Smed-notum

Overview
NameSmed-notum (F8U830)
Smed IDSMED30010051
Length (bp)1917
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Smed-notum (SMED30010051) t-SNE clustered cells

Violin plots show distribution of expression levels for Smed-notum (SMED30010051) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Smed-notum (SMED30010051) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Smed-notum (SMED30010051) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010051

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30010051SMESG000004222.1 dd_Smed_v4_24180_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010051SMESG000004222.1 dd_Smed_v4_24180_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior poleSMED30010051SMESG000004222.1 dd_Smed_v4_24180_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior pole cellSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30010051SMESG000004222.1 SmedASXL_009180SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30010051SMESG000004222.1 dd_Smed_v4_24180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30010051SMESG000004222.1 dd_Smed_v4_24180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010051SMESG000004222.1 dd_Smed_v6_24180_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010051SMESG000004222.1 Contig11665newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010051SMESG000004222.1 Contig11665uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30010051SMESG000004222.1 Contig11665newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010051SMESG000004222.1 Contig11665uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Category 2 cellSMED30010051SMESG000004222.1 dd_Smed_v4_24180_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 JF725701.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 JF725701.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30010051SMESG000004222.1 notumsmed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Smed-notum vs. Ensembl Human
Match: NOTUM (notum, palmitoleoyl-protein carboxylesterase [Source:HGNC Symbol;Acc:HGNC:27106])

HSP 1 Score: 246.514 bits (628), Expect = 1.154e-73
Identity = 156/454 (34.36%), Postives = 213/454 (46.92%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            T+V CNDGS  GYY + S    S++WL+FLEGGWYCFN   C+SR  T   L SS  W   R   GILS+    NP + + N V+IPYCSSD+WSG   +     Y F G+ I+  VV +L   +       +   GSSAGG GVLLN+DR+  +L+K     + + G+ DS WFLD   YR ++C     C P  A+R G++ WN  +P RC++    G EW CF G  +Y  L+ P F++Q LFD+AQL +  V     P+ EG       YIQ LG     TL+     FA +C+ HEI+ +S+W  V V    L   L+ W   L                  K  K+P K                 L+DSC            PH                CNP+C  +    +G  M+    L      +  +A+  G+   +L  M
Sbjct:   97 TSVTCNDGSPAGYYLKESRG--SRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELL-GRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEG----LRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLH--------------DSHKASKTPLKG------------CPVHLVDSC----------PWPH----------------CNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGM 491          
BLAST of Smed-notum vs. Ensembl Human
Match: NOTUM (notum, palmitoleoyl-protein carboxylesterase [Source:HGNC Symbol;Acc:HGNC:27106])

HSP 1 Score: 162.155 bits (409), Expect = 1.835e-44
Identity = 88/202 (43.56%), Postives = 116/202 (57.43%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGM 909
            T+V CNDGS  GYY + S    S++WL+FLEGGWYCFN   C+SR  T   L SS  W   R   GILS+    NP + + N V+IPYCSSD+WSG   +     Y F G+ I+  VV +L   +       +   GSSAGG GVLLN+DR+  +L+K     + + G+ DS WFLD   YR ++C     C P  A+R G+
Sbjct:   97 TSVTCNDGSPAGYYLKESRG--SRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELL-GRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGI 295          
BLAST of Smed-notum vs. Ensembl Human
Match: NOTUM (notum, palmitoleoyl-protein carboxylesterase [Source:HGNC Symbol;Acc:HGNC:27106])

HSP 1 Score: 147.902 bits (372), Expect = 1.718e-40
Identity = 78/195 (40.00%), Postives = 108/195 (55.38%), Query Frame = 1
Query:  460 LFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLF 1041
            L SS  W   R   GILS+    NP + + N V+IPYCSSD+WSG   +     Y F G+ I+  VV +L   +       +   GSSAGG GVLLN+DR+  +L+K     + + G+ DS WFLD   YR ++C     C P  A+R G++ WN  +P RC++    G EW CF G  +Y  L+ P F++Q LF
Sbjct:    4 LMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELL-GRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLF 197          
BLAST of Smed-notum vs. Ensembl Fly
Match: Notum (gene:FBgn0044028 transcript:FBtr0075435)

HSP 1 Score: 211.846 bits (538), Expect = 1.543e-59
Identity = 127/350 (36.29%), Postives = 189/350 (54.00%), Query Frame = 1
Query:  244 SSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE-----KTNGLYFHGSRILDTVVDDLTQNQHFKKV--HEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV--PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQ 1266
            S +  HSR  +   L     +T++ CNDGS  G+Y R   +  SKKW++ LEGGW+CF+  +C SR      L +S  W   R +GGILS +   NP +H+ N V IPYCSSD WSG + E     + N   F G+ IL  V+ +L       +V   E+  VGSSAGG+GV+LN+DR++  L  + K ++ + G+ DS WFLD   Y  +            A+R G KLW   +P  C K       W+C+ G  +Y  LK P F+ Q LFD+AQ+++  V  P+    + ++++YI ++GG    +L     VFA SC+ H +L K +W  + +++  L   L  W+
Sbjct:   79 SGSGDHSRSLKRANLA----NTSITCNDGSHAGFYLRKHPS--SKKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVGGILSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELIP-VGLGRVPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDREPYTPAAVAS------NEAVRQGWKLWQGLLPEECTKSYPT-EPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRVDNVGAPV----TPQQWNYIHEMGGALRSSLDNVSAVFAPSCIGHGVLFKRDWVNIKIDDISLPSALRCWE 410          

HSP 2 Score: 50.8322 bits (120), Expect = 3.980e-6
Identity = 23/71 (32.39%), Postives = 40/71 (56.34%), Query Frame = 1
Query: 1465 RTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLL 1677
            R L RC+      P CN +C  L++P++G  M F++LL  + + I  +A +LG+ M  L  M   + +++L
Sbjct:  601 RLLERCS-----WPQCNHSCPTLTNPMTGEEMRFLELLTAFGLDIEAVAAALGVDMHTLNNMERTELVNML 666          
BLAST of Smed-notum vs. Ensembl Zebrafish
Match: notum1a (notum, palmitoleoyl-protein carboxylesterase a [Source:NCBI gene;Acc:570510])

HSP 1 Score: 249.595 bits (636), Expect = 6.196e-75
Identity = 161/479 (33.61%), Postives = 224/479 (46.76%), Query Frame = 1
Query:  232 NDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            N  QS     ++K  Y     F  +T+V CNDG+  GYY + S    SK+WLIFLEGGWYCFN   C+SR  T   L SS  W   +   G+LS+    NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  VV DL  ++       +   GSSAGG GVLLN+D +   L++     + + G+ DS WFLD   YR ++C     C P   ++ G+K W   +P RC++    G+EW CF G  +Y  +K P FI+Q LFD+AQL +  +     P+ EG    ++ YIQ LG     TL+    +FA +C+ HE +T++ W  V V    L   L+ W   L+                 +  KSP K                 LIDSC            PH                CNPTC  +    +G  M+ I  L      +  +A   G+   +L  M
Sbjct:   77 NLAQSLYPCSAQKLDYDMKLHFLENTSVTCNDGTPAGYYLKESKG--SKRWLIFLEGGWYCFNKENCDSRYETMRRLMSSSKWPQTKTGTGMLSSLPEENPHWWNANMVFIPYCSSDVWSGASPKTDQNDYAFMGSLIIKEVVKDLL-SKGLDNAKILLLAGSSAGGTGVLLNVDSVSELLEELGHTNIQVRGLSDSGWFLDNKQYRCTDCVDTINCAPTEVIKRGIKYWGGVVPERCRQAY-EGKEWNCFFGYKVYPTIKRPVFIVQWLFDEAQLTVDNIHLTGQPVQEG----QWRYIQNLGTELRNTLKDVPAMFAPACLSHEFITRNYWTDVQVKGTSLPRALHCWDRSLQ--------------DTSRNNKSPPKG------------CPVHLIDSC----------PWPH----------------CNPTCPTIRDQSTGQEMNVIQFLMHMGFDVQKMAHQQGMDPSKLLGM 495          
BLAST of Smed-notum vs. Ensembl Zebrafish
Match: notum2 (Danio rerio notum pectinacetylesterase 2 (notum2), mRNA. [Source:RefSeq mRNA;Acc:NM_001353872])

HSP 1 Score: 236.498 bits (602), Expect = 4.499e-70
Identity = 122/330 (36.97%), Postives = 188/330 (56.97%), Query Frame = 1
Query:  295 FPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE------KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPI-LEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYW 1263
            F  +T V CNDG+  G+Y +      SK+WLIFLEGGW C++  TC+SR +T   L  S  W   R+  G+LS     NP++++ N V++PYCSSD+WSG +        K     F GS+I+  V+ DL   +  K+   V   G+SAGG GVLLNID++   L+++      + G+VDS WFL+    +  +C     C P +A++ G++LWN  +P +CK+   RG +W CF G  +Y ++  P F++Q LFD+ QL++  + +  +  S ++++Y+Q LG     +L+    VFA SC+ H ++TKSNW    +    L   L  W
Sbjct:   90 FLKNTAVTCNDGTAAGFYLK--EFKGSKRWLIFLEGGWCCYSKETCDSRYKTIPRLMGSTDWPQTRRGSGLLSAQVDENPHWYNANIVFVPYCSSDVWSGNKAASKPKQGKETEYAFMGSQIIREVIKDLVP-KGLKQAKVVMLAGTSAGGTGVLLNIDKVSSLLEQQGAE-AQVRGLVDSGWFLESKQQKVPDCPDSASCTPADAIKKGLRLWNGVVPEKCKQQYKRGEDWHCFFGHKLYSYISAPLFVVQWLFDEEQLRVENIYMGSQSLSEQQWTYMQNLGKELKNSLKDVTAVFAPSCLSHTLITKSNWTDFQIKGTSLSRALQCW 415          
BLAST of Smed-notum vs. Ensembl Zebrafish
Match: notum2 (Danio rerio notum pectinacetylesterase 2 (notum2), mRNA. [Source:RefSeq mRNA;Acc:NM_001353872])

