SMED30010052

Overview
NameSMED30010052
Smed IDSMED30010052
Length (bp)500
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010052 (SMED30010052) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010052 (SMED30010052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010052 (SMED30010052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010052 (SMED30010052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30010052SMESG000039920.1 SmedASXL_066872SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010052 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.036415:1261..1821 -1631
v31.003039:16068..16628 +1623
Homology
BLAST of SMED30010052 vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 49.2914 bits (116), Expect = 4.652e-7
Identity = 30/94 (31.91%), Postives = 46/94 (48.94%), Query Frame = -2
Query:   80 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 361
            M K+    +Y++V +D FSK V L  +     Q I  ++    + R G P  IL+DR   F S+   +   K NI  +  + Y  Q+N + ERV
Sbjct:   49 MPKSGKQNEYLLVFVDYFSKWVELFPMRHATAQTIATILRQEMLTRWGVPDFILSDRGAQFVSSLFTELCGKWNITPKLTTAYHPQTN-MTERV 141          
BLAST of SMED30010052 vs. Ensembl Zebrafish
Match: CU929458.1 (pep chromosome:GRCz11:11:43363075:43368382:1 gene:ENSDARG00000114395.1 transcript:ENSDART00000179934.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929458.1)

HSP 1 Score: 46.2098 bits (108), Expect = 6.454e-6
Identity = 31/97 (31.96%), Postives = 46/97 (47.42%), Query Frame = -2
Query:   56 NKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVIPFQIIRF 343
            N   ++ ++DRFSK   L  + ++         L N ++R+ G P  I++DR   F S         LNI     S Y  QSNG  ER+   ++IRF
Sbjct: 1079 NNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQ-EVIRF 1174          
BLAST of SMED30010052 vs. Ensembl Zebrafish
Match: CR533578.3 (pep chromosome:GRCz11:16:23466094:23471387:-1 gene:ENSDARG00000115891.1 transcript:ENSDART00000180899.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR533578.3)

HSP 1 Score: 46.2098 bits (108), Expect = 6.454e-6
Identity = 31/97 (31.96%), Postives = 46/97 (47.42%), Query Frame = -2
Query:   56 NKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVIPFQIIRF 343
            N   ++ ++DRFSK   L  + ++         L N ++R+ G P  I++DR   F S         LNI     S Y  QSNG  ER+   ++IRF
Sbjct: 1079 NNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQ-EVIRF 1174          
BLAST of SMED30010052 vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 46.2098 bits (108), Expect = 7.025e-6
Identity = 31/97 (31.96%), Postives = 46/97 (47.42%), Query Frame = -2
Query:   56 NKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVIPFQIIRF 343
            N   ++ ++DRFSK   L  + ++         L N ++R+ G P  I++DR   F S         LNI     S Y  QSNG  ER+   ++IRF
Sbjct: 1072 NNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQ-EVIRF 1167          
BLAST of SMED30010052 vs. Ensembl Xenopus
Match: prkar2a (protein kinase, cAMP-dependent, regulatory subunit type II alpha [Source:Xenbase;Acc:XB-GENE-982783])

HSP 1 Score: 51.2174 bits (121), Expect = 1.720e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = -2
Query:   80 VIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 325
            V+IDRFSK+     + ++        +    I+R+ G P+ I++DR   F S   +     L +  +F+S Y  Q+NG AERV
Sbjct:  360 VVIDRFSKMAHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERV 442          
BLAST of SMED30010052 vs. Ensembl Xenopus
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:Xenbase;Acc:XB-GENE-5752559])

