGYAFVTFTTKQEAKNAMKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKKEEILAEMKKVTDGVVEVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHAIAVDWAEPEVEVDEDTMATVKILYVRNLMLATTEETIEKEFNSIKPG---AVERVKKIRDYAFVHFSQREDAITAMNALNGKIIDGSPIEVTLAKPVDK 285          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: syncrip (heterogeneous nuclear ribonucleoprotein Q [Source:NCBI gene;Acc:103047758])

HSP 1 Score: 287.73 bits (735), Expect = 2.535e-86
Identity = 149/320 (46.56%), Postives = 206/320 (64.38%), Query Frame = 3
Query:  246 QNSRLTDSPPAKIPNTCKFPVVHD---------NGHRRFG---PPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQ 1166
            Q +++TDS   K P+  K   + +          G R++G   P S +IG  P+ G E+F+GKIPRD  EDEL+P+FE  G I++ RLM+D  +G+NRGY F  +  KE +  AV+  NN+EIRPGK IGVC SV N RLFVG IPKNKTKE+I  E  +VT G+ +VI Y    +K KNRGF F+EYE HK+AA ARR+L+ G++ +WG  + V+WA+P  +    +M+ VK+L+ RNL  + TE+ L + F     G +  +ERVKK+KDYAFIHF ER  A  A E LN  +++G  +E+ +AKP D+   K+ K Q
Sbjct:  107 QGTKVTDS--NKGPDETKIKALLERTSYTLDVTTGQRKYGGPPPESVYIGTQPTIGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLSGLNRGYAFVTFCTKEAALEAVKLCNNHEIRPGKQIGVCISVANNRLFVGSIPKNKTKEQIVEEFAKVTEGLNDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVVTVEWADPIEDPDPEVMAKVKVLFVRNLANSVTEEILEKSF-----GQFGKLERVKKLKDYAFIHFDERDGAVKALEELNGKDLEGENIEIVFAKPPDQ-KRKERKAQ 418          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: syncripl (synaptotagmin binding, cytoplasmic RNA interacting protein, like [Source:ZFIN;Acc:ZDB-GENE-030131-3104])