HSP 1 Score: 236.498 bits (602), Expect = 4.499e-70
Identity = 122/330 (36.97%), Postives = 188/330 (56.97%), Query Frame = 1
Query:  295 FPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE------KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPI-LEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYW 1263
            F  +T V CNDG+  G+Y +      SK+WLIFLEGGW C++  TC+SR +T   L  S  W   R+  G+LS     NP++++ N V++PYCSSD+WSG +        K     F GS+I+  V+ DL   +  K+   V   G+SAGG GVLLNID++   L+++      + G+VDS WFL+    +  +C     C P +A++ G++LWN  +P +CK+   RG +W CF G  +Y ++  P F++Q LFD+ QL++  + +  +  S ++++Y+Q LG     +L+    VFA SC+ H ++TKSNW    +    L   L  W
Sbjct:   90 FLKNTAVTCNDGTAAGFYLK--EFKGSKRWLIFLEGGWCCYSKETCDSRYKTIPRLMGSTDWPQTRRGSGLLSAQVDENPHWYNANIVFVPYCSSDVWSGNKAASKPKQGKETEYAFMGSQIIREVIKDLVP-KGLKQAKVVMLAGTSAGGTGVLLNIDKVSSLLEQQGAE-AQVRGLVDSGWFLESKQQKVPDCPDSASCTPADAIKKGLRLWNGVVPEKCKQQYKRGEDWHCFFGHKLYSYISAPLFVVQWLFDEEQLRVENIYMGSQSLSEQQWTYMQNLGKELKNSLKDVTAVFAPSCLSHTLITKSNWTDFQIKGTSLSRALQCW 415          
BLAST of Smed-notum vs. Ensembl Xenopus
Match: notum (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:100145278])

HSP 1 Score: 250.751 bits (639), Expect = 2.399e-75
Identity = 150/450 (33.33%), Postives = 218/450 (48.44%), Query Frame = 1
Query:  310 NVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE-KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQL 1641
            +V CNDGS  GYY + S    S++WL+FLEGGWYC +   C+ R  T   L SS+ W   +   GILS     NP++ + N V+IPYCSSD+WSG   + + +G  F GS I+  VV +L   +       +   GSSAGG GVLLN+D +  +L++     + + G+ DS WFLD   YR+++CT I  C P  A++ G++ WN  +P RCK+    G EW CF G  IY  L++P F++Q LFD+AQL +  V     P+ E     ++ YIQ LG     TL+     FA +C+ HE++T+S+W  + V    L   L+ W   L+                        KN + P     +    + L+DSC                            P CNPTC  +    +G  MS +  L      +  +A   G+   +L
Sbjct:   92 SVTCNDGSPAGYYLKESKG--SRRWLVFLEGGWYCISRENCDLRYDTMRRLMSSKAWPPAKTASGILSTQPEENPHWWNANMVFIPYCSSDVWSGASPKTEKSGYAFMGSLIIQEVVKELL-GKGLDTAKVLLLAGSSAGGTGVLLNVDLVADQLEELGFPGIQVRGLSDSGWFLDNKQYRRTDCTDIITCAPTEAIQRGIRYWNSVVPERCKQQFKEGEEWNCFFGYKIYPTLRSPVFVVQWLFDEAQLTVDNVHLSGQPVQE----SQWLYIQNLGQELRNTLKDVGASFAPACLAHEVITRSHWTEIQVRGTSLPRALHCWDRSLQETN---------------------KNSKVP-----LKGCPFHLMDSCP--------------------------WPQCNPTCPSIRDHFTGQEMSVVQFLMHLGFDVQKMASQQGMEPGKL 482          
BLAST of Smed-notum vs. Ensembl Xenopus
Match: notum (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:100145278])

HSP 1 Score: 250.751 bits (639), Expect = 2.539e-75
Identity = 150/450 (33.33%), Postives = 218/450 (48.44%), Query Frame = 1
Query:  310 NVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE-KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQL 1641
            +V CNDGS  GYY + S    S++WL+FLEGGWYC +   C+ R  T   L SS+ W   +   GILS     NP++ + N V+IPYCSSD+WSG   + + +G  F GS I+  VV +L   +       +   GSSAGG GVLLN+D +  +L++     + + G+ DS WFLD   YR+++CT I  C P  A++ G++ WN  +P RCK+    G EW CF G  IY  L++P F++Q LFD+AQL +  V     P+ E     ++ YIQ LG     TL+     FA +C+ HE++T+S+W  + V    L   L+ W   L+                        KN + P     +    + L+DSC                            P CNPTC  +    +G  MS +  L      +  +A   G+   +L
Sbjct:   95 SVTCNDGSPAGYYLKESKG--SRRWLVFLEGGWYCISRENCDLRYDTMRRLMSSKAWPPAKTASGILSTQPEENPHWWNANMVFIPYCSSDVWSGASPKTEKSGYAFMGSLIIQEVVKELL-GKGLDTAKVLLLAGSSAGGTGVLLNVDLVADQLEELGFPGIQVRGLSDSGWFLDNKQYRRTDCTDIITCAPTEAIQRGIRYWNSVVPERCKQQFKEGEEWNCFFGYKIYPTLRSPVFVVQWLFDEAQLTVDNVHLSGQPVQE----SQWLYIQNLGQELRNTLKDVGASFAPACLAHEVITRSHWTEIQVRGTSLPRALHCWDRSLQETN---------------------KNSKVP-----LKGCPFHLMDSCP--------------------------WPQCNPTCPSIRDHFTGQEMSVVQFLMHLGFDVQKMASQQGMEPGKL 485          
BLAST of Smed-notum vs. Ensembl Xenopus
Match: prdm5 (PR domain 5 [Source:Xenbase;Acc:XB-GENE-854777])

HSP 1 Score: 228.794 bits (582), Expect = 3.932e-67
Identity = 141/441 (31.97%), Postives = 212/441 (48.07%), Query Frame = 1
Query:  259 HSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPI-LEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLL 1578
            H +K Q      F  +T V CNDG+  GYY R +    SK+W+IFLEGGW C++  TC  R      L SS  W   R+  GI+S     NP + + N+V++PYCSSD+WSG   +  +G  F GS I+  V+ DL   +  K+   V   GSSAGG GVL+NIDR+   +++     + + G+VDS WFLD    +QS+C  I +C    A++ G+KLWN  +P  CK+   +G EW+CF GP ++  +K+P F++Q L+D  QL++  +    +  +  +++ IQ +G    ++LR+         +   I    NW    V +  L + L+ W   L+                           R PK +  I    + LID+C          Q PH                CNPTC  +    SG  +S + + 
Sbjct:   73 HDQKSQEDMKLHFLKNTMVTCNDGTTAGYYLREAKG--SKRWIIFLEGGWCCYSKETCGIRYDNIKRLMSSSNWPQTRKGSGIISPRPDENPYWWNVNAVFVPYCSSDVWSGNISKTQDGYAFMGSVIIQEVIRDLVP-RGLKQAKSVILAGSSAGGTGVLINIDRVAALVEEITSESIQVRGLVDSGWFLDSKHAKQSDCLDISKCALTEAIKKGLKLWNGILPENCKQQLKKGDEWRCFYGPRVFASMKSPIFVVQWLYDQEQLRIENIQTEFQSMTENQWNSIQNIGREFKKSLREVP-------LKSHISGIHNWLEFQVKSVTLAKALHCWDRSLQEN-------------------------RAPKAA--IRGCPFHLIDNC----------QWPH----------------CNPTCPAIYDSTSGQEVSILQMF 450          
BLAST of Smed-notum vs. Ensembl Xenopus
Match: notum (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:100145278])

HSP 1 Score: 223.787 bits (569), Expect = 2.265e-65
Identity = 145/450 (32.22%), Postives = 209/450 (46.44%), Query Frame = 1
Query:  310 NVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE-KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQL 1641
            +V CNDGS  GYY + S    S++WL+FLEGGWYC +   C+ R  T   L SS+ W   +   GILS     NP++ + N V+IPYCSSD+WSG   + + +G  F GS I+  VV +L   +       +   GSSAGG GVLLN+D +  +L++     + + G+ DS WFLD   YR+++CT I  C P  A++ G++ WN  +P RCK+    G EW CF G  IY  L++P F++Q LFD+AQL +  V     P+ E     ++ YIQ LG     TL+         CV  + L  +    + V    L   L+ W   L+                        KN + P     +    + L+DSC                            P CNPTC  +    +G  MS +  L      +  +A   G+   +L
Sbjct:   92 SVTCNDGSPAGYYLKESKG--SRRWLVFLEGGWYCISRENCDLRYDTMRRLMSSKAWPPAKTASGILSTQPEENPHWWNANMVFIPYCSSDVWSGASPKTEKSGYAFMGSLIIQEVVKELL-GKGLDTAKVLLLAGSSAGGTGVLLNVDLVADQLEELGFPGIQVRGLSDSGWFLDNKQYRRTDCTDIITCAPTEAIQRGIRYWNSVVPERCKQQFKEGEEWNCFFGYKIYPTLRSPVFVVQWLFDEAQLTVDNVHLSGQPVQE----SQWLYIQNLGQELRNTLKDV------GCVSSDTLNYT----IQVRGTSLPRALHCWDRSLQETN---------------------KNSKVP-----LKGCPFHLMDSCP--------------------------WPQCNPTCPSIRDHFTGQEMSVVQFLMHLGFDVQKMASQQGMEPGKL 472          
BLAST of Smed-notum vs. Ensembl Xenopus
Match: notum (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:100145278])