HSP 1 Score: 51.2174 bits (121), Expect = 1.904e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = -2
Query:   80 VIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 325
            V+IDRFSK+     + ++        +    I+R+ G P+ I++DR   F S   +     L +  +F+S Y  Q+NG AERV
Sbjct: 1089 VVIDRFSKMAHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERV 1171          
BLAST of SMED30010052 vs. Ensembl Xenopus
Match: ENSXETT00000031191.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460363.1:2287392:2288407:-1 gene:ENSXETG00000009772.1 transcript:ENSXETT00000031191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.004e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = -2
Query:   80 VIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 325
            V+IDRFSK+     + ++        +    I+R+ G P+ I++DR   F S   +     L +  +F+S Y  Q+NG AERV
Sbjct:   18 VVIDRFSKMAHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERV 100          
BLAST of SMED30010052 vs. Ensembl Xenopus
Match: ENSXETT00000008059.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:106110826:106112135:-1 gene:ENSXETG00000002142.1 transcript:ENSXETT00000008059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.015e-7
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = -2
Query:   80 VVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 331
            + V+IDRFSK+     + ++        +    I+R+ G P+ I++DR   F S   +     L +  +F+S Y  Q+NG AERV
Sbjct:  101 IWVVIDRFSKMAHFVPLKKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERV 185          
BLAST of SMED30010052 vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.106e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = -2
Query:   80 VIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 325
            V+IDRFSK+     + ++        +    I+R+ G P+ I++DR   F S   +     L +  +F+S Y  Q+NG AERV
Sbjct:  571 VVIDRFSKMAHFVPLRKLPSAVELAQLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERV 653          
BLAST of SMED30010052 vs. UniProt/SwissProt
Match: sp|P03360|POL_AVIRE (Gag-Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus OX=11636 GN=pol PE=1 SV=2)

HSP 1 Score: 49.2914 bits (116), Expect = 4.145e-6
Identity = 26/86 (30.23%), Postives = 44/86 (51.16%), Query Frame = -2
Query:   80 KYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 337
            KY++V++D FS  V      R   Q + K ++H+ I R G P+ I +D    F +   ++    LN+  +    Y+ QS+G  ER+
Sbjct:  886 KYLLVLVDTFSGWVEAYPAKRETSQVVIKHLIHDIIPRFGLPVQIGSDNGPAFVAKVTQQLCEALNVSWKLHCAYRPQSSGQVERM 971          
BLAST of SMED30010052 vs. UniProt/SwissProt
Match: sp|P51517|POL_SRV2 (Gag-Pro-Pol polyprotein OS=Simian retrovirus SRV-2 OX=39068 GN=pol PE=3 SV=2)