HSP 1 Score: 262.692 bits (670), Expect = 8.676e-78
Identity = 140/335 (41.79%), Postives = 199/335 (59.40%), Query Frame = 3
Query:  177 EQFPSLYSNSINNNSQYVLSNNIQNSRLTDSPPAKIPNTCKFP---------------VVHDNGHRRFG-PPSD--WIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWA 1124
            +QF     + + N S + L   ++  R  +    K P T K P               +    G R++G PP D  + G  P  G EVF+GKIPRD  ED L+P+FE  G I++ RLM+D   G+NRGY F  Y  K+ +  AV+  +NYEIRPGK +GVC SV N RLFVG IPK+KTKE+I  E Q +T G+ +VI Y  + +K +NRGF F+E+E HK+AA ARR+L+ G+I ++G  ++V+WA+P  E    IMS VK+L+ RNL    TE+ L++ F       +  +ERVKK+KDYAF+HF +R  A  A + +N   ++G  + +  A
Sbjct:   86 QQFKESDLSHVQNKSAF-LCGVMKTYRQREKQGGKAPETNKGPDEAKIKELLERTGYTLDVTTGQRKYGGPPPDPVYSGPQPGTGTEVFVGKIPRDLFEDTLVPLFEKAGPIWDLRLMMDPLTGLNRGYAFLTYCSKDAALEAVKLCDNYEIRPGKHVGVCLSVANNRLFVGSIPKSKTKEQIMEEFQDITEGLTDVILYQQVEDKRRNRGFCFLEFEDHKTAAQARRRLMSGKIKVFGIPVSVEWADPIEEPDPEIMSKVKVLFVRNLASAVTEEILQDTFSV-----FGKLERVKKLKDYAFVHFEDRDDAVKAMDEMNGKPLEGEPLVIVLA 414          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009756.1 (pep scaffold:Pmarinus_7.0:GL478948:7772:26420:1 gene:ENSPMAG00000008818.1 transcript:ENSPMAT00000009756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.121 bits (614), Expect = 1.093e-73
Identity = 128/284 (45.07%), Postives = 173/284 (60.92%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGG-------PYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKP 1130
            + ++ +NG R+FGPP DW G PP+RGCEVF+GKIPRD  EDEL+P+ ET+G +Y  RLM++F+G NRGY F  Y  +  +  A++KLNN+EIRPG  IGVC SVDNCRL++GG+PK+KT+EE+ + M   T GVV+V       +K +NRG+AFVEYESH++AA+ARRKL+P    LWG  I VDWA+P+R+    + +T K                R     A GG       P           D A +HF  R  A  A  +L  + + G+ V    A+P
Sbjct:   14 YNMIQENGQRKFGPPPDWQGPPPARGCEVFLGKIPRDLYEDELVPVLETVGKLYLLRLMMEFSGENRGYAFATYTTRTHAEDAIKKLNNFEIRPGCAIGVCISVDNCRLYIGGLPKDKTQEEVMLAMSCATMGVVDVKMSVCPTDKTRNRGYAFVEYESHRAAAMARRKLVPETFELWGHTIKVDWADPKRDT-AVVAATEKEASTPGSRRGRVPPPPRRLPDGAPGGAVVEATAPEPLQPERAGAGDAALLHFGSRGDAATALRTLRGAALLGAQVRAAAAEP 296          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003808.1 (pep scaffold:Pmarinus_7.0:GL483076:13225:15644:1 gene:ENSPMAG00000003482.1 transcript:ENSPMAT00000003808.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 6.007e-62
Identity = 98/173 (56.65%), Postives = 133/173 (76.88%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPG 818
            + ++ +NG R+FGPP DW G PP+RGCEVF+GKIPRD  EDEL+P+ ET+G +Y+ RLM++F+G NRGY F  Y  +  +  A++KLNN+EIRPG   GVC SVDNCRL++GG+PK+K +EE+ + M   T GVV+V       +K +NRG+AFVEYESH++AA+ARRKL+PG
Sbjct:   17 YNMIQENGQRKFGPPPDWQGPPPARGCEVFLGKIPRDLYEDELVPVLETVGRLYQLRLMMEFSGENRGYAFATYTTRH-AVAAIKKLNNFEIRPGHPFGVCISVDNCRLYIGGLPKDKKQEEVMLAMSCATMGVVDVKMSVCPTDKTRNRGYAFVEYESHRAAAMARRKLVPG 188          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 55.0694 bits (131), Expect = 5.113e-8
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQ----RVTSGVVNVIAYPSIANK--NKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKP 1130
            +F+  I      + L   FE  G + E R+ +  NG +RG  +  +  +ED+  A+++    ++  G+ + + +  D         P++ T     +  Q     + S   N  A   + ++   K RG AFV++ S   A  A +      +   G+ I ++++ P      +  S+   L+ R L   T+EDTL + F  A+           + K YA++ F+    A++A  ++   EIDGS + V +A+P
Sbjct:  374 LFVKNIAWSSTVESLTEAFE--GAV-EVRIPLGPNGKSRGIAYVEFPSEEDAEAAMKEYQGADVD-GRAVLLDYVGDKSNKAKPQGPESNTLMVRNLSFQADEDSLRSVFENAEAVRVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSGAEVE--GRAIRLEFSTPRGTPGPSEASST--LFVRGLGEDTSEDTLMDSFEGATAARIVTDRDSGQSKGYAYVDFSSADEAKSALNAMKGVEIDGSQIYVDFARP 620          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 54.6842 bits (130), Expect = 5.805e-8
Identity = 77/336 (22.92%), Postives = 125/336 (37.20%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRL----FVGGIPKNKTKEEIFMEMQRVTSGVVNV------------------------IAYPSIANK-NKNRGFAFVEYESHKSAAVARRKL----IPGRIPLWG--QQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKM------KDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWA--KPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAM 1262
            VFI  + +      +   F   G I   +++ D NG +RGYGF  ++ +E ++RA+EK+N   +             N RL    FVG     K +E+   EM        NV                        ++   ++++  K+RGF FV +E H+ A  A  ++    + GR    G  Q+     AE +R+        +      NL +   +D + ++ L     PY  I   K M      K + F+ F+  + A  A   +N   +    + V  A  K   KA      +Q      +L       Q  + P     Y  PAM
Sbjct:  101 VFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETQEAADRAIEKMNGMLL-------------NDRLARRRFVGRFKSRKEREQ---EMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTSQYMQRIAGMRALPPSTVIGQ--YQPAAPSGYFMPAM 417          
BLAST of APOBEC1 complementation factor vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 59.3066 bits (142), Expect = 1.568e-9
Identity = 69/263 (26.24%), Postives = 115/263 (43.73%), Query Frame = 3
Query:  378 CEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRL---FVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANK--NKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAV--DWAEPEREVH-ETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVK----KMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAK 1127
              +++G +     E  L  IF  IG +   R+  D     + GY +  +   E   +A+E+LN   I+ G+   + +S  +  L     G I       +I  +    T  V   I    IA     K++GF FV +E   +A  A   L    + L GQ+I V    +  ER+   E   +    LY +N+   TT++  +E F  A  GP       K    K+K + F+++ + + A  A E+LN+SE++G  + V  A+
Sbjct:   38 ASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIK-GRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDAL--NGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELF--AKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295          

HSP 2 Score: 53.1434 bits (126), Expect = 1.090e-7
Identity = 63/283 (22.26%), Postives = 108/283 (38.16%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDN--------------CRLFVGGIPKNKTKE---EIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETI--------MSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKM-------KDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPAD 1136
            +FI  +  D     L   F   G I   ++  D NG ++G+GF  ++++  +  A++ LN   +  G+ I V   +                  L+V  I    T E   E+F +   + S  +   A        K +GF FV YE H+ A  A   L      L G+++ V  A+ + E    +        +  +      NL +   +D++ ++ L     PY  I   K M       K + F+ F+  + A  A    N   + G  + V  A+  D
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLN-GQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA------DGKLKGFGFVNYEKHEDAVKAVEALNDSE--LNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 401          
BLAST of APOBEC1 complementation factor vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 55.8398 bits (133), Expect = 1.874e-8
Identity = 46/171 (26.90%), Postives = 77/171 (45.03%), Query Frame = 3
Query:  378 CEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEK---LNNYEIRPGKTIGVCFSVDNCRLFVGGIPKN---KTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAA-VARRKLIPGRIPLWGQQIAVDWAEP 866
            C++FIG +  D  ED L   F   G + + ++M D   G +RG+GF  ++K    +  V+    L+   I P + I         ++FVGGI  +   K  EE F +   +    + +       +  ++RGF FV Y+S  +   V + K     I    ++I +  AEP
Sbjct:  159 CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDK-----DTGQSRGFGFVTYDSADAVDRVCQNKF----IDFKDRKIEIKRAEP 320          
BLAST of APOBEC1 complementation factor vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 49.2914 bits (116), Expect = 1.852e-6
Identity = 43/166 (25.90%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKT-IGVCF------SVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWA 860
            +++G + +   ED L   F+  G I   ++M+D N  N  Y F  Y +  D+N A++ LN  +I      I   F      S D   LFVG +  N   E +    +   S +   + +        +RG+ FV + S   A  A   +  G+  L G+ + ++WA
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWD--MQTGSSRGYGFVSFTSQDDAQNAMDSM-QGQ-DLNGRPLRINWA 238          