HSP 1 Score: 202.216 bits (513), Expect = 1.363e-57
Identity = 134/449 (29.84%), Postives = 193/449 (42.98%), Query Frame = 1
Query:  310 NVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQL 1641
            +V CNDGS  GYY + S    S++WL+FLEGGWYC +   C+ R  T   L SS+ W                                          KT G  F GS I+  VV +L   +       +   GSSAGG GVLLN+D +  +L++     + + G+ DS WFLD   YR+++CT I  C P  A++ G++ WN  +P RCK+    G EW CF G  IY  L++P F++Q LFD+AQL +  V     P+ E     ++ YIQ LG     TL+     FA +C+ HE++T+S+W  + V    L   L+ W   L+                        KN + P     +    + L+DSC                            P CNPTC  +    +G  MS +  L      +  +A   G+   +L
Sbjct:   92 SVTCNDGSPAGYYLKESKG--SRRWLVFLEGGWYCISRENCDLRYDTMRRLMSSKAWPPA---------------------------------------KTGGYAFMGSLIIQEVVKELL-GKGLDTAKVLLLAGSSAGGTGVLLNVDLVADQLEELGFPGIQVRGLSDSGWFLDNKQYRRTDCTDIITCAPTEAIQRGIRYWNSVVPERCKQQFKEGEEWNCFFGYKIYPTLRSPVFVVQWLFDEAQLTVDNVHLSGQPVQE----SQWLYIQNLGQELRNTLKDVGASFAPACLAHEVITRSHWTEIQVRGTSLPRALHCWDRSLQETN---------------------KNSKVP-----LKGCPFHLMDSCP--------------------------WPQCNPTCPSIRDHFTGQEMSVVQFLMHLGFDVQKMASQQGMEPGKL 442          
BLAST of Smed-notum vs. Ensembl Mouse
Match: Notum (notum palmitoleoyl-protein carboxylesterase [Source:MGI Symbol;Acc:MGI:1924833])

HSP 1 Score: 250.751 bits (639), Expect = 2.306e-75
Identity = 155/454 (34.14%), Postives = 218/454 (48.02%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            T+V CNDGS  GYY + S    S++WL+FLEGGWYCFN   C+SR  T   L SS+ W   R   GILS+    NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  VV +L   +       +   GSSAGG GVLLN+DR+   L++     + + G+ DS WFLD   YR+S+C     C P +A+R G++ W+  +P RC++    G EW CF G  +Y  L+ P F++Q LFD+AQL +  V     P+ EG    ++ YIQ LG     TL+  +  FA +C+ HEI+ +S W  V V    L   L+ W                      K  K+P K               + L+DSC            PH                CNP+C  +    +G  M+    L      +  +A+  G+   +L  M
Sbjct:  104 TSVTCNDGSPAGYYLKESKG--SRRWLLFLEGGWYCFNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSGASPKSDKNEYAFMGSLIIQEVVRELL-GKGLSGAKVLLLAGSSAGGTGVLLNVDRVAELLEELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTDAIRRGIRYWSGMVPERCQRQFKEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEG----QWLYIQNLGRELRGTLKDVQASFAPACLSHEIIIRSYWTDVQVKGTSLPRALHCWDRSFH--------------DSHKASKTPMKG------------CPFHLVDSC----------PWPH----------------CNPSCPTIRDQFTGQEMNVAQFLMHMGFDVQTVAQQQGMEPSKLLGM 498          
BLAST of Smed-notum vs. Ensembl Mouse
Match: Notum (notum palmitoleoyl-protein carboxylesterase [Source:MGI Symbol;Acc:MGI:1924833])

HSP 1 Score: 250.751 bits (639), Expect = 2.306e-75
Identity = 155/454 (34.14%), Postives = 218/454 (48.02%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            T+V CNDGS  GYY + S    S++WL+FLEGGWYCFN   C+SR  T   L SS+ W   R   GILS+    NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  VV +L   +       +   GSSAGG GVLLN+DR+   L++     + + G+ DS WFLD   YR+S+C     C P +A+R G++ W+  +P RC++    G EW CF G  +Y  L+ P F++Q LFD+AQL +  V     P+ EG    ++ YIQ LG     TL+  +  FA +C+ HEI+ +S W  V V    L   L+ W                      K  K+P K               + L+DSC            PH                CNP+C  +    +G  M+    L      +  +A+  G+   +L  M
Sbjct:  104 TSVTCNDGSPAGYYLKESKG--SRRWLLFLEGGWYCFNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSGASPKSDKNEYAFMGSLIIQEVVRELL-GKGLSGAKVLLLAGSSAGGTGVLLNVDRVAELLEELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTDAIRRGIRYWSGMVPERCQRQFKEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEG----QWLYIQNLGRELRGTLKDVQASFAPACLSHEIIIRSYWTDVQVKGTSLPRALHCWDRSFH--------------DSHKASKTPMKG------------CPFHLVDSC----------PWPH----------------CNPSCPTIRDQFTGQEMNVAQFLMHMGFDVQTVAQQQGMEPSKLLGM 498          
BLAST of Smed-notum vs. Ensembl Mouse
Match: Notum (notum palmitoleoyl-protein carboxylesterase [Source:MGI Symbol;Acc:MGI:1924833])

HSP 1 Score: 106.301 bits (264), Expect = 1.095e-25
Identity = 56/114 (49.12%), Postives = 71/114 (62.28%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRIL 645
            T+V CNDGS  GYY + S    S++WL+FLEGGWYCFN   C+SR  T   L SS+ W   R   GILS+    NP++ + N V+IPYCSSD+WSG   +     Y F GS I+
Sbjct:  104 TSVTCNDGSPAGYYLKESKG--SRRWLLFLEGGWYCFNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSGASPKSDKNEYAFMGSLII 215          
BLAST of Smed-notum vs. UniProt/SwissProt
Match: sp|F8U830|NOTUM_SCHMD (Palmitoleoyl-protein carboxylesterase NOTUM OS=Schmidtea mediterranea OX=79327 GN=notum PE=2 SV=1)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 496/496 (100.00%), Postives = 496/496 (100.00%), Query Frame = 1
Query:  205 LIFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR 1692
            LIFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDRLKRRLKKKLKRKVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEKKKIKKKVQKNPKLIKTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR
Sbjct:   32 LIFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDRLKRRLKKKLKRKVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEKKKIKKKVQKNPKLIKTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR 527          
BLAST of Smed-notum vs. UniProt/SwissProt
Match: sp|A0A0D3QS97|NOTU2_XENLA (Palmitoleoyl-protein carboxylesterase notum2 OS=Xenopus laevis OX=8355 GN=notum2 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.796e-77
Identity = 148/429 (34.50%), Postives = 219/429 (51.05%), Query Frame = 1
Query:  295 FPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPI-LEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLL 1578
            F  +T V CNDG+  GYY R   T  SK+W+IFLEGGW C++  TC  R      L SS  W   R+  GILS  +  NP + + N+V++PYCSSD+WSG   +  +G  F GS I+  V+ DL   +  K+   V   GSSAGG GVL+NIDR+   +++     V + G+VDS WFLD    +QS+C  I +C    A++ G+KLWN  +P  CK+   +G EW+CF GP ++  +K+P F++Q L+D  QL++  +    +  +  +++ IQ +G    ++LR+   VFA +C+ H ++TKSNW    V +  L + L+ W   L+                           R PK  G I    + L+D+C          Q PH                CNPTC  +    SG  +S + + 
Sbjct:   85 FLKNTLVTCNDGTTAGYYLR--ETKGSKRWIIFLEGGWCCYSKETCGVRYDNVKRLMSSSNWPQTRKGTGILSPRQDENPYWWNVNAVFVPYCSSDVWSGNVSKTQDGYAFMGSVIIQEVIRDLVP-RGMKQAKSVILAGSSAGGTGVLINIDRVAALVEETTSESVQVRGLVDSGWFLDSRHSKQSDCLDISKCALTEAIKKGLKLWNGILPENCKQQFKKGDEWRCFYGPRLFTSMKSPIFVVQWLYDQEQLRIENIQTEFQSMTENQWNSIQNIGREFKKSLREVPAVFAPACLSHTLITKSNWLEFQVKSVTLAKALHCWDRSLQEN-------------------------RAPK--GVIRGCPFHLVDNC----------QWPH----------------CNPTCPAIYDATSGQELSILQMF 457          
BLAST of Smed-notum vs. UniProt/SwissProt
Match: sp|Q8R116|NOTUM_MOUSE (Palmitoleoyl-protein carboxylesterase NOTUM OS=Mus musculus OX=10090 GN=Notum PE=1 SV=2)