HSP 1 Score: 49.2914 bits (116), Expect = 4.975e-6
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = -2
Query:   83 NKL*YMDKTETNK----KYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 376
            N L  MD T  ++    KYV V ID FS  +  T  +    + +   +LH +   IG+PI I TD    + S++ +   +KL+IK  F  PY  Q  G+ ER
Sbjct: 1552 NMLWQMDVTHYSEFGKLKYVHVSIDTFSGFLVATLQTGEATKHVIAHLLHCFSI-IGQPIHIKTDNGPGYTSSNFRAFCSKLHIKHTFGIPYNPQGQGIVER 1652          
BLAST of SMED30010052 vs. TrEMBL
Match: A0A3P9MI86 (Integrase catalytic domain-containing protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.308e-12
Identity = 39/100 (39.00%), Postives = 56/100 (56.00%), Query Frame = -2
Query:   83 SLNKL*YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 382
            +L+ L  + +T    KY++VI D FSK      +   + Q I KV+   W+ R G P SI +D+ RNFES   K+  + L+I +   SPY  QS+GL ER
Sbjct:   42 ALDILGPLPETPNKNKYILVIGDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVER 141          
BLAST of SMED30010052 vs. TrEMBL
Match: A0A3B3HYG8 (Integrase catalytic domain-containing protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 7.222e-12
Identity = 37/93 (39.78%), Postives = 52/93 (55.91%), Query Frame = -2
Query:   83 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 361
            + +T    KY++VI D FSK      +   + Q I KV+   W+ R G P SI +D+ RNFES   K+  + L+I +   SPY  QS+GL ER
Sbjct:   49 LPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVER 141          
BLAST of SMED30010052 vs. TrEMBL
Match: A0A5S6QWV2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.618e-12
Identity = 35/93 (37.63%), Postives = 56/93 (60.22%), Query Frame = -2
Query:   83 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 361
            + KT T K+YV+V++D F+K     A   M+ + + KV++ N+I R G P S+ +D+ R+FE+  + +    L IK+   + Y  QSNGL ER
Sbjct:  791 LPKTTTGKRYVLVVVDYFTKWTEAYATENMEAKTVAKVLVDNFITRFGPPESVHSDQGRSFEATLLAETFQLLGIKKTHTTSYHPQSNGLVER 883          
BLAST of SMED30010052 vs. TrEMBL
Match: A0A3P9IDH0 (Integrase catalytic domain-containing protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.232e-11
Identity = 38/100 (38.00%), Postives = 56/100 (56.00%), Query Frame = -2
Query:   83 SLNKL*YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 382
            +L+ L  + +T    KY++VI D FSK      +   + Q I KV+   W+ R G P SI +D+ RNFES   K+  + L+I +   +PY  QS+GL ER
Sbjct:   67 ALDILGPLPETPNKNKYILVIGDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTTPYHPQSDGLVER 166          
BLAST of SMED30010052 vs. TrEMBL
Match: A0A3P9I3H7 (Integrase catalytic domain-containing protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.479e-11
Identity = 38/100 (38.00%), Postives = 56/100 (56.00%), Query Frame = -2
Query:   83 SLNKL*YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 382
            +L+ L  + +T    KY++VI D FSK      +   + Q I KV+   W+ R G P SI +D+ RNFES   K+  + L+I +   +PY  QS+GL ER
Sbjct:   67 ALDILGPLPETPNKNKYILVIGDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTTPYHPQSDGLVER 166          
BLAST of SMED30010052 vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 1.744e-13
Identity = 36/100 (36.00%), Postives = 56/100 (56.00%), Query Frame = -2
Query:   83 SLNKL*YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 382
            +L+ L  + +T    +Y++V+ D FSK     ++   + + + KV+   WI R G P SI TD+ RNFES    +    LN+ +   SPY+ QS+GL ER
Sbjct:   77 ALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIER 176          
BLAST of SMED30010052 vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 2.015e-13
Identity = 36/100 (36.00%), Postives = 56/100 (56.00%), Query Frame = -2
Query:   83 SLNKL*YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 382
            +L+ L  + +T    +Y++V+ D FSK     ++   + + + KV+   WI R G P SI TD+ RNFES    +    LN+ +   SPY+ QS+GL ER
Sbjct:   41 ALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIER 140          
BLAST of SMED30010052 vs. Ensembl Cavefish
Match: ENSAMXT00000037741.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27788674:27792885:-1 gene:ENSAMXG00000029895.1 transcript:ENSAMXT00000037741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 3.715e-11
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = -2
Query:   80 TETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 352
            T    KY++VI D F+K     A+   D   + + ++  +I R G P SI TD+ +NF+SA  +     L+I +   +PY   S+GL ER+
Sbjct:  171 TSQGNKYIIVIADYFTKWCEAFAMRAQDADTVARTVVEQFILRWGTPRSIHTDQGKNFDSALFRAICELLDIHKTRTTPYHPSSDGLVERL 261          
BLAST of SMED30010052 vs. Ensembl Cavefish
Match: ENSAMXT00000033536.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:66835186:66837354:-1 gene:ENSAMXG00000033197.1 transcript:ENSAMXT00000033536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 9.486e-11
Identity = 26/93 (27.96%), Postives = 49/93 (52.69%), Query Frame = -2
Query:   83 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 361
            ++++   +++V+++ D FSK              +  V++H W YR G P  + +D+ RNFESA + +      +++   +PY+ Q NG  ER
Sbjct:  507 LEQSGDGREHVLIMTDVFSKYTQAVPTRDQRASTVASVLVHEWFYRFGVPARLHSDQGRNFESAVIAQLCLLYGVQKTHTTPYRPQGNGQCER 599          
BLAST of SMED30010052 vs. Ensembl Cavefish
Match: ENSAMXT00000054209.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001944.1:84644:88116:-1 gene:ENSAMXG00000038678.1 transcript:ENSAMXT00000054209.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.723e-10
Identity = 33/91 (36.26%), Postives = 50/91 (54.95%), Query Frame = -2
Query:   80 TETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 352
            T T  KY++VI D FSK     A+   +   + + ++ +++ R G P  I TD+ R FES+  K+    L I +   SPY  QS+GL ER+
Sbjct:   33 TATGNKYILVIADYFSKWAESYAIPNQEATTVARAVV-DFLLRWGMPQVIHTDQGRTFESSLFKELCRLLEIDKTRTSPYSPQSDGLVERL 122          
BLAST of SMED30010052 vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 2.718e-15
Identity = 37/93 (39.78%), Postives = 52/93 (55.91%), Query Frame = -2
Query:   83 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 361
            + +T    KY++VI D FSK      +   + Q I KV+   W+ R G P SI +D+ RNFES   K+  + L+I +   SPY  QS+GL ER
Sbjct:   49 LPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVER 141          
BLAST of SMED30010052 vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.820e-9
Identity = 28/93 (30.11%), Postives = 50/93 (53.76%), Query Frame = -2
Query:   83 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 361
            +++T+ + +Y++V+ D FSK V    V       + + I+  W+ R G P  + +D+  NFESA  +     L I +   +P++ QS+G  ER
Sbjct: 1492 LNETDRHNRYILVVQDYFSKWVEAYPVPNEQATTVAEKIVSEWVCRYGAPYELHSDQGANFESAVFQGMCELLGINKTRTTPFRPQSDGQVER 1584          
BLAST of SMED30010052 vs. Ensembl Medaka
Match: ENSORLT00000035638.1 (pep primary_assembly:ASM223467v1:9:28520962:28524357:1 gene:ENSORLG00000024848.1 transcript:ENSORLT00000035638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 6.415e-8
Identity = 30/85 (35.29%), Postives = 43/85 (50.59%), Query Frame = -2
Query:   80 VVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERV 331
            ++ IIDRFSK V    ++++        IL + ++R  G P  I++DR   F S   K   + L      +S Y  QSNG AERV
Sbjct:  793 ILTIIDRFSKAVHFVPLAQLPSATDTAEILIHHVFRYHGIPCDIVSDRGPQFTSQVWKSFCSALGATVSLSSGYHPQSNGQAERV 877          