HSP 2 Score: 48.1358 bits (113), Expect = 4.249e-6
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  903 KILYARNLMLTTTEDTLREKFLTASGGPYS----CIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWA 1124
            ++LY  NL    TED L++ F    GGP +     I++  K  +YAF+ + +   A  A ++LN  +I+ +IV++ WA
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQV--GGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWA 150          
BLAST of APOBEC1 complementation factor vs. Ensembl Yeast
Match: RNA15 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability [Source:SGD;Acc:S000003012])

HSP 1 Score: 48.1358 bits (113), Expect = 2.465e-6
Identity = 26/85 (30.59%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  324 HRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEI 575
            +R+ G  +    +PPSR   V++G IP D  E++++ +   +G +   ++M D   G ++GY F  ++  E S  AV  LN Y++
Sbjct:    2 NRQSGVNAGVQNNPPSR--VVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQL 84          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO46547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ1])

HSP 1 Score: 373.244 bits (957), Expect = 3.377e-122
Identity = 196/408 (48.04%), Postives = 250/408 (61.27%), Query Frame = 3
Query:  297 KFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNINTK 1520
            KFP+   NG RR+GPP  W    P RGCEVF+GKIPRD  EDEL+P+FET G IYE RLM+DFNG NRGY F VY  K+D+ R V+ LNNYEIR GK IGVC SVDNCRLFVGGIPK   K+EI  E+ +VT  VV+VI YPS  +K KNRGFAFVEY SH+ AA+ARRKL+ G+I LWG QIAVDWAEPE+EV + IM  VK+LYARNL+L+TTE+T+ + F       +  +ERVKK+KDY FIHF  ++ A +A E++N +E+DG+ +EVT AKP DK                            D  + L + G             G PS+R                + + K+S E LE++     WG P YT  ++   +   +  LF  +V +P + T+
Sbjct:   30 KFPIRQCNGQRRYGPPPGWDRPIPPRGCEVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFNGQNRGYAFVVYTSKDDAKRCVKTLNNYEIRKGKCIGVCSSVDNCRLFVGGIPKKVKKDEIMAEVSKVTDNVVDVIVYPSAQDKTKNRGFAFVEYISHRDAAMARRKLMTGKIQLWGHQIAVDWAEPEQEVDQEIMDQVKVLYARNLLLSTTEETIEQAF-----SKFGEVERVKKIKDYCFIHFRTKEQARDAMEAMNETELDGNEIEVTLAKPVDK----------------------------DHRSPLLFRG-----------YYGTPSMR-------------PGFYGDYKKSQEILEDVCQKNQWGSPVYTLHST---LGPQEVQLFLYKVSIPGLATQ 377          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO38763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC28])

HSP 1 Score: 300.442 bits (768), Expect = 4.715e-92
Identity = 143/278 (51.44%), Postives = 193/278 (69.42%), Query Frame = 3
Query:  321 GHRRFG-PPSDWIGDPPSRGCE-----VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQ-QIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKP 1130
            G R++G PP  W G PP  G E     VFIGK+PRDC EDELIP+FE  G IY+FRLM+D  +G+ +G+ FC +  K+++  AV+KL+N EIRPGK +GVC SV N RLFVG IPK K+K+EI  E  +VT+G+ +VI Y S   K KNRGFAF+EYESH++A++ARR+L  GRI +WG   + VDWA+P+ E  +  M  VK++Y RNL  + TE+ L+E++       Y  ++RVKK+KDYAF+HFTER +A  A E  +  E+DG  +E + AKP
Sbjct:  127 GQRKYGGPPPGWEGKPPGTGSEKVCSQVFIGKVPRDCFEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAVKKLDNKEIRPGKRLGVCISVANSRLFVGSIPKTKSKQEILEEFSKVTNGLDDVIVYLSADQKGKNRGFAFLEYESHQAASLARRRLASGRIKVWGNIVVTVDWADPQEEPDDDAMKKVKVVYLRNLSPSITEEKLKEEYSQ-----YGAVDRVKKLKDYAFVHFTERDHALKAIEETDGKEMDGLKIEASLAKP 399          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO38734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC26])

HSP 1 Score: 221.09 bits (562), Expect = 4.303e-65
Identity = 113/257 (43.97%), Postives = 161/257 (62.65%), Query Frame = 3
Query:  375 GCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNK---NRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQI-AVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKP 1130
            G EVFIGKIPRDCLEDELIP+ E  G I EFRL +D   G+N+G+ FC + K+  + +A+  LN+ +IRPG+ + +C S  N RLFV GIPK K+KEEIF E  +VT+ + +VI Y S    N    NRGF F+EY ++ + A A  +   G++ +WG+ + AV WAE        +MS VK +Y RN+ L  +E  L+  F       Y  IE+V+K++DY F++F +R+ A  A + +N + IDG  +EV+ A P
Sbjct:  109 GTEVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTKQTSAYQAITTLNDKDIRPGRRLAICKSRSNSRLFVKGIPKRKSKEEIFQEFSKVTTDLQDVIVYQSCDQGNHGDLNRGFVFLEYANYIAGASALHRFTDGKVRIWGKVLEAVTWAEAREIPDYAVMSKVKSIYVRNVPLPMSETQLKAVFTK-----YGQIEKVRKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLAIP 360          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO50067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA9])