HSP 1 Score: 250.751 bits (639), Expect = 1.613e-74
Identity = 155/454 (34.14%), Postives = 218/454 (48.02%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            T+V CNDGS  GYY + S    S++WL+FLEGGWYCFN   C+SR  T   L SS+ W   R   GILS+    NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  VV +L   +       +   GSSAGG GVLLN+DR+   L++     + + G+ DS WFLD   YR+S+C     C P +A+R G++ W+  +P RC++    G EW CF G  +Y  L+ P F++Q LFD+AQL +  V     P+ EG    ++ YIQ LG     TL+  +  FA +C+ HEI+ +S W  V V    L   L+ W                      K  K+P K               + L+DSC            PH                CNP+C  +    +G  M+    L      +  +A+  G+   +L  M
Sbjct:  104 TSVTCNDGSPAGYYLKESKG--SRRWLLFLEGGWYCFNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSGASPKSDKNEYAFMGSLIIQEVVRELL-GKGLSGAKVLLLAGSSAGGTGVLLNVDRVAELLEELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTDAIRRGIRYWSGMVPERCQRQFKEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEG----QWLYIQNLGRELRGTLKDVQASFAPACLSHEIIIRSYWTDVQVKGTSLPRALHCWDRSFH--------------DSHKASKTPMKG------------CPFHLVDSC----------PWPH----------------CNPSCPTIRDQFTGQEMNVAQFLMHMGFDVQTVAQQQGMEPSKLLGM 498          
BLAST of Smed-notum vs. UniProt/SwissProt
Match: sp|A0A0D3QS99|NOT1_XENLA (Palmitoleoyl-protein carboxylesterase notum1 OS=Xenopus laevis OX=8355 GN=notum1 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 4.331e-74
Identity = 149/450 (33.11%), Postives = 218/450 (48.44%), Query Frame = 1
Query:  310 NVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE-KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQL 1641
            +V CNDGS  GYY + S    S++WL+FLEGGWYC ++  C+ R  T   L SS+ W   +   GILS     NP++ + N V+IPYCSSD+WSG   + + +G  F GS I+  VV +L   +       +   GSSAGG GVLLN+D +   L++     + + G+ DS WFLD   YR+++CT I  C P  A++ G++ W+  +P RCK+    G EW CF G  IY  L++P F++Q LFD+AQL +  V     P+ E     ++ YIQ LG     TL+     FA +C+ HE++T+S+W  + V    L   L+ W   L+                        KN + P     +    + L+DSC                            P CNPTC  +    +G  MS +  L      +  +A   G+   +L
Sbjct:   92 SVTCNDGSSAGYYLKESKG--SRRWLVFLEGGWYCISHENCDLRYDTMRRLMSSKAWPPAKTASGILSTQPEENPHWWNANMVFIPYCSSDVWSGASPKTEKSGYAFMGSLIIQEVVKELL-GKGLDAAKVLLLAGSSAGGTGVLLNVDLVADLLEELGYPGIQVRGLSDSGWFLDNKQYRRTDCTDIITCAPTEAIQRGIRYWSSMVPERCKQQFKEGEEWNCFFGYKIYPTLRSPVFVVQWLFDEAQLTVDNVHLSGQPVQE----SQWLYIQNLGRELRNTLKDVGASFAPACLAHEVITRSHWTEIQVRGTSLPRALHCWDRRLQETN---------------------KNSKVP-----LKGCPFHLMDSCP--------------------------WPQCNPTCPSIRDHFTGQEMSVVQFLMHLGFDVQKMASQQGMEPGKL 482          
BLAST of Smed-notum vs. UniProt/SwissProt
Match: sp|C5H5C4|NOT1A_DANRE (Palmitoleoyl-protein carboxylesterase notum1a OS=Danio rerio OX=7955 GN=notum1a PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 4.677e-74
Identity = 161/479 (33.61%), Postives = 224/479 (46.76%), Query Frame = 1
Query:  232 NDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            N  QS     ++K  Y     F  +T+V CNDG+  GYY + S    SK+WLIFLEGGWYCFN   C+SR  T   L SS  W   +   G+LS+    NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  VV DL  ++       +   GSSAGG GVLLN+D +   L++     + + G+ DS WFLD   YR ++C     C P   ++ G+K W   +P RC++    G+EW CF G  +Y  +K P FI+Q LFD+AQL +  +     P+ EG    ++ YIQ LG     TL+    +FA +C+ HE +T++ W  V V    L   L+ W   L+                 +  KSP K                 LIDSC            PH                CNPTC  +    +G  M+ I  L      +  +A   G+   +L  M
Sbjct:   77 NLAQSLYPCSAQKLDYDMKLHFLENTSVTCNDGTPAGYYLKESKG--SKRWLIFLEGGWYCFNKENCDSRYETMRRLMSSSKWPQTKTGTGMLSSLPEENPHWWNANMVFIPYCSSDVWSGASPKTDQNDYAFMGSLIIKEVVKDLL-SKGLDNAKILLLAGSSAGGTGVLLNVDSVSELLEELGHTNIQVRGLSDSGWFLDNKQYRCTDCVDTINCAPTEVIKRGIKYWGGVVPERCRQAY-EGKEWNCFFGYKVYPTIKRPVFIVQWLFDEAQLTVDNIHLTGQPVQEG----QWRYIQNLGTELRNTLKDVPAMFAPACLSHEFITRNYWTDVQVKGTSLPRALHCWDRSLQ--------------DTSRNNKSPPKG------------CPVHLIDSC----------PWPH----------------CNPTCPTIRDQSTGQEMNVIQFLMHMGFDVQKMAHQQGMDPSKLLGM 495          
BLAST of Smed-notum vs. TrEMBL
Match: A0A481SAC8 (Notum (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 435/490 (88.78%), Postives = 461/490 (94.08%), Query Frame = 1
Query:  232 NDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKF---SGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR 1692
            ND QSS SIHSRKYQYFQL KFPNS+NVRCNDGS+PGYYTRPS +NCSKKWLIFLEGGWYCFNNNTCE RRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYN+VYIPYCSSDLWSGKQ+EKT+GLYFHGSRILDTV+DDL  N +FKKV EVAFVGSSAGGIGVLLNIDRLKRR+KKKLKRKVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALR GMKLWNPRIPRRCKKFQGRG+EWKCFMGPVIYRHLKNP FIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFA+QTLRQAKGVFAHSCVDHEILTKSNWAY+SVNNQ LHETLN+WQ YL+ EKKKIKKK  +N K+ K  KS CKN+RKPK    SG ++ S+YQLIDSCHISQIT+YKIQLPHNRTLSRCA+AIPLIPLCNPTCSPLSHPISGL MSFIDLLELYNVRINLIAKSLG++M+ LRKM+TQQQISLLYCSSR
Sbjct:    1 NDQQSSGSIHSRKYQYFQLNKFPNSSNVRCNDGSVPGYYTRPSASNCSKKWLIFLEGGWYCFNNNTCELRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNAVYIPYCSSDLWSGKQIEKTDGLYFHGSRILDTVIDDLIINHNFKKVQEVAFVGSSAGGIGVLLNIDRLKRRMKKKLKRKVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRKGMKLWNPRIPRRCKKFQGRGKEWKCFMGPVIYRHLKNPVFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFASQTLRQAKGVFAHSCVDHEILTKSNWAYISVNNQCLHETLNFWQVYLDNEKKKIKKKNPRNLKINKIDKSLCKNIRKPKLPSSSGIVNPSRYQLIDSCHISQITNYKIQLPHNRTLSRCADAIPLIPLCNPTCSPLSHPISGLQMSFIDLLELYNVRINLIAKSLGVTMDNLRKMSTQQQISLLYCSSR 490          
BLAST of Smed-notum vs. TrEMBL
Match: T1E107 (Notum OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 372/496 (75.00%), Postives = 433/496 (87.30%), Query Frame = 1
Query:  208 IFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTG-KSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR 1692
            +FD ++KLN  Q+ NS H R+YQ+FQLKKFPNSTNVRCNDGSIPGYYTR S + CS+KWLIFLEGGWYCF++NTC+SR+RTHYDLFSSEFWSSERQLGGILSNNERINP F+D+N+VYIPYCSSDLWSGK+ +KT GLYFHGSRILD V+DDL++N  FKK   V FVGSSAGGIGVLLNIDR+ RR+KK  +RK+ ++GIVDSAWFLDYPAYRQSNCTHIY+CPPE A++ GM LW+PRIPRRCK+FQG  ++W+CFMG VIYRHLKNP FIIQSLFDDAQLQMSKVPILEGGSN+KFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAY+SVNNQ LH+TL YW+  L  + K+ K+K+ +  K+++ G  +  KNL + K   +    ++QLIDSCHISQ+T+   +L  NRTL+RCA+AIPLIPLCNP+C+PLSHP+SGL MSFIDLLELYNVRINLIAKSLG +M+ LRKMNTQQQISLLYCSSR
Sbjct:   37 VFDTLSKLNGQQTQNSFHGRRYQHFQLKKFPNSTNVRCNDGSIPGYYTRLSQSKCSRKWLIFLEGGWYCFDDNTCQSRKRTHYDLFSSEFWSSERQLGGILSNNERINPGFYDFNAVYIPYCSSDLWSGKRWKKTKGLYFHGSRILDAVIDDLSKNNRFKKAKSVDFVGSSAGGIGVLLNIDRIARRIKKSFRRKIPVNGIVDSAWFLDYPAYRQSNCTHIYDCPPETAIQKGMSLWSPRIPRRCKRFQGPNKQWRCFMGHVIYRHLKNPVFIIQSLFDDAQLQMSKVPILEGGSNQKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYLSVNNQGLHQTLAYWKLSLANKFKRSKQKLPRGRKIVQKGCPNSDKNLPQMK---DPSPRQFQLIDSCHISQVTNSNNRLFLNRTLTRCADAIPLIPLCNPSCTPLSHPVSGLKMSFIDLLELYNVRINLIAKSLGTTMDGLRKMNTQQQISLLYCSSR 529          
BLAST of Smed-notum vs. TrEMBL
Match: A0A5K3FN45 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.085e-124
Identity = 192/351 (54.70%), Postives = 247/351 (70.37%), Query Frame = 1
Query:  265 RKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXX-----------XXXXXXXXXVFIHGIVDSAWFLDYPAYRQ---SNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYL 1275
            R Y+ F L  F    +VRCNDG+  GYY R S    S+KW+I+LEGGWYCF+  TC SR+ T++ LFSS  W   R +GG+LS +ERINPN+HDYN++++PYCSSDLWSGK+ E T G YFHGSRIL  VVDDL Q   F +  +V FVGSSAGGIGV+LNIDRL R           +L +++   + I G+VDSAWFL+YP Y Q   S+CT IY+CPPE  +  G+ LW PRIPRRC+  QG+   W+C++GPVIY +++ P FIIQSLFD+AQLQMS+  +L GG   K +YIQ LG   A++L   +GVFA +C DHEILT ++WA + VN+Q L +TLN W A+L
Sbjct:   68 RNYKVFHLI-FLRQLDVRCNDGTRAGYYIRRSKNTNSRKWMIYLEGGWYCFDEATCISRQITNHALFSSRTWHINRYIGGVLSWDERINPNYHDYNTIFVPYCSSDLWSGKKSEPTGGYYFHGSRILTAVVDDLLQRPEFSQAEKVVFVGSSAGGIGVMLNIDRLARRIRRGLRYRRWQLTRRIATNIQISGLVDSAWFLNYPTYAQPFSSSCTSIYDCPPEEGILRGIGLWQPRIPRRCRVAQGKKNFWQCYLGPVIYSYIQTPIFIIQSLFDEAQLQMSRALLLTGGPYNKLAYIQNLGKAVAKSLDTVRGVFAPACSDHEILTTNHWAQLMVNSQSLQDTLNAWDAHL 417          
BLAST of Smed-notum vs. TrEMBL
Match: A0A0R3WAH5 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7553 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 5.442e-122
Identity = 187/351 (53.28%), Postives = 251/351 (71.51%), Query Frame = 1
Query:  265 RKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVF-----------IHGIVDSAWFLDYPAYRQS---NCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYL 1275
            R ++ FQL+ F   ++VRCNDG+  GYY R S    S+ W+I+LEGGWYCF+  TC SR+ T++ LFSS  W   R +GG+LS ++RINPN+H+YN++++PYCSSDLW+GK+ E+T G YFHGSRIL  V+DDL +   F     V F GSSAGGIGV+LNIDRL RRL++ L+ + +           I G+VDSAWFL++P Y Q+   +CT IY+CPPE  +  G+ LW PRIPRRC+  QG+   W+C++GPVIY H++ PTFIIQSLFD+AQLQMS+  +L GG   K +YIQ LG   A++L   +GVFA +C DHEILT ++WA + V++Q LH+TLN W A+L
Sbjct:   66 RNHKVFQLR-FLIQSDVRCNDGTRAGYYVRRSKDVKSRNWMIYLEGGWYCFDEATCISRQITNHALFSSRTWHMIRYIGGVLSWDDRINPNYHNYNTIFVPYCSSDLWTGKKRERTGGYYFHGSRILTAVIDDLLRQPEFTGADRVVFAGSSAGGIGVMLNIDRLARRLRRGLRYRRWQQSTRNYGRLQISGLVDSAWFLNHPTYAQAYSGSCTSIYDCPPEEGILRGIGLWQPRIPRRCRMAQGKKNFWQCYLGPVIYPHIRTPTFIIQSLFDEAQLQMSRAILLTGGPYNKLAYIQNLGKAVAKSLDTVQGVFAPACTDHEILTTNHWAQLMVDSQSLHDTLNAWDAHL 415          
BLAST of Smed-notum vs. TrEMBL
Match: A0A068Y747 (Protein notum OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 4.159e-114
Identity = 174/325 (53.54%), Postives = 229/325 (70.46%), Query Frame = 1
Query:  343 YYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNID-----------XXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQS---NCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYL 1275
            YY R S    S+ WLI+LEGGWYCF+  TC SR+ T++ LFSS  W   R +GG+LS ++RINPN+H+YN++++PYCSSDLW+GK+ E+T G YFHGSRIL  V+DDL +   F +V +V F GSSAGGIGV+LNID             + R   +   ++ I G+VDSAWFL YP Y Q+   +CT IY+CPPE  +  G+ LW PRIPRRC+  QG+   W+C++GPVIY HL+ PTFIIQSLFD+AQLQMS+  +L GGS  K +YIQ LG   A++L   +GVFA +C DHEILT ++WA + V++Q LH+TL  W A+L
Sbjct:  197 YYVRRSKDLKSRNWLIYLEGGWYCFDEATCISRQITNHALFSSRTWHMIRYIGGVLSWDDRINPNYHNYNTIFVPYCSSDLWTGKKRERTGGYYFHGSRILTAVIDDLLRQPEFIRVDKVVFSGSSAGGIGVMLNIDRLARRLRRGLRYRRWRQSTRNYSRLQISGLVDSAWFLHYPTYAQAYSGSCTSIYDCPPEEGILRGIGLWQPRIPRRCRMAQGKKNFWQCYLGPVIYSHLRTPTFIIQSLFDEAQLQMSRAILLTGGSYNKLAYIQNLGKAVAKSLDTVQGVFAPACTDHEILTTNHWAQLMVDSQSLHDTLKAWDAHL 521          