HSP 2 Score: 26.9498 bits (58), Expect = 6.415e-8
Identity = 15/39 (38.46%), Postives = 21/39 (53.85%), Query Frame = -1
Query:  387 PSMINTIKESRMKCIICAKGKISPSKTKELM--IPIQSR 497
            PS+   ++E    C ICA+ K S S    L+  +PI SR
Sbjct:  733 PSLEKDVREYVAACTICARSKNSNSPPSGLLQPLPIPSR 771          
BLAST of SMED30010052 vs. Ensembl Medaka
Match: ENSORLT00000032945.1 (pep primary_assembly:ASM223467v1:21:2349747:2355169:1 gene:ENSORLG00000022552.1 transcript:ENSORLT00000032945.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 1.138e-7
Identity = 27/84 (32.14%), Postives = 42/84 (50.00%), Query Frame = -2
Query:   83 VVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRI-GKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 331
            ++ ++DRFSK+     ++R+        +L N ++R  G P+ I++DR   F S   K   + L       S Y  QSNG AER
Sbjct: 1110 ILTVVDRFSKMAHFIPLTRLPSATDTAQVLVNQVFRHHGIPLDIVSDRGPQFVSQVWKAFCSALGATVSLTSGYHPQSNGQAER 1193          

HSP 2 Score: 27.7202 bits (60), Expect = 1.138e-7
Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = -1
Query:  396 PSMINTIKESRMKCIICAKGKISPSKTKELMIPI 497
            PSM   ++E    C ICA+ K S S    L+ P+
Sbjct: 1050 PSMEKDVREFVAACTICARSKASNSAPVGLLQPL 1083          
BLAST of SMED30010052 vs. Ensembl Medaka
Match: ENSORLT00000046208.1 (pep primary_assembly:ASM223467v1:12:17965935:17967666:1 gene:ENSORLG00000027528.1 transcript:ENSORLT00000046208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.163e-7
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = -2
Query:   83 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCI-FKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAER 361
            ++++ T  +Y++VI D  +K   + A+  +  + + F ++   +  R+G P  ILTDR  NF S  +K+    L IK    +PY  Q++GL ER
Sbjct:  133 VERSRTGNRYMLVITDYATKYPEVFALKCVKAKAVAFSLV--QFFSRVGFPKEILTDRGTNFMSTLLKQVYQLLGIKSIRTTPYHPQTDGLTER 224          
BLAST of SMED30010052 vs. Planmine SMEST
Match: SMESG000039920.1 (SMESG000039920.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.600e-61
Identity = 87/96 (90.62%), Postives = 93/96 (96.88%), Query Frame = -2
Query:   77 YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVI 364
            YMD+TETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYR  KPISILTDR RNF+SA++KK+MA+LNIKQEFASPYQHQSNGLAERVI
Sbjct:  235 YMDRTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRFNKPISILTDRGRNFKSAYMKKRMAELNIKQEFASPYQHQSNGLAERVI 330          