HSP 1 Score: 57.7658 bits (138), Expect = 5.493e-10
Identity = 38/136 (27.94%), Postives = 67/136 (49.26%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAA 791
            VF+G +     E+ L   FE  G +   R+M  F G +R YGF +++   D   + E L    +  GKT+ V  S +   ++VGG+P + T++ +    ++   GV+  + +    +     G+AFV + S + AA
Sbjct:    3 VFVGGLASGTDEEGLKDYFEQFGEVESVRIMRTFLGYSRNYGFVLFK---DDGPSKEVLKKSHVINGKTVDVGKSRNFRVIYVGGLPSHFTEQTVREHFKKF--GVIEAVKFIENTSVGAKTGYAFVTFSSTEEAA 133          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 57.7658 bits (138), Expect = 6.785e-9
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 3
Query:  384 VFIGKIPRDCLEDELIPIFETIGLIYEFRLMVD-FNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFS------VDNCRLFVGGIPKNKTKEEI---FMEMQR-VTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEP 866
            + I  +P    ++++  IF T+G +   +L+ D   G + GY F  Y   +D+N+AV ++N   ++  KT+ V F+      + N  L++ G+PK+  +EE+   F    + +TS V+  ++        + RG  FV ++    A  A   L    +P    ++ V +A P
Sbjct:   12 LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQ-NKTLKVSFARPSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVS-------GEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVKFANP 175          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 389.808 bits (1000), Expect = 2.319e-126
Identity = 182/319 (57.05%), Postives = 234/319 (73.35%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE++G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNNYE+RPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T E+T+R+ F   + G   C+ERVKK++DYAF+HFT R  A  A ++LN +EI+GS +EVT AKP DK    + K        +    Q    +Y  DP T L+Y G
Sbjct:   57 YTMVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQWNPG---CVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPATPEATQQQNYVYQCDPYT-LAYYG 371          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 391.349 bits (1004), Expect = 5.564e-126
Identity = 182/319 (57.05%), Postives = 234/319 (73.35%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE++G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNNYE+RPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T E+T+R+ F   + G   C+ERVKK++DYAF+HFT R  A  A ++LN +EI+GS +EVT AKP DK    + K        +    Q    +Y  DP T L+Y G
Sbjct:   57 YTMVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQWNPG---CVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPATPEATQQQNYVYQCDPYT-LAYYG 371          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 391.349 bits (1004), Expect = 5.564e-126
Identity = 182/319 (57.05%), Postives = 234/319 (73.35%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE++G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNNYE+RPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T E+T+R+ F   + G   C+ERVKK++DYAF+HFT R  A  A ++LN +EI+GS +EVT AKP DK    + K        +    Q    +Y  DP T L+Y G
Sbjct:   57 YTMVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQWNPG---CVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPATPEATQQQNYVYQCDPYT-LAYYG 371          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 391.349 bits (1004), Expect = 5.564e-126
Identity = 182/319 (57.05%), Postives = 234/319 (73.35%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE++G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNNYE+RPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T E+T+R+ F   + G   C+ERVKK++DYAF+HFT R  A  A ++LN +EI+GS +EVT AKP DK    + K        +    Q    +Y  DP T L+Y G
Sbjct:   57 YTMVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQWNPG---CVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPATPEATQQQNYVYQCDPYT-LAYYG 371          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 391.349 bits (1004), Expect = 5.564e-126
Identity = 182/319 (57.05%), Postives = 234/319 (73.35%), Query Frame = 3
Query:  300 FPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIY-FDPNTGLSYIG 1253
            + +V +NG R++GPP  W G  P RGCE+F+GKIPRD  EDEL+P+FE++G IYE RLM+DF+G NRGY F +Y +K ++ RAV +LNNYE+RPG+ +GVC SVDNCRLF+GGIPK K +EEI  E+ +VT GV++VI Y S A+K KNRGFAFVEYESH++AA+ARRKL+PGRI LWG QIAVDWAEPE +V E +M TVKILY RNLM+ T E+T+R+ F   + G   C+ERVKK++DYAF+HFT R  A  A ++LN +EI+GS +EVT AKP DK    + K        +    Q    +Y  DP T L+Y G
Sbjct:   57 YTMVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQWNPG---CVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPATPEATQQQNYVYQCDPYT-LAYYG 371          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000032489.1 (SMESG000032489.1)

HSP 1 Score: 1242.25 bits (3213), Expect = 0.000e+0
Identity = 662/664 (99.70%), Postives = 663/664 (99.85%), Query Frame = 3
Query:  165 MADYEQFPSLYSNSINNNSQYVLSNNIQNSRLTDSPPAKIPNTCKFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNINTKQVTQVLYSTPXXXXXXXXXXXXXXXTQPPSHFNGLDMRQQMAALLNLXXXXXXXXXXXXXXXXXXMDLNNXXXXXXXXXSLYYLQPGLTNSALFHPNSLLSSPQTNPLNLAAFSSLYSSPNANMSSVISTSNREMNALNNLFNPNGLGILQSPNSIPLLSMNLELNNGEMMDNSVIRNALIANQQQNFLYXXXXXXXXXXXXILMGQQVPSQ 2156
            MADYEQFPSLYSNSINNNSQYVLSNNIQNSRLTDSPPAKIPNTCKFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNINTKQVTQVL+STPEEAKAAAAELFIKAATQPPSHFNGLDMRQQMAALLNLSNIISPQTQQINPN QTSMDLNNAAAIAAAGASLYYLQPGLTNSALFHPNSLLSSPQTNPLNLAAFSSLYSSPNANMSSVISTSNREMNALNNLFNPNGLGILQSPNSIPLLSMNLELNNGEMMDNSVIRNALIANQQQNFLYNNSQQSLNDQNNILMGQQVPSQ
Sbjct:    1 MADYEQFPSLYSNSINNNSQYVLSNNIQNSRLTDSPPAKIPNTCKFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIGPAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNINTKQVTQVLHSTPEEAKAAAAELFIKAATQPPSHFNGLDMRQQMAALLNLSNIISPQTQQINPNQQTSMDLNNAAAIAAAGASLYYLQPGLTNSALFHPNSLLSSPQTNPLNLAAFSSLYSSPNANMSSVISTSNREMNALNNLFNPNGLGILQSPNSIPLLSMNLELNNGEMMDNSVIRNALIANQQQNFLYNNSQQSLNDQNNILMGQQVPSQ 664          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000044930.1 (SMESG000044930.1)