HSP 2 Score: 60.8474 bits (146), Expect = 7.468e-6
Identity = 25/68 (36.76%), Postives = 42/68 (61.76%), Query Frame = 1
Query: 1480 CANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYC 1683
            CA    + PLCNP+C  L+HP +   +S + L ELY V    +A ++G+S+ QL+ +  + Q+ +L+C
Sbjct:  647 CAGRSHMTPLCNPSCRTLTHPHTMERLSVVSLYELYGVDSAQLAANIGVSVTQLKALPVKMQMQMLFC 714          
BLAST of Smed-notum vs. Ensembl Cavefish
Match: notum1a (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:103027144])

HSP 1 Score: 241.506 bits (615), Expect = 6.736e-72
Identity = 155/479 (32.36%), Postives = 223/479 (46.56%), Query Frame = 1
Query:  232 NDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            N  QS     ++K  Y     F  + +V CNDG+  GYY + S    S++WLIFLEGGWYCFN   C+SR  T   L SS  W   +   GILS+    NP++ + N V++PYCSSD+WSG   +     Y F GS I+  VV DL  ++       +   GSSAGG GVLLN+D +   L++     + + G+ DS WFLD   YR + C     C P  A++ G+K W   +P RC++   +  +WKCF G  +Y  ++ P F++Q LFD+AQL +  +     P+ EG    ++ YIQ LG     TL+    +FA +C+ HE++T++ W  + V    L   L+ W   L                         KN +     G        LIDSC            PH                CNPTC  +    +G  M+ I  L      +  +A+  G+   +L  M
Sbjct:   81 NLAQSLYPCSAQKLDYDMKLHFVENASVTCNDGTPAGYYLKESRG--SRRWLIFLEGGWYCFNKENCDSRYETMRRLMSSSKWPQTKTGTGILSSLPEENPHWWNANMVFLPYCSSDVWSGATPKTDQNDYAFMGSLIIKEVVKDLL-SKGLDNGKILLLAGSSAGGTGVLLNVDAVAELLEQLGHPNIQVRGLSDSGWFLDNNQYRSTVCVDTISCAPTEAIKRGIKYWGGVVPERCRQ-ANKESDWKCFFGYQVYPTIRRPVFVVQWLFDEAQLTVDNIHLTGQPVQEG----QWRYIQNLGIELRNTLKDVPALFAPACLSHEVITRNYWIDIQVKGTSLPRALHCWDRSLHDNN---------------------KNNKTTHHKG----CPMHLIDSC----------PWPH----------------CNPTCPTIRDQATGQEMNVIQFLMHMGFDVQKMAQQQGMDPSKLLGM 500          
BLAST of Smed-notum vs. Ensembl Cavefish
Match: notum2 (carboxylesterase notum2-like [Source:NCBI gene;Acc:103040225])

HSP 1 Score: 236.498 bits (602), Expect = 3.154e-70
Identity = 130/334 (38.92%), Postives = 190/334 (56.89%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSG-------KQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGG---SNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLE 1278
            T   CNDG+  G+Y +      SK+WLIFLEGGW C+N +TC+SR +    L SS  W   R+  GILS     NP++++ N V++PYCSSD+WSG       KQ ++T    F GS I+  V+ DL  ++  K+   V   G+SAGG GVLLNI+       ++L     + G+VDS WFL+    + S+C     C P +A++ G++LWN  IP +CK+   RG EW+CF G  ++  L  P F++Q LFD+ QL++  + +  GG   S ++++Y+Q LG     +L+    VFA SC+ H ++TKSNW    V    L   L  W   L+
Sbjct:   82 TPAICNDGTAAGFYLK--EFKGSKRWLIFLEGGWCCYNKDTCDSRYKNIPRLMSSSDWPQTRKGSGILSAQADENPHWYNANIVFVPYCSSDVWSGNKPAVKAKQGKETE-YSFVGSVIIREVIKDLA-SKGIKQAKVVMLAGTSAGGTGVLLNIE-KVASQLEQLGADTQVRGLVDSGWFLE-SKQKASDCPDSVSCTPVDAIKKGIRLWNGVIPEKCKQHYKRGEEWQCFFGHKLFSFLSTPLFVVQWLFDEEQLRVENIYL--GGQSLSEQQWTYMQNLGKELKNSLKDVTAVFAPSCLSHTLITKSNWMDFQVKGTSLSRALQCWDRSLQ 407          
BLAST of Smed-notum vs. Ensembl Cavefish
Match: notum2 (carboxylesterase notum2-like [Source:NCBI gene;Acc:103040225])

HSP 1 Score: 236.498 bits (602), Expect = 3.154e-70
Identity = 130/334 (38.92%), Postives = 190/334 (56.89%), Query Frame = 1
Query:  307 TNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSG-------KQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGG---SNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLE 1278
            T   CNDG+  G+Y +      SK+WLIFLEGGW C+N +TC+SR +    L SS  W   R+  GILS     NP++++ N V++PYCSSD+WSG       KQ ++T    F GS I+  V+ DL  ++  K+   V   G+SAGG GVLLNI+       ++L     + G+VDS WFL+    + S+C     C P +A++ G++LWN  IP +CK+   RG EW+CF G  ++  L  P F++Q LFD+ QL++  + +  GG   S ++++Y+Q LG     +L+    VFA SC+ H ++TKSNW    V    L   L  W   L+
Sbjct:   82 TPAICNDGTAAGFYLK--EFKGSKRWLIFLEGGWCCYNKDTCDSRYKNIPRLMSSSDWPQTRKGSGILSAQADENPHWYNANIVFVPYCSSDVWSGNKPAVKAKQGKETE-YSFVGSVIIREVIKDLA-SKGIKQAKVVMLAGTSAGGTGVLLNIE-KVASQLEQLGADTQVRGLVDSGWFLE-SKQKASDCPDSVSCTPVDAIKKGIRLWNGVIPEKCKQHYKRGEEWQCFFGHKLFSFLSTPLFVVQWLFDEEQLRVENIYL--GGQSLSEQQWTYMQNLGKELKNSLKDVTAVFAPSCLSHTLITKSNWMDFQVKGTSLSRALQCWDRSLQ 407          
BLAST of Smed-notum vs. Ensembl Cavefish
Match: notum1a (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:103027144])

HSP 1 Score: 213.386 bits (542), Expect = 1.733e-61
Identity = 149/479 (31.11%), Postives = 210/479 (43.84%), Query Frame = 1
Query:  232 NDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKV-----PILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            N  QS     ++K  Y     F  + +V CNDG+  GYY + S    S++WLIFLEGGWYCFN   C+SR  T   L SS  W   +   GILS+    NP++ + N V++PYCSSD+WSG   +     Y F GS I+  VV DL  ++       +   GSSAGG GVLLN+D +   L++     + + G+ DS WFLD   YR + C     C P  A++ G+K W   +P RC++   +  +WKCF G  +Y  ++ P F++Q LFD+AQL +  +     P+ EG    ++ YIQ LG     TL+                    W  + V    L   L+ W   L                         KN +     G        LIDSC            PH                CNPTC  +    +G  M+ I  L      +  +A+  G+   +L  M
Sbjct:   81 NLAQSLYPCSAQKLDYDMKLHFVENASVTCNDGTPAGYYLKESRG--SRRWLIFLEGGWYCFNKENCDSRYETMRRLMSSSKWPQTKTGTGILSSLPEENPHWWNANMVFLPYCSSDVWSGATPKTDQNDYAFMGSLIIKEVVKDLL-SKGLDNGKILLLAGSSAGGTGVLLNVDAVAELLEQLGHPNIQVRGLSDSGWFLDNNQYRSTVCVDTISCAPTEAIKRGIKYWGGVVPERCRQ-ANKESDWKCFFGYQVYPTIRRPVFVVQWLFDEAQLTVDNIHLTGQPVQEG----QWRYIQNLGIELRNTLKDVP----------------YWIDIQVKGTSLPRALHCWDRSLHDNN---------------------KNNKTTHHKG----CPMHLIDSC----------PWPH----------------CNPTCPTIRDQATGQEMNVIQFLMHMGFDVQKMAQQQGMDPSKLLGM 484          
BLAST of Smed-notum vs. Ensembl Cavefish
Match: ENSAMXT00000021130.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:28109530:28127000:-1 gene:ENSAMXG00000020491.2 transcript:ENSAMXT00000021130.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.838 bits (525), Expect = 3.033e-59
Identity = 147/464 (31.68%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  265 RKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPIL-EGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            R  Q  +L+   NST V CNDGS  GYY R S    S++WL+FLEG            + RT         W +     GILS     NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  V+ +L   +       +   GSSAGG GVLLN+DR+   LK +    + + G+ DS WFLD   YR ++C     C P  A++ G++ W   +P RC +    G EW CF G  +Y  LK+P F++Q LFD+AQL +  V ++ +     ++ YIQ LG     TL+    +FA +C+ HE++T+S W  + V    L   L  W   L            +N     + +SP +                 LIDSC            PH                CNPTC  +   ++G  M+ I  L      +  +A+  G+   +L  M
Sbjct:   78 RLDQDMKLRFLENST-VTCNDGSPAGYYIRESKG--SRRWLVFLEG------------KYRT--------LWCT-----GILSPQPEENPHWWNANMVFIPYCSSDVWSGATPKTDQNDYAFMGSLIIQEVIKELL-TKGLDNAKVLLLAGSSAGGTGVLLNVDRVAELLKSRGHGSIQVRGLADSGWFLDNEQYRCTDCVDTMSCAPTEAIKRGIRYWGGVVPERC-RLAHTGAEWNCFFGYKVYPTLKSPVFVVQWLFDEAQLTVDNVHLMGQPVQEDQWRYIQNLGIDLRNTLKNVPAMFAPACLSHEVITRSYWMDIQVKGTSLPRALQCWDRSLH--------HSLRNHGNSSSPRSPPRG------------CPLHLIDSC----------PWPH----------------CNPTCPAIRDQLTGREMNVIQFLTHMGFDVQRMAQQQGLDPNKLLGM 465          
BLAST of Smed-notum vs. Ensembl Nematostella
Match: EDO46655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB3])

HSP 1 Score: 197.978 bits (502), Expect = 4.282e-57
Identity = 117/337 (34.72%), Postives = 174/337 (51.63%), Query Frame = 1
Query:  280 FQLK-KFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYD-LFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNG--LYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSN---KKFSYIQQLGGFAAQTLRQA--KGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYW 1263
            F LK  +    N  CNDGS  GYY + S    SK+WL++LEGGW+C+N  +C  R  +    L +S+ WS  ++  G+LS     NPN+ + N V IPYCSSD WSG       G    F G+RIL+ V++DL     +   H +   GSSAGGIGV+LN+D         +   V + G+ DS W+L    +  S    + EC P   ++ GM  W   +P  C K +   + W C+ G  +Y  +  P FI Q L+D+AQL +       G      K+   I ++G    ++L++A  + VF+ +C+ H ILT S+W  + +    L++ L  W
Sbjct:   27 FDLKLHYLTDVNTTCNDGSPAGYYLKESPK--SKRWLVYLEGGWFCYNQMSCNIRANSQMRYLMTSKNWSKTKRGNGMLSPQPEENPNWWNANHVLIPYCSSDAWSGNASRHETGEKFSFLGARILEKVIEDLLPRGLYNAKH-LLLAGSSAGGIGVILNLD-RISTKLHAMGFAVEVRGLADSGWYLSDRPFESSCPPGVKECGPVKTIKEGMMYWRGIVPENCTK-ENLLQPWMCYFGETVYPTITAPLFIFQWLYDEAQLALDGSIQPRGIQTIDLKQIKTIFKIGRKIRESLKRARVRHVFSPACISHTILTHSSWLNIRLKGASLNDILTCW 358          
BLAST of Smed-notum vs. Ensembl Nematostella
Match: EDO39429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA46])