HSP 2 Score: 69.3218 bits (168), Expect = 1.600e-61
Identity = 35/45 (77.78%), Postives = 38/45 (84.44%), Query Frame = -1
Query:  363 PSMINTIKESRMKCIICAKGKISPSKTKELMIPIQSRNLLEQIVV 497
            PS INTIK+S  KC++CAK KISPSKTKELMI  QSRN LEQIVV
Sbjct:  187 PSTINTIKKSLKKCMVCAKRKISPSKTKELMILRQSRNFLEQIVV 231          
BLAST of SMED30010052 vs. Planmine SMEST
Match: SMESG000073174.1 (SMESG000073174.1)

HSP 1 Score: 190.66 bits (483), Expect = 3.813e-61
Identity = 89/96 (92.71%), Postives = 94/96 (97.92%), Query Frame = -2
Query:   77 YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVI 364
            YMD+TETNKKYVVVIIDRFSKLVSLTAVSRMDD+CIFKVILHNWIYR GKPISILTDRCRNFESA++KKKMA+LNIKQEFASPYQHQSNGLA RVI
Sbjct:  177 YMDRTETNKKYVVVIIDRFSKLVSLTAVSRMDDKCIFKVILHNWIYRFGKPISILTDRCRNFESAYMKKKMAELNIKQEFASPYQHQSNGLAGRVI 272          
BLAST of SMED30010052 vs. Planmine SMEST
Match: SMESG000017876.1 (SMESG000017876.1)

HSP 1 Score: 182.57 bits (462), Expect = 4.724e-59
Identity = 87/96 (90.62%), Postives = 92/96 (95.83%), Query Frame = -2
Query:   74 MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVIP 361
            M++TETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYR  KPISILTDR RNFESA++ KKMA+LNIKQEFASPYQHQSNGLAERVIP
Sbjct:    1 MNRTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRFCKPISILTDRRRNFESAYMNKKMAELNIKQEFASPYQHQSNGLAERVIP 96          
BLAST of SMED30010052 vs. Planmine SMEST
Match: SMESG000040832.1 (SMESG000040832.1)

HSP 1 Score: 171.785 bits (434), Expect = 1.008e-58
Identity = 84/96 (87.50%), Postives = 89/96 (92.71%), Query Frame = -2
Query:   77 YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVI 364
            YMD+ ETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIY   K ISILT+R RNFESA++KKKMA+LNIKQEFASPY HQSNGLAERVI
Sbjct:  158 YMDRKETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYGFVKVISILTNRGRNFESAYMKKKMAELNIKQEFASPYHHQSNGLAERVI 253          

HSP 2 Score: 72.7886 bits (177), Expect = 1.008e-58
Identity = 36/45 (80.00%), Postives = 40/45 (88.89%), Query Frame = -1
Query:  363 PSMINTIKESRMKCIICAKGKISPSKTKELMIPIQSRNLLEQIVV 497
            PSMINTIK+S  KC++CAK KISPSKTK+LMIP QSRN LEQIVV
Sbjct:  110 PSMINTIKKSLKKCMVCAKRKISPSKTKKLMIPRQSRNFLEQIVV 154          
BLAST of SMED30010052 vs. Planmine SMEST
Match: SMESG000020150.1 (SMESG000020150.1)

HSP 1 Score: 178.718 bits (452), Expect = 2.595e-56
Identity = 85/109 (77.98%), Postives = 97/109 (88.99%), Query Frame = -2
Query:   77 FLYRVETSLNKL*YMDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKPISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVI 403
            FL ++E  +    YMD+TETNKKYV+VIIDRFSKLV+LTAV RMDDQCIFKVILHNWIYR GKPISILT+R +NFESA++KKKM +LNIKQEF SP+QHQSNGLAERVI
Sbjct:  133 FLEQIEVDIA---YMDRTETNKKYVIVIIDRFSKLVNLTAVFRMDDQCIFKVILHNWIYRFGKPISILTERGKNFESAYMKKKMTELNIKQEFTSPFQHQSNGLAERVI 238          