HSP 1 Score: 510.375 bits (1313), Expect = 7.368e-171
Identity = 256/438 (58.45%), Postives = 318/438 (72.60%), Query Frame = 3
Query:  210 NNNSQYVLSNNIQNSRLTDSPPA--KIPNTCKFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG-PAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNI 1511
            N+N   V   + QN+ +  S  A  K+ N   +P+V +NG RR+GPP DW G PP RGCEVFIGKIPRDC EDEL+P+FE IG IY FRLM+DF G NRGYGFC+Y  +ED+ RAV +LNN+EIR  K +GVC SVDNCRLFVGGIPKNKTKEEIF+EM RVT GV +VIAYPS+A+K KNRGFAFVEYESHK+AA+ARRKLIPGRI LWGQQIAVDWAEPEREV+E IMSTVKILY RNLMLTTTE+T+REKF+  S GP  C+ERVKK+KDYAF+HF +R  A+NA ++LNN++ID S +EV WAKPADK   +K   + SN +  S  DL   +QI+ D ++G+SYIG P     S +++       R K  RRNAAG R+    +E+K S E  +E  N+ NW +  +  +  +  +NGVK      Q+  P++
Sbjct:   19 NDNLSVVSKQDNQNAAVLSSAEALVKLLNRTMYPIVQENGQRRYGPPPDWKGFPPRRGCEVFIGKIPRDCFEDELVPVFERIGPIYMFRLMMDFTGTNRGYGFCIYMNREDTKRAVAELNNFEIRRDKPLGVCLSVDNCRLFVGGIPKNKTKEEIFIEMVRVTEGVKDVIAYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSTVKILYVRNLMLTTTEETIREKFVACSNGPPDCVERVKKIKDYAFVHFKDRNLADNALKALNNTQIDSSWIEVNWAKPADKTEPSKVKAVTSNGDPSSSQDLFQQSQIFIDSSSGISYIGAPISTIHSQNISSSSSSPSRIKSGRRNAAGYRSVTISRERKVS-ETGDEGHNSDNW-VNSHQMNKCEWMVNGVKYQYIPTQIMYPSV 454          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000044930.1 (SMESG000044930.1)

HSP 1 Score: 508.064 bits (1307), Expect = 4.563e-170
Identity = 254/438 (57.99%), Postives = 316/438 (72.15%), Query Frame = 3
Query:  210 NNNSQYVLSNNIQNSRLTDSPPA--KIPNTCKFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG-PAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNI 1511
            N+N   V   + QN+ +  S  A  K+ N   +P+V +NG RR+GPP DW G PP RGCEVFIGKIPRDC EDEL+P+FE IG IY FRLM+DF G NRGYGFC+Y  +ED+ RAV +LNN+EIR  K +GVC SVDNCRLFVGGIPKNKTKEEIF+EM RVT GV +VIAYPS+A+K KNRGFAFVEYESHK+AA+ARRKLIPGRI LWGQQIAVDWAEPEREV+E IMSTVKILY RNLMLTTTE+T+REKF+  S GP  C+ERVKK+KDYAF+HF +R  A+NA ++LNN++ID S +EV WAKPADK   +K   + SN +  S  DL   +QI+ D ++G+SYIG P     S +++       R K  RRNAAG R+    +E+K      +E  N+ NW +  +  +  +  +NGVK      Q+  P++
Sbjct:   19 NDNLSVVSKQDNQNAAVLSSAEALVKLLNRTMYPIVQENGQRRYGPPPDWKGFPPRRGCEVFIGKIPRDCFEDELVPVFERIGPIYMFRLMMDFTGTNRGYGFCIYMNREDTKRAVAELNNFEIRRDKPLGVCLSVDNCRLFVGGIPKNKTKEEIFIEMVRVTEGVKDVIAYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSTVKILYVRNLMLTTTEETIREKFVACSNGPPDCVERVKKIKDYAFVHFKDRNLADNALKALNNTQIDSSWIEVNWAKPADKTEPSKVKAVTSNGDPSSSQDLFQQSQIFIDSSSGISYIGAPISTIHSQNISSSSSSPSRIKSGRRNAAGYRSVTISRERKTG----DEGHNSDNW-VNSHQMNKCEWMVNGVKYQYIPTQIMYPSV 451          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000044930.1 (SMESG000044930.1)

HSP 1 Score: 508.064 bits (1307), Expect = 8.244e-170
Identity = 254/438 (57.99%), Postives = 316/438 (72.15%), Query Frame = 3
Query:  210 NNNSQYVLSNNIQNSRLTDSPPA--KIPNTCKFPVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKAT-TKQNKIQSNLNELSLSDLQATTQIYFDPNTGLSYIG-PAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFLPNI 1511
            N+N   V   + QN+ +  S  A  K+ N   +P+V +NG RR+GPP DW G PP RGCEVFIGKIPRDC EDEL+P+FE IG IY FRLM+DF G NRGYGFC+Y  +ED+ RAV +LNN+EIR  K +GVC SVDNCRLFVGGIPKNKTKEEIF+EM RVT GV +VIAYPS+A+K KNRGFAFVEYESHK+AA+ARRKLIPGRI LWGQQIAVDWAEPEREV+E IMSTVKILY RNLMLTTTE+T+REKF+  S GP  C+ERVKK+KDYAF+HF +R  A+NA ++LNN++ID S +EV WAKPADK   +K   + SN +  S  DL   +QI+ D ++G+SYIG P     S +++       R K  RRNAAG R+    +E+K      +E  N+ NW +  +  +  +  +NGVK      Q+  P++
Sbjct:   36 NDNLSVVSKQDNQNAAVLSSAEALVKLLNRTMYPIVQENGQRRYGPPPDWKGFPPRRGCEVFIGKIPRDCFEDELVPVFERIGPIYMFRLMMDFTGTNRGYGFCIYMNREDTKRAVAELNNFEIRRDKPLGVCLSVDNCRLFVGGIPKNKTKEEIFIEMVRVTEGVKDVIAYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSTVKILYVRNLMLTTTEETIREKFVACSNGPPDCVERVKKIKDYAFVHFKDRNLADNALKALNNTQIDSSWIEVNWAKPADKTEPSKVKAVTSNGDPSSSQDLFQQSQIFIDSSSGISYIGAPISTIHSQNISSSSSSPSRIKSGRRNAAGYRSVTISRERKTG----DEGHNSDNW-VNSHQMNKCEWMVNGVKYQYIPTQIMYPSV 468          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000035182.1 (SMESG000035182.1)

HSP 1 Score: 356.681 bits (914), Expect = 2.634e-113
Identity = 188/419 (44.87%), Postives = 254/419 (60.62%), Query Frame = 3
Query:  303 PVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLS-DLQATTQIYFDPNTGLSYIGP-----------AMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPL--FSAQVFLPNINT 1517
            PV++++G RR GPP +W    P +GCE+FI KIP+D  E +LIPI   IG IY FRLM++    +RG+GFC+Y K E +  AV KLNNY+I+    +GVCFSVDNCRLFVGGIPK KTK EI  EM+  T  +V++I YPS A+K KNRGFAFVEY +HK+AA+AR+K+I   + LWGQ +AVDWAEPER+V + IMS VKILY RNLMLTTTE+T+   F   +  P   I +VKK+ D+AF+HF  R  AE  K  ++   +DGS +EV +AKP  K   +Q  ++ +   L+ S  L   T +       LS  GP           AM S  +  N  G  SI+++ + +N   S N  +       I  L E    Y WG P Y      + ++  ++P+  F AQ ++P +N 
Sbjct:   19 PVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEII-KVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSLPLLMPTDL---SRLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKNMENSENFYNV------INLLAETCQLYGWGTPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNV 427          
The following BLAST results are available for this feature:
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
A1CF1.016e-11751.37APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF1.016e-11751.37APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF1.016e-11751.37APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF2.205e-11760.85APOBEC1 complementation factor [Source:HGNC Symbol... [more]
RBM472.316e-11756.11RNA binding motif protein 47 [Source:HGNC Symbol;A... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrp-27.737e-6544.16HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3K... [more]
hrp-27.737e-6544.16HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3K... [more]
tiar-11.229e-1323.05TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
unc-752.871e-1126.02Putative RNA-binding protein [Source:UniProtKB/Tr... [more]
unc-758.309e-1126.02Putative RNA-binding protein [Source:UniProtKB/Tr... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syp1.444e-8749.82gene:FBgn0038826 transcript:FBtr0113256[more]
Syp1.492e-8749.82gene:FBgn0038826 transcript:FBtr0083961[more]
Syp2.823e-8749.82gene:FBgn0038826 transcript:FBtr0083963[more]
Syp3.269e-8749.82gene:FBgn0038826 transcript:FBtr0083958[more]
Syp5.438e-8749.82gene:FBgn0038826 transcript:FBtr0334720[more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm476.225e-12556.39RNA binding motif protein 47 [Source:ZFIN;Acc:ZDB-... [more]
a1cf3.500e-11760.50apobec1 complementation factor [Source:ZFIN;Acc:ZD... [more]
a1cf3.500e-11760.50apobec1 complementation factor [Source:ZFIN;Acc:ZD... [more]
rbm466.529e-11057.19RNA binding motif protein 46 [Source:NCBI gene;Acc... [more]
rbm462.469e-10959.44RNA binding motif protein 46 [Source:NCBI gene;Acc... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tom18.211e-12356.04target of myb1 membrane trafficking protein [Sourc... [more]
tom11.610e-12256.04target of myb1 membrane trafficking protein [Sourc... [more]
tom12.104e-12253.09target of myb1 membrane trafficking protein [Sourc... [more]
tom16.531e-12256.04target of myb1 membrane trafficking protein [Sourc... [more]
tom11.093e-12156.04target of myb1 membrane trafficking protein [Sourc... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
A1cf8.298e-11655.31APOBEC1 complementation factor [Source:MGI Symbol;... [more]
Rbm472.127e-11561.21RNA binding motif protein 47 [Source:MGI Symbol;Ac... [more]
Rbm479.029e-11553.52RNA binding motif protein 47 [Source:MGI Symbol;Ac... [more]
Rbm479.029e-11553.52RNA binding motif protein 47 [Source:MGI Symbol;Ac... [more]
Rbm479.029e-11553.52RNA binding motif protein 47 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R9H4|A1CF_PONAB5.830e-11751.37APOBEC1 complementation factor OS=Pongo abelii OX=... [more]
sp|Q9NQ94|A1CF_HUMAN1.059e-11660.85APOBEC1 complementation factor OS=Homo sapiens OX=... [more]
sp|Q91WT8|RBM47_MOUSE6.315e-11453.52RNA-binding protein 47 OS=Mus musculus OX=10090 GN... [more]
sp|Q5R5P4|RBM47_PONAB6.669e-11453.41RNA-binding protein 47 OS=Pongo abelii OX=9601 GN=... [more]
sp|A0AV96|RBM47_HUMAN6.669e-11453.41RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of APOBEC1 complementation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SFH31.002e-16354.11Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LX772.471e-16254.11Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LX895.324e-16052.52Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y9F52.014e-15852.52APOBEC1 complementation factor OS=Clonorchis sinen... [more]
A0A4S2LX842.314e-15852.52Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm471.965e-12557.01RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm461.117e-11560.14RNA binding motif protein 46 [Source:NCBI gene;Acc... [more]
ENSAMXT00000021508.21.435e-10355.56probable RNA-binding protein 46 [Source:NCBI gene;... [more]
a1cf9.464e-9560.48apobec1 complementation factor [Source:ZFIN;Acc:ZD... [more]
syncrip2.535e-8646.56heterogeneous nuclear ribonucleoprotein Q [Source:... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syncripl8.676e-7841.79synaptotagmin binding, cytoplasmic RNA interacting... [more]
ENSPMAT00000009756.11.093e-7345.07pep scaffold:Pmarinus_7.0:GL478948:7772:26420:1 ge... [more]
ENSPMAT00000003808.16.007e-6256.65pep scaffold:Pmarinus_7.0:GL483076:13225:15644:1 g... [more]
ncl5.113e-823.53nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
pabpc45.805e-822.92poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
PAB11.568e-926.24Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
HRP11.874e-826.90Subunit of cleavage factor I; cleavage factor I is... [more]
PUB11.852e-625.90Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
RNA152.465e-630.59Component of the cleavage and polyadenylation fact... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465473.377e-12248.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387634.715e-9251.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387344.303e-6543.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500675.493e-1027.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348796.785e-925.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm472.319e-12657.05RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm475.564e-12657.05RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm475.564e-12657.05RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm475.564e-12657.05RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm475.564e-12657.05RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032489.10.000e+099.70SMESG000032489.1[more]
SMESG000044930.17.368e-17158.45SMESG000044930.1[more]
SMESG000044930.14.563e-17057.99SMESG000044930.1[more]
SMESG000044930.18.244e-17057.99SMESG000044930.1[more]
SMESG000035182.12.634e-11344.87SMESG000035182.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010061 ID=SMED30010061|Name=APOBEC1 complementation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2415bp
ATTTTTAGAAAATCAAAATTTCATTCGTCAATTTCTTTAACAATTCAAGT
CACAAAATGACCTTTAAACTTCGAACTTTTTCATCATAATTTTAATGCAT
CGATAATTCAACGGTGAAACCGAAAAACCTTTTGAGGATTACAAAATCAT
ATATGAATCAACAGATGGCAGACTACGAGCAATTTCCATCATTATATTCA
AACTCCATCAATAACAACAGTCAATATGTTCTGTCGAACAATATTCAAAA
TTCAAGACTTACAGACTCTCCTCCGGCGAAAATTCCAAACACTTGCAAAT
TTCCCGTCGTTCACGACAATGGTCATCGAAGATTCGGGCCGCCATCCGAT
TGGATTGGAGATCCTCCATCTAGAGGCTGTGAAGTATTTATTGGGAAAAT
TCCCAGAGATTGTCTAGAAGATGAACTTATTCCTATTTTCGAAACTATTG
GTTTGATTTACGAGTTTCGTTTGATGGTTGATTTCAATGGCGTCAATCGG
GGTTATGGGTTTTGTGTTTATCAGAAAAAAGAAGACAGCAATCGAGCGGT
AGAAAAATTGAATAACTATGAAATCCGGCCGGGAAAAACAATCGGAGTGT
GTTTTTCTGTTGATAACTGTCGACTATTTGTTGGGGGAATTCCGAAAAAC
AAAACGAAAGAGGAGATTTTTATGGAAATGCAACGAGTCACTAGTGGGGT
TGTGAATGTCATTGCGTATCCGAGTATTGCGAATAAAAATAAAAACCGAG
GATTCGCTTTTGTTGAATACGAAAGCCACAAGTCTGCAGCAGTTGCCAGG
AGGAAATTAATTCCTGGACGAATTCCGTTATGGGGTCAACAGATTGCCGT
TGACTGGGCGGAACCAGAAAGGGAAGTCCACGAAACAATAATGTCAACGG
TGAAAATACTGTATGCACGAAATCTTATGCTAACAACAACCGAAGATACG
CTTAGAGAGAAGTTCTTAACCGCTTCCGGTGGACCGTATAGTTGCATTGA
GAGAGTCAAAAAAATGAAAGATTATGCCTTCATTCATTTTACAGAAAGGC
AGTATGCCGAAAATGCCAAGGAATCGCTGAATAATTCGGAAATTGATGGT
TCCATTGTTGAAGTGACATGGGCTAAGCCAGCTGATAAGGCAACAACAAA
ACAAAACAAAATTCAGTCGAATTTAAACGAACTTTCACTTTCGGATTTAC
AAGCGACAACGCAGATTTATTTCGATCCAAATACAGGTCTTTCCTATATT
GGTCCAGCAATGGGAAGCTGGTCGAATTCCTTGAACATTCTCGGCGACCC
AAGTATACGAAATAAACCAGTAAGAAGAAACGCAGCTGGAAGTCGCAATT
CGAATTCTTTCAAAGAGAAAAAACAATCAATTGAGTATCTAGAAGAACTA
GCAAACACGTACAATTGGGGGATGCCGCAGTATACCGCCTCTGCGTCAGA
CATTGACATAAATGGAGTTAAAACTCCCTTGTTCAGTGCTCAAGTTTTCT
TGCCCAATATTAACACGAAACAAGTTACTCAAGTTTTATACTCGACGCCC
GAAGAGGCTAAAGCGGCAGCAGCAGAACTTTTTATAAAGGCTGCTACTCA
ACCCCCTAGTCATTTTAATGGATTAGACATGAGACAACAAATGGCAGCTC
TATTAAATTTATCCAACATCATAAGTCCCCAGACGCAACAAATAAATCCC
AATCCACAAACATCCATGGATCTTAACAATGCCGCTGCTATCGCCGCAGC
AGGAGCTTCTCTATACTACTTACAACCCGGGCTAACGAATTCAGCGCTTT
TTCATCCAAATTCTCTTCTCTCTTCTCCACAGACAAATCCATTAAACCTT
GCAGCTTTTAGCAGTCTCTATTCTTCTCCAAATGCCAACATGTCTTCTGT
TATTTCAACTTCAAATAGAGAAATGAATGCTCTCAACAACCTCTTCAATC
CGAATGGATTAGGGATATTGCAATCTCCGAATTCCATTCCTTTATTGTCA
ATGAATTTGGAGTTGAACAATGGTGAAATGATGGACAATTCTGTAATAAG
AAATGCTTTAATTGCAAATCAACAACAGAATTTCCTCTACAACAATTCTC
AACAATCGCTCAACGATCAAAATAATATTTTGATGGGTCAACAAGTTCCA
AGTCAGTGATGAAAAATAAAAAAAAGTCGGAAAAAGTTGGAACACTTTTT
TTGTTGAAGTCATTTCAACAGTGCAACTTTGTTTCAATTTTTGAATTAAC
TTGTGATGGTGCAATATTTGACGTTCAACTGTATTTCTATTCATTTTCAT
ACTTTCATTTTTATTAGTAACGTTCCTAATATTTATGTGACTTTTACTGA
ACGAATCAAAGTCAGGTTTGCCAATACAAATGTATTTCATTAGAATATAA
ACATATTATTGAGAA
back to top

protein sequence of SMED30010061-orf-1

>SMED30010061-orf-1 ID=SMED30010061-orf-1|Name=SMED30010061-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MKYICIGKPDFDSFSKSHINIRNVTNKNESMKMNRNTVERQILHHHKLIQ
KLKQSCTVEMTSTKKVFQLFPTFFYFSSLTWNLLTHQNIILIVERLLRIV
VEEILLLICN*
back to top

protein sequence of SMED30010061-orf-2

>SMED30010061-orf-2 ID=SMED30010061-orf-2|Name=SMED30010061-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=669bp
MNQQMADYEQFPSLYSNSINNNSQYVLSNNIQNSRLTDSPPAKIPNTCKF
PVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIG
LIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVC
FSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRG
FAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTV
KILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQ
YAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNELSLSDLQ
ATTQIYFDPNTGLSYIGPAMGSWSNSLNILGDPSIRNKPVRRNAAGSRNS
NSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPLFSAQVFL
PNINTKQVTQVLYSTPEEAKAAAAELFIKAATQPPSHFNGLDMRQQMAAL
LNLSNIISPQTQQINPNPQTSMDLNNAAAIAAAGASLYYLQPGLTNSALF
HPNSLLSSPQTNPLNLAAFSSLYSSPNANMSSVISTSNREMNALNNLFNP
NGLGILQSPNSIPLLSMNLELNNGEMMDNSVIRNALIANQQQNFLYNNSQ
QSLNDQNNILMGQQVPSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003727single-stranded RNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006535HnRNP_R/Q_splicing_fac
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: biological process
TermDefinition
GO:0016556mRNA modification
Vocabulary: cellular component
TermDefinition
GO:0030895apolipoprotein B mRNA editing enzyme complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 252..322
e-value: 3.0E-9
score: 46.7
coord: 157..234
e-value: 2.4E-7
score: 40.4
coord: 77..150
e-value: 2.4E-14
score: 63.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 253..317
e-value: 1.2E-6
score: 28.2
coord: 78..142
e-value: 7.4E-15
score: 54.5
coord: 158..219
e-value: 1.4E-7
score: 31.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 156..238
score: 11.878
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 251..326
score: 13.669
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 76..154
score: 15.016
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 243..343
e-value: 4.8E-17
score: 64.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 54..155
e-value: 9.8E-15
score: 56.6
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 156..237
e-value: 1.7E-21
score: 78.1
IPR006535HnRNP R/Q splicing factorTIGRFAMTIGR01648TIGR01648coord: 50..553
e-value: 5.9E-141
score: 469.0
NoneNo IPR availablePANTHERPTHR21245:SF15coord: 48..353
NoneNo IPR availablePANTHERPTHR21245FAMILY NOT NAMEDcoord: 48..353
NoneNo IPR availableCDDcd12249RRM1_hnRNPR_likecoord: 75..152
e-value: 3.99749E-41
score: 142.313
NoneNo IPR availableCDDcd12251RRM3_hnRNPR_likecoord: 250..326
e-value: 9.01348E-32
score: 115.8
NoneNo IPR availableCDDcd12250RRM2_hnRNPR_likecoord: 155..236
e-value: 9.71262E-47
score: 157.823
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 74..239
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 243..329