HSP 1 Score: 130.954 bits (328), Expect = 2.017e-33
Identity = 93/342 (27.19%), Postives = 158/342 (46.20%), Query Frame = 1
Query:  313 VRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE----KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYR-----QSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQL-QMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAK--------GVFAHSCVDH-EILTKSNWAYVSVNNQRLHETLNYWQAYLEG 1281
             +C DGS+P Y+ R      + KW+++L+GG +C +   C  R +T  +L SS  +      GGILS+    N +FH +N VY+PYC    ++G + +    K   LY  G RIL  ++DDL   +  +   +V F G+SAG + VL+N D +K+RL         +  + DS  FL+ P  +       +   +YE      L +     NP    +C + +     W+C       R ++ P +++  L+D  QL  +  V  +    +     ++ +  F  +TL   +         VF   C+DH +++    W  + VN Q +HE  + W   ++G
Sbjct:    7 AKCLDGSLPAYFYRRGHGAGTHKWILYLQGGAWCDSAENCYHRSKT--NLGSSRNYKHLMDAGGILSDKMHENKHFHSWNVVYVPYCDGASFTGNRSDPVVVKGQRLYMRGKRILSALIDDLLV-KGLQNATDVVFTGTSAGALAVLMNADYVKQRLPASTS----MVALSDSGVFLNEPDLKGVKKFGKSMKRVYE------LHDSADSINP----KCARKKAAKDRWECMFPAEFVRSIETPVYMVNPLYDAWQLANVVGVRCVYSPESCDKHEMKVIREFRKKTLNALEPILRNKNHKVFGDGCIDHGQVIFDKKWNEIKVNKQAMHEAFHEWHQDVKG 331          
BLAST of Smed-notum vs. Ensembl Nematostella
Match: EDO47398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLV4])

HSP 1 Score: 125.176 bits (313), Expect = 3.196e-31
Identity = 99/361 (27.42%), Postives = 162/361 (44.88%), Query Frame = 1
Query:  262 SRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSE-RQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLE----KTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPR--IPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGG--------------SNKKFSYIQQLGGFAAQTLR-----QAKGVFAHSCVDH-EILTKSNWAYVSVNNQRLHETLNYW 1263
            SR  Q   LK       V C DGS PGYY R  +   S  W++   GG +C++   C  R +T   L SS+++     +L G+LS + RINP+FHD+N V I YC    ++G + E    +   +Y  G RIL+ ++D L  +Q F K   V   G+SAGG+ V+L+ D     ++ KL + + +  + DS +F+D  +    N  + +        +   ++ N    + + C +    G +WKC      +R L  P FI+QS +D  Q+   + P                   ++++   I Q        L      +  G+   SC++H + L    W  + VN   + E +  W
Sbjct:   11 SRDVQLILLKSAVKQGAV-CLDGSPPGYYYREGSGKGSDNWVLHFFGGAWCYDEEACLQRSKT--VLGSSKYFPEHPPKLQGVLSGDARINPDFHDWNLVMICYCDGASFTGYRTEPVSIRGELIYMRGKRILEAIMDQLLSSQ-FSKAKRVLLTGTSAGGLSVVLHAD----YIRNKLPKSMALRAMSDSGYFVDIASLNGGNIINRH-------FKRMFEVHNSTAGVQQDCVRDAEPGYQWKCLFPQHTFRFLSTPIFILQSAYDAWQIIHVRGPHPSWAYRHIHGIYCKPPECTSRELKAIMQYRNITLHALHPVLRSRTSGLLLTSCMEHSQSLYDDTWTKLYVNGLPVSEIVGDW 356          
BLAST of Smed-notum vs. Ensembl Nematostella
Match: EDO38898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBM6])

HSP 1 Score: 80.4925 bits (197), Expect = 4.352e-16
Identity = 62/210 (29.52%), Postives = 102/210 (48.57%), Query Frame = 1
Query:  241 QSSNSIHSRKYQYFQLKKF----PNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTN--GLYFHGSRILDTVVDDLTQNQHFKKVHEVA-FVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAW-FLDYPAY 846
            + + S+  RK   + L+K         N  C DGS   +Y   S    SK W+I L+ G  C ++ TC  R +  +   SS+ +        + S+N   NP F  +N V +PYCS D++ G++ ++T+  GL   G  I+  VV  L  +        V  F G+SAGG+G+L N+D   +++    K  +F+H +  + + +L  P Y
Sbjct:   50 RKTRSVRPRKKYRYNLRKHEIRDARDRNALCLDGSPAVFYL--SRNPYSKDWVIQLQAGGSCGDHKTCHERAKGSFG--SSKDYELYMTGSFLSSDNPNENPTFASWNKVLVPYCSGDVFVGRKTKETHPYGLQMLGHFIVKAVVQQLMDDYKINTTGTVILFGGASAGGLGMLANVD-FVQQMVLPAKVHLFLHVVCSAVFKYLSTPIY 254          
BLAST of Smed-notum vs. Ensembl Medaka
Match: notum1a (notum, palmitoleoyl-protein carboxylesterase [Source:NCBI gene;Acc:101171916])

HSP 1 Score: 244.973 bits (624), Expect = 2.309e-73
Identity = 152/458 (33.19%), Postives = 215/458 (46.94%), Query Frame = 1
Query:  295 FPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLY-FHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQL-----QMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKM 1650
            F  +T+V CNDGS  GYY + S    S++WLIFLEGGWYCFN   C++R  T     SS  W   +   GILS     NP++ + N V+IPYCSSD+WSG   +     Y F GS I+  VV DL  N+       +   GSSAGG GVLLN+D +   L+      + + G+ DS WFLD   Y+ ++C     C P   ++ G K W   +P RC++    G EW CF G  ++  +K+P F++Q LFD+AQL     Q++  P+ EG    ++ YIQ LG     TL+    +FA +C+ HE++T++ W  V V    L   L+ W   L+                 +  K+P K                 LIDSC            PH                CNPTC  +    +G  M+    L      +  +A+  G+   +L  M
Sbjct:   95 FLKNTSVTCNDGSPAGYYLKESRG--SRRWLIFLEGGWYCFNKENCDTRYETMRRFMSSSKWPHTKTGTGILSPLPEENPHWWNANMVFIPYCSSDVWSGATAKTEQNFYAFMGSLIIQEVVKDLL-NKGLDNAKVLLLAGSSAGGTGVLLNVDGVAELLEGLGHTGIQVRGLSDSGWFLDNKQYQCTDCGDTASCAPTETIKRGFKYWGAVVPERCRQTH-EGEEWNCFFGYRVFPSIKSPVFVVQWLFDEAQLTVDNIQLTGQPVQEG----QWRYIQNLGTELRNTLKDVPAMFAPACLSHEVITRNYWIDVQVKGTSLPRALHCWDRSLQDN---------------RNNKAPPK------------ACPVHLIDSC----------PWPH----------------CNPTCPTIRDQFTGQEMNVFQFLMHMGFDVQKMAQQQGMDPSKLLGM 491          
BLAST of Smed-notum vs. Ensembl Medaka
Match: notum2 (carboxylesterase notum2 [Source:NCBI gene;Acc:101157515])

HSP 1 Score: 239.965 bits (611), Expect = 2.963e-71
Identity = 126/349 (36.10%), Postives = 194/349 (55.59%), Query Frame = 1
Query:  295 FPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSG-------------------KQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPI-LEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEG 1281
            F  +T V CNDG+  G+Y + S  N  ++W++FLEGGW C++  +C++R +T   L SS  W   +   GILS+    NP++++ N V+IPYCSSD+W+G                   ++   T    F GS I+  V+ DL   +  K    +   G+SAGG GVLLNI+R+  +L +       + G+VDS WFL+    R +NC     C PE+A++NG++LWN  +P +C++   +G EW+CF G  +Y  L +P F++Q LFD+ QL++  + +  +  S++++ YIQ LG     +LR    VFA SC+ H ++TKS W    V    L   L+ W   LE 
Sbjct:   88 FLRNTQVTCNDGTAAGFYLKESRGN--RRWILFLEGGWCCYSKESCDARYQTVPRLMSSTVWPQIKTGTGILSSRAEENPHWYNANRVFIPYCSSDVWTGTGPAPTPPTRQRQGRDKIKERNTNTTEYSFMGSLIIREVIKDLIP-KGIKMAKVIMLAGTSAGGTGVLLNIERVASQLAQLGTD-AQVRGLVDSGWFLESKKERPTNCPETVSCSPEDAIKNGLRLWNGAVPEQCQQLYQKGEEWQCFFGHRLYSTLTSPLFVVQWLFDEEQLRVENIYMGAQSLSDEQWQYIQNLGLELKNSLRGVTAVFAPSCLSHTVITKSEWMSFQVKGTTLPRALHCWDRSLEA 432          
BLAST of Smed-notum vs. Planmine SMEST
Match: SMESG000004222.1 (SMESG000004222.1)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 496/496 (100.00%), Postives = 496/496 (100.00%), Query Frame = 1
Query:  205 LIFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDXXXXXXXXXXXXXVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEXXXXXXXXXXXXXXXXTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR 1692
            LIFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDRLKRRLKKKLKRKVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEKKKIKKKVQKNPKLIKTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR
Sbjct:   32 LIFDRINKLNDPQSSNSIHSRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWYCFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVYIPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFVGSSAGGIGVLLNIDRLKRRLKKKLKRKVFIHGIVDSAWFLDYPAYRQSNCTHIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLKNPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKGVFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEKKKIKKKVQKNPKLIKTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPHNRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIAKSLGISMEQLRKMNTQQQISLLYCSSR 527          
The following BLAST results are available for this feature:
BLAST of Smed-notum vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NOTUM1.154e-7334.36notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
NOTUM1.835e-4443.56notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
NOTUM1.718e-4040.00notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
back to top
BLAST of Smed-notum vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-notum vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Notum1.543e-5936.29gene:FBgn0044028 transcript:FBtr0075435[more]
back to top
BLAST of Smed-notum vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
notum1a6.196e-7533.61notum, palmitoleoyl-protein carboxylesterase a [So... [more]
notum24.499e-7036.97Danio rerio notum pectinacetylesterase 2 (notum2),... [more]
notum24.499e-7036.97Danio rerio notum pectinacetylesterase 2 (notum2),... [more]
back to top
BLAST of Smed-notum vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notum2.399e-7533.33notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
notum2.539e-7533.33notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
prdm53.932e-6731.97PR domain 5 [Source:Xenbase;Acc:XB-GENE-854777][more]
notum2.265e-6532.22notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
notum1.363e-5729.84notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
back to top
BLAST of Smed-notum vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Notum2.306e-7534.14notum palmitoleoyl-protein carboxylesterase [Sourc... [more]
Notum2.306e-7534.14notum palmitoleoyl-protein carboxylesterase [Sourc... [more]
Notum1.095e-2549.12notum palmitoleoyl-protein carboxylesterase [Sourc... [more]
back to top
BLAST of Smed-notum vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F8U830|NOTUM_SCHMD0.000e+0100.00Palmitoleoyl-protein carboxylesterase NOTUM OS=Sch... [more]
sp|A0A0D3QS97|NOTU2_XENLA2.796e-7734.50Palmitoleoyl-protein carboxylesterase notum2 OS=Xe... [more]
sp|Q8R116|NOTUM_MOUSE1.613e-7434.14Palmitoleoyl-protein carboxylesterase NOTUM OS=Mus... [more]
sp|A0A0D3QS99|NOT1_XENLA4.331e-7433.11Palmitoleoyl-protein carboxylesterase notum1 OS=Xe... [more]
sp|C5H5C4|NOT1A_DANRE4.677e-7433.61Palmitoleoyl-protein carboxylesterase notum1a OS=D... [more]
back to top
BLAST of Smed-notum vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481SAC80.000e+088.78Notum (Fragment) OS=Dugesia japonica OX=6161 PE=2 ... [more]
T1E1070.000e+075.00Notum OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A5K3FN451.085e-12454.70Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3WAH55.442e-12253.28Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068Y7474.159e-11453.54Protein notum OS=Echinococcus multilocularis OX=62... [more]
back to top
BLAST of Smed-notum vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notum1a6.736e-7232.36notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
notum23.154e-7038.92carboxylesterase notum2-like [Source:NCBI gene;Acc... [more]
notum23.154e-7038.92carboxylesterase notum2-like [Source:NCBI gene;Acc... [more]
notum1a1.733e-6131.11notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
ENSAMXT00000021130.23.033e-5931.68pep primary_assembly:Astyanax_mexicanus-2.0:5:2810... [more]
back to top
BLAST of Smed-notum vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-notum vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-notum vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO466554.282e-5734.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394292.017e-3327.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473983.196e-3127.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388984.352e-1629.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Smed-notum vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
notum1a2.309e-7333.19notum, palmitoleoyl-protein carboxylesterase [Sour... [more]
notum22.963e-7136.10carboxylesterase notum2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Smed-notum vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000004222.10.000e+0100.00SMESG000004222.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010051
GenBankF8U830
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010051 ID=SMED30010051|Name=Smed-notum|organism=Schmidtea mediterranea sexual|type=transcript|length=1917bp
TATAAATATCGACGATCACATAACTAACCAAAGTTAAATCTAAAATTTCT
GAGGATCGAAAAAATTGAAAACTATTCTTCAAATATTTGGTTTTTATTCC
AGGATCAAAAAATGAAATCATATCTGATATTGAATACTCTTCTATTGAGC
CTATTGAAGATCAATGGATTTTCCAAATCGTCTTGGTTCAGTTCAAAGAC
TTCGTTGATTTTCGATCGAATCAACAAATTGAATGATCCGCAATCCAGTA
ATTCAATTCACAGTAGAAAATATCAGTATTTTCAGTTGAAAAAATTTCCA
AATTCTACAAACGTTCGCTGCAATGACGGAAGCATTCCAGGTTATTACAC
CCGCCCATCGACAACAAATTGTTCAAAAAAATGGCTCATCTTTTTAGAAG
GAGGATGGTATTGTTTTAACAACAATACTTGTGAATCCCGTAGACGAACT
CATTATGATTTATTTTCATCAGAATTTTGGTCTTCTGAACGGCAACTTGG
AGGAATTCTTTCTAATAATGAGCGAATCAATCCAAATTTTCATGACTATA
ATTCAGTGTATATTCCTTACTGTTCGAGTGATTTGTGGTCTGGCAAACAA
TTAGAAAAAACTAATGGATTATATTTCCATGGATCTCGAATTTTAGACAC
AGTCGTTGATGATTTGACCCAAAACCAGCATTTTAAAAAGGTTCATGAAG
TAGCTTTTGTTGGATCGAGCGCTGGTGGAATCGGAGTTTTGTTGAATATC
GATAGGCTGAAAAGACGATTGAAGAAAAAACTTAAACGAAAAGTATTTAT
TCATGGAATAGTCGATTCAGCGTGGTTTCTCGATTATCCGGCGTATAGAC
AGTCAAACTGTACCCATATTTACGAATGCCCTCCAGAAAATGCCCTTAGA
AATGGAATGAAATTATGGAATCCTCGAATTCCGAGAAGATGCAAGAAATT
CCAAGGTCGCGGTAGGGAATGGAAATGTTTCATGGGTCCTGTCATATATA
GGCACTTGAAAAATCCAACTTTCATTATACAAAGTCTATTTGATGACGCT
CAACTGCAGATGTCAAAAGTCCCGATTTTAGAAGGAGGATCTAACAAAAA
GTTTTCATACATTCAACAATTAGGAGGTTTTGCAGCTCAGACTTTGAGGC
AGGCAAAAGGAGTATTCGCTCATTCTTGTGTTGATCATGAAATTTTAACA
AAAAGTAATTGGGCTTATGTTAGTGTCAACAATCAACGACTCCACGAAAC
GCTAAATTATTGGCAAGCATATTTAGAAGGTGAAAAGAAAAAAATAAAGA
AAAAAGTCCAAAAAAATCCGAAACTTATCAAAACCGGCAAGTCTCCATGT
AAAAACTTGAGAAAGCCCAAGTTTTCTGGAAACATTGATCAAAGTAAATA
CCAATTGATTGACTCTTGCCACATTAGTCAAATTACGAGCTACAAAATAC
AGTTACCCCATAATCGAACTTTATCAAGATGTGCTAATGCCATTCCTTTG
ATTCCTTTATGCAATCCAACATGTTCACCGCTTTCCCACCCGATATCTGG
TCTCAGTATGTCCTTCATTGATCTACTGGAATTGTATAACGTTCGCATAA
ACTTAATTGCGAAATCGTTGGGTATCTCAATGGAACAATTGCGAAAAATG
AACACTCAACAACAAATAAGTTTACTTTATTGTAGCAGTCGATAAATTTT
GTTTGGTTAACGAAACCTATTCTTATCTCAGACCTACCTCTAATAATTGA
TGATTTTTTATGGCACATCTCACTCAATTTAATCCATCGATCTAGCTCTA
ATTCAAGATTTTAGATGGTTTTTTATGTTATGCATTTAACAATATTTTTG
TTATCTTTTCTGTTTTTAGTTGACTCTAGAATTGAATTTGAAAATTATTC
TTTACTCATGATACTAC
back to top

protein sequence of SMED30010051-orf-1

>SMED30010051-orf-1 ID=SMED30010051-orf-1|Name=SMED30010051-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=528bp
MKSYLILNTLLLSLLKINGFSKSSWFSSKTSLIFDRINKLNDPQSSNSIH
SRKYQYFQLKKFPNSTNVRCNDGSIPGYYTRPSTTNCSKKWLIFLEGGWY
CFNNNTCESRRRTHYDLFSSEFWSSERQLGGILSNNERINPNFHDYNSVY
IPYCSSDLWSGKQLEKTNGLYFHGSRILDTVVDDLTQNQHFKKVHEVAFV
GSSAGGIGVLLNIDRLKRRLKKKLKRKVFIHGIVDSAWFLDYPAYRQSNC
THIYECPPENALRNGMKLWNPRIPRRCKKFQGRGREWKCFMGPVIYRHLK
NPTFIIQSLFDDAQLQMSKVPILEGGSNKKFSYIQQLGGFAAQTLRQAKG
VFAHSCVDHEILTKSNWAYVSVNNQRLHETLNYWQAYLEGEKKKIKKKVQ
KNPKLIKTGKSPCKNLRKPKFSGNIDQSKYQLIDSCHISQITSYKIQLPH
NRTLSRCANAIPLIPLCNPTCSPLSHPISGLSMSFIDLLELYNVRINLIA
KSLGISMEQLRKMNTQQQISLLYCSSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003109anterior pole cell
PLANA:0007524anterior pole
Vocabulary: INTERPRO
TermDefinition
IPR004963PAE/NOTUM
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0052689carboxylic ester hydrolase activity
GO:1990699palmitoleyl hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0030178negative regulation of Wnt signaling pathway
GO:1990697protein depalmitoleylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004963Pectinacetylesterase/NOTUMPFAMPF03283PAEcoord: 65..385
e-value: 1.8E-66
score: 224.7
IPR004963Pectinacetylesterase/NOTUMPANTHERPTHR21562NOTUM-RELATEDcoord: 44..405
NoneNo IPR availablePANTHERPTHR21562:SF45PALMITOLEOYL-PROTEIN CARBOXYLESTERASE NOTUMcoord: 44..405
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.569