HSP 2 Score: 61.2326 bits (147), Expect = 1.476e-11
Identity = 34/45 (75.56%), Postives = 36/45 (80.00%), Query Frame = -1
Query:  363 PSMINTIKESRMKCIICAKGKISPSKTKELMIPIQSRNLLEQIVV 497
            PSMINTIKES  K ++    KISPSKTKELMIPIQSRN LEQI V
Sbjct:   98 PSMINTIKESLKKYMVL---KISPSKTKELMIPIQSRNFLEQIEV 139          
The following BLAST results are available for this feature:
BLAST of SMED30010052 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CABZ01030006.14.652e-731.91pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
CU929458.16.454e-631.96pep chromosome:GRCz11:11:43363075:43368382:1 gene:... [more]
CR533578.36.454e-631.96pep chromosome:GRCz11:16:23466094:23471387:-1 gene... [more]
BX571665.17.025e-631.96pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
back to top
BLAST of SMED30010052 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2a1.720e-732.53protein kinase, cAMP-dependent, regulatory subunit... [more]
lin541.904e-732.53lin-54 DREAM MuvB core complex component [Source:X... [more]
ENSXETT00000031191.12.004e-732.53pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
ENSXETT00000008059.12.015e-731.76pep primary_assembly:Xenopus_tropicalis_v9.1:3:106... [more]
ENSXETT00000035398.12.106e-732.53pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
back to top
BLAST of SMED30010052 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P03360|POL_AVIRE4.145e-630.23Gag-Pol polyprotein (Fragment) OS=Avian reticuloen... [more]
sp|P51517|POL_SRV24.975e-634.31Gag-Pro-Pol polyprotein OS=Simian retrovirus SRV-2... [more]
back to top
BLAST of SMED30010052 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9MI865.308e-1239.00Integrase catalytic domain-containing protein OS=O... [more]
A0A3B3HYG87.222e-1239.78Integrase catalytic domain-containing protein OS=O... [more]
A0A5S6QWV27.618e-1237.63Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A3P9IDH01.232e-1138.00Integrase catalytic domain-containing protein OS=O... [more]
A0A3P9I3H71.479e-1138.00Integrase catalytic domain-containing protein OS=O... [more]
back to top
BLAST of SMED30010052 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000058127.11.744e-1336.00pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000031920.12.015e-1336.00pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000037741.13.715e-1134.07pep primary_assembly:Astyanax_mexicanus-2.0:6:2778... [more]
ENSAMXT00000033536.19.486e-1127.96pep primary_assembly:Astyanax_mexicanus-2.0:3:6683... [more]
ENSAMXT00000054209.11.723e-1036.26pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30010052 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010052 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.12.718e-1539.78pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000040305.11.820e-930.11pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000035638.16.415e-835.29pep primary_assembly:ASM223467v1:9:28520962:285243... [more]
ENSORLT00000032945.11.138e-732.14pep primary_assembly:ASM223467v1:21:2349747:235516... [more]
ENSORLT00000046208.11.163e-731.91pep primary_assembly:ASM223467v1:12:17965935:17967... [more]
back to top
BLAST of SMED30010052 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039920.11.600e-6190.63SMESG000039920.1[more]
SMESG000073174.13.813e-6192.71SMESG000073174.1[more]
SMESG000017876.14.724e-5990.63SMESG000017876.1[more]
SMESG000040832.11.008e-5887.50SMESG000040832.1[more]
SMESG000020150.12.595e-5677.98SMESG000020150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010052 ID=SMED30010052|Name=SMED30010052|organism=Schmidtea mediterranea sexual|type=transcript|length=500bp
TTCTGCGTTGTTTTATCCCGTTATGACACTGGAGCACAACCTAATGAGGA
GATTTGAATCTGATTATTTGAAATGGTATTACGCGTTCTGCCAGTCCATT
TGATTGATGCTGATATGGCGAGGCAAACTCTTGCTTAATGTTTAATTTTG
CCATCTTTTTCTTCACATGGGCACTTTCAAAGTTTCTACATCTATCTGTC
AAAATACTGATTGGTTTACCAATTCTATATATCCAATTATGTAATATGAC
TTTAAATATACATTGATCATCCATTCTAGATACGGCAGTTAGACTCACCA
GTTTGCTAAATCTGTCAATGATAACAACTACATACTTTTTGTTAGTTTCT
GTTTTATCCATGTACTACAATTTGTTCAAGGAGGTTTCTACTCTGTATAG
GAATCATTAGTTCCTTTGTTTTGCTTGGACTTATCTTCCCTTTCGCACAG
ATTATACACTTCATTCGGGATTCTTTTATAGTATTAATCATAGATGGCCG
back to top

protein sequence of SMED30010052-orf-1

>SMED30010052-orf-1 ID=SMED30010052-orf-1|Name=SMED30010052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MDKTETNKKYVVVIIDRFSKLVSLTAVSRMDDQCIFKVILHNWIYRIGKP
ISILTDRCRNFESAHVKKKMAKLNIKQEFASPYQHQSNGLAERVIPFQII
RFKSPH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration