Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30010050
Length (bp)1955
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30010050) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30010050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30010050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30010050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010050SMESG000017274.1 Contig3109GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010050SMESG000063568.1 Contig4276uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010050SMESG000063568.1 Contig4276newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30010050SMESG000017277.1 SMESG000017274.1 dd_Smed_v4_639_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010050SMESG000017277.1 SMESG000017274.1 dd_Smed_v4_639_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010050SMESG000017277.1 SMESG000017274.1 dd_Smed_v4_639_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010050SMESG000017277.1 SMESG000017274.1 dd_Smed_v4_639_2_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 152.91 bits (385), Expect = 1.359e-38
Identity = 89/263 (33.84%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 152.91 bits (385), Expect = 1.452e-38
Identity = 89/263 (33.84%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  357 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELL 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 152.91 bits (385), Expect = 1.688e-38
Identity = 89/263 (33.84%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  388 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELL 644          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 152.91 bits (385), Expect = 1.727e-38
Identity = 89/263 (33.84%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  392 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELL 648          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 152.91 bits (385), Expect = 1.727e-38
Identity = 89/263 (33.84%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  392 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELL 648          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 141.739 bits (356), Expect = 3.170e-35
Identity = 93/265 (35.09%), Postives = 145/265 (54.72%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQ----MKSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            F K   IGRG+FG+VYK   +    V AIK ++ E  +++   I+  I + L++ D Q + KYFG+      L + MEY   GS   +++  G ++  ++    ++IL+GL++LH  + IHRDIK  N+L+ E  ++K+ADFG+   L  T  K  RI T VG+  + APE+++ +    Y   ADIWS+G T I + +G PP+ +     V+F +        P P L   Q     K F+E  LN +P+ R SA+ LLK +  
Sbjct:   14 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSA-LDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKK--RI-TFVGSPFWMAPELIKQSS---YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPK-----NPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 141.739 bits (356), Expect = 3.255e-35
Identity = 93/265 (35.09%), Postives = 145/265 (54.72%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQM----KSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            F K   IGRG+FG+VYK   +    V AIK ++ E  +++   I+  I + L++ D Q + KYFG+      L + MEY   GS   +++  G ++  ++    ++IL+GL++LH  + IHRDIK  N+L+ E  ++K+ADFG+   L  T  K  RI T VG+  + APE+++ +    Y   ADIWS+G T I + +G PP+ +     V+F +        P P L   Q     K F+E  LN +P+ R SA+ LLK +  
Sbjct:   34 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSA-LDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKK--RI-TFVGSPFWMAPELIKQSS---YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPK-----NPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 141.739 bits (356), Expect = 3.472e-35
Identity = 93/265 (35.09%), Postives = 145/265 (54.72%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQ----MKSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            F K   IGRG+FG+VYK   +    V AIK ++ E  +++   I+  I + L++ D Q + KYFG+      L + MEY   GS   +++  G ++  ++    ++IL+GL++LH  + IHRDIK  N+L+ E  ++K+ADFG+   L  T  K  RI T VG+  + APE+++ +    Y   ADIWS+G T I + +G PP+ +     V+F +        P P L   Q     K F+E  LN +P+ R SA+ LLK +  
Sbjct:   19 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSA-LDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKK--RI-TFVGSPFWMAPELIKQSS---YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPK-----NPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 141.739 bits (356), Expect = 7.008e-35
Identity = 93/265 (35.09%), Postives = 145/265 (54.72%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQ----MKSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            F K   IGRG+FG+VYK   +    V AIK ++ E  +++   I+  I + L++ D Q + KYFG+      L + MEY   GS   +++  G ++  ++    ++IL+GL++LH  + IHRDIK  N+L+ E  ++K+ADFG+   L  T  K  RI T VG+  + APE+++ +    Y   ADIWS+G T I + +G PP+ +     V+F +        P P L   Q     K F+E  LN +P+ R SA+ LLK +  
Sbjct:  184 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSA-LDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKK--RI-TFVGSPFWMAPELIKQSS---YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPK-----NPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 435          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 135.961 bits (341), Expect = 3.085e-33
Identity = 91/266 (34.21%), Postives = 142/266 (53.38%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEEN-NIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQ----MKSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            F K   IGRG+FG+VYK   +    V AIK ++ E  +++   I+  I + L++ D Q + KYFG+      L + MEY   GS   +++  G ++  ++    ++IL+GL++LH  + IHRDIK  N+LLD +   +K+ D+G+ + L        + +T VGT  F APEV++      Y   ADIWS+G T I + +G PP+ +     V+F +        P P L   Q     K F+E  LN +P+ R SA+ LLK +  
Sbjct:   34 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSA-LDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVL----KANTFVGTPFFMAPEVVKGE----YSIEADIWSLGITAIELANGEPPHSDLHPMRVLFLIPK-----NPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 135.576 bits (340), Expect = 4.273e-33
Identity = 92/260 (35.38%), Postives = 139/260 (53.46%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLM---TVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            F K   IG+G+FG+V+K   +    V AIK ++ E  +++   I+  I   L++ D   + KY+G+      L + MEY   GS   ++   GS E  ++    +++L+GL +LH  + +HRDIK  N+LL E+ ++KLADFG+   L  T  K    +T VGT  + APEV++ +    Y   ADIWS+G T I +  G PP        V+F    L   + P PQL    T   K F+E  LN +P+ R +A +LLK
Sbjct:   13 FTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIM-VLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSA-LDLMKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKR---NTFVGTPFWMAPEVIKQSQ---YDAKADIWSLGITAIELAKGEPPNSELHPMRVLF----LIPKNNP-PQLTGSYTKSFKDFVEACLNKDPENRPTAKELLK 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 132.88 bits (333), Expect = 4.746e-32
Identity = 82/258 (31.78%), Postives = 131/258 (50.78%), Query Frame = 1
Query:  331 DKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ + K   IG+GA G VY    S      AIK+MN     +K +  N    + +  H  +V Y  +    + L + MEY P GSL T++  +  ++   +    +++L+ L+FLH N++IHRDIK DNILL  + ++KL DFG    +     K T   T VGT  + APEV+       Y    D+WS+G   I M+ G PPY N      ++ + +  K ++ E   ++   + F+++ L     +R+SA  LLK
Sbjct:  427 NRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSL-TDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRT---TMVGTPYWMAPEVVTRKQ---YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 132.88 bits (333), Expect = 4.746e-32
Identity = 82/258 (31.78%), Postives = 131/258 (50.78%), Query Frame = 1
Query:  331 DKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ + K   IG+GA G VY    S      AIK+MN     +K +  N    + +  H  +V Y  +    + L + MEY P GSL T++  +  ++   +    +++L+ L+FLH N++IHRDIK DNILL  + ++KL DFG    +     K T   T VGT  + APEV+       Y    D+WS+G   I M+ G PPY N      ++ + +  K ++ E   ++   + F+++ L     +R+SA  LLK
Sbjct:  427 NRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSL-TDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRT---TMVGTPYWMAPEVVTRKQ---YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 132.88 bits (333), Expect = 4.746e-32
Identity = 82/258 (31.78%), Postives = 131/258 (50.78%), Query Frame = 1
Query:  331 DKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ + K   IG+GA G VY    S      AIK+MN     +K +  N    + +  H  +V Y  +    + L + MEY P GSL T++  +  ++   +    +++L+ L+FLH N++IHRDIK DNILL  + ++KL DFG    +     K T   T VGT  + APEV+       Y    D+WS+G   I M+ G PPY N      ++ + +  K ++ E   ++   + F+++ L     +R+SA  LLK
Sbjct:  427 NRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSL-TDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRT---TMVGTPYWMAPEVVTRKQ---YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 132.88 bits (333), Expect = 4.746e-32
Identity = 82/258 (31.78%), Postives = 131/258 (50.78%), Query Frame = 1
Query:  331 DKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ + K   IG+GA G VY    S      AIK+MN     +K +  N    + +  H  +V Y  +    + L + MEY P GSL T++  +  ++   +    +++L+ L+FLH N++IHRDIK DNILL  + ++KL DFG    +     K T   T VGT  + APEV+       Y    D+WS+G   I M+ G PPY N      ++ + +  K ++ E   ++   + F+++ L     +R+SA  LLK
Sbjct:  427 NRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSL-TDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRT---TMVGTPYWMAPEVVTRKQ---YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 159.073 bits (401), Expect = 5.394e-41
Identity = 93/265 (35.09%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEK------YIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K+++ +    +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C  ST + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     K R SA +LL+
Sbjct:  343 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFK-IATQPTNPQLPSHISEHTRDFLRCIFV-EAKYRPSAEELLR 600          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 158.688 bits (400), Expect = 8.732e-41
Identity = 93/265 (35.09%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEK------YIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K+++ +    +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C  ST + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     K R SA +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFK-IATQPTNPQLPSHISEHTRDFLRCIFV-EAKYRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 158.688 bits (400), Expect = 8.775e-41
Identity = 93/265 (35.09%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEK------YIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K+++ +    +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C  ST + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     K R SA +LL+
Sbjct:  361 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFK-IATQPTNPQLPSHISEHTRDFLRCIFV-EAKYRPSAEELLR 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 157.532 bits (397), Expect = 2.145e-40
Identity = 94/261 (36.02%), Postives = 147/261 (56.32%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRMNSE------GVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+V+    +      A+K++  +        +   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++ + G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  R L   C   T I +  GT  + +PEV+       Y   ADIWS+G TV+ M++ RPP+      A IFK I+ +  +   P  ++   + F++ +     K+R +A  LL+
Sbjct:  357 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEI-QLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEG---YGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFK-IATQPTNPTLPPHVSDHCRDFLKRIFVET-KQRPAAEDLLR 610          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 157.532 bits (397), Expect = 2.308e-40
Identity = 96/261 (36.78%), Postives = 148/261 (56.70%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+V+    +      A+K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++ + G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  R L   C   T I +  GT  + +PEV+       Y   ADIWS+G TV+ M++ RPP+      A IFK I+ +  +   P  ++   + F++ +     K+R +A  LL+
Sbjct:  365 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEI-QLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEG---YGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFK-IATQPTNPTLPPHVSDHCRDFLKRIFVET-KQRPAAEDLLR 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 157.532 bits (397), Expect = 3.207e-40
Identity = 89/264 (33.71%), Postives = 146/264 (55.30%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSE------GVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K++  +        +   +E  I + L  L H RIV+Y+G+++   EK L +FMEY P GS+  ++   G++  +   RY++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T I +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P   + Q + F++ +L    ++R +A +L++
Sbjct:  364 NWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEI-QLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIR 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 157.147 bits (396), Expect = 3.348e-40
Identity = 89/264 (33.71%), Postives = 146/264 (55.30%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSE------GVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K++  +        +   +E  I + L  L H RIV+Y+G+++   EK L +FMEY P GS+  ++   G++  +   RY++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T I +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P   + Q + F++ +L    ++R +A +L++
Sbjct:  346 NWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEI-QLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIR 603          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 154.066 bits (388), Expect = 4.881e-39
Identity = 91/269 (33.83%), Postives = 151/269 (56.13%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRM----NSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLK-KLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN*I 1128
            G ++GRGAFG+VY           A+K++    +S+   ++   +E  I + L    H+RIV+Y+G ++  TE+ L +F+EY P GS+  ++   G++  +   RY++QIL+G+ +LHGN I+HRDIK  NIL D   N+KL DFG  + +   C   T I +  GT  + +PEV+       Y   AD+WSV  TV+ M++ +PP+      A IFK+ +   K  LP+   ++   + F++++     K+R +A +LL+    S+ I
Sbjct:  357 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEI-QLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEG---YGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPD--TVSDACRDFMKQIFV-EEKRRPTAEELLRHLFVSHSI 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 153.68 bits (387), Expect = 5.794e-39
Identity = 91/269 (33.83%), Postives = 151/269 (56.13%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRM----NSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLK-KLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN*I 1128
            G ++GRGAFG+VY           A+K++    +S+   ++   +E  I + L    H+RIV+Y+G ++  TE+ L +F+EY P GS+  ++   G++  +   RY++QIL+G+ +LHGN I+HRDIK  NIL D   N+KL DFG  + +   C   T I +  GT  + +PEV+       Y   AD+WSV  TV+ M++ +PP+      A IFK+ +   K  LP+   ++   + F++++     K+R +A +LL+    S+ I
Sbjct:  364 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEI-QLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEG---YGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPD--TVSDACRDFMKQIFV-EEKRRPTAEELLRHLFVSHSI 625          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 152.91 bits (385), Expect = 9.830e-39
Identity = 89/260 (34.23%), Postives = 142/260 (54.62%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRMNSE------GVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+VY    +      A+K++  +        +   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   ADIWSVG TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F++ +     K R S+ +LL+
Sbjct:  342 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEI-QLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEG---YGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFK-IATQPTNPQLPAHVSEHCRDFLKRIFV-EAKVRPSSEELLR 595          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 153.68 bits (387), Expect = 5.503e-39
Identity = 90/263 (34.22%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T I +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIFV-EARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 153.295 bits (386), Expect = 6.159e-39
Identity = 96/261 (36.78%), Postives = 145/261 (55.56%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRM--NSEGVDEK----YIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+VY           A+K++  N E  +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   NIKL DFG  + L   C   T + +  GT  + +PEV+       Y   ADIWSV  TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F++ +     K R SA +LL+
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEI-QLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGAL-TENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEG---YGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFK-IATQPTNPKLPPHVSDYTRDFLKRIFV-EAKLRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk10 (serine/threonine kinase 10 [Source:MGI Symbol;Acc:MGI:1099439])

HSP 1 Score: 145.976 bits (367), Expect = 7.512e-36
Identity = 93/256 (36.33%), Postives = 142/256 (55.47%), Query Frame = 1
Query:  358 IGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKF--LTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNT---EISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVL--EATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            +G GAFGKVYK +     ++ A K + ++  +E  +E  I +   L   DH  IVK  GA   +  L + +E+ P G+++    E+ ++G  E   +    +Q+LE L FLHG +IIHRD+K  N+L+  E +I+LADFG+    ++T  K    D+ +GT  + APEV+  E   DAPY   ADIWS+G T+I M    PP+       V+ K+       L  P   +V+ + F++  L+ NP+ R SAAQLL+
Sbjct:   42 LGDGAFGKVYKAKNKETGALAAAKVIETKSEEE--LEDYIVEIEILATCDHPYIVKLLGAYYYDGKLWIMIEFCPGGAVDAIMLEL-DRGLTEP-QIQVVCRQMLEALNFLHGKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKR---DSFIGTPYWMAPEVVLCETMKDAPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLQ 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 141.739 bits (356), Expect = 2.013e-35
Identity = 93/281 (33.10%), Postives = 144/281 (51.25%), Query Frame = 1
Query:  322 SLRDKSFD--------KGSMIGRGAFGKVYKLQGSGISSV---FAIKRMNSEGVDEKYIEGNIYKF------LTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRID---TTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            +L DKS +        KG ++GRGA+G VY     G++S+    A+K++  +  D+   E    K       L  L H  IV Y G    E  L +FME+ P GS+++ I+  G +      +Y++QIL+G+ +LH N ++HRDIK +N++L     IKL DFG  + L       T  D   +  GT  + APEV+   +++ Y   +DIWS+G TV  M +G+PP  +    A +F + + + L  P P   +     F+   L  +  +R SA QLLK
Sbjct:  234 TLSDKSLNHEEAIFWTKGEILGRGAYGTVY----CGLTSLGQLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVI---NESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLK 507          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:MGI Symbol;Acc:MGI:2448588])

HSP 1 Score: 144.05 bits (362), Expect = 3.615e-35
Identity = 89/258 (34.50%), Postives = 148/258 (57.36%), Query Frame = 1
Query:  355 MIGRGAFGKVYKLQGSGISSVFAIKRMNSEGV---DEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNK-GSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENN-IKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAP--YRESADIWSVGATVINMISGRPPYDNC-PLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++G+G++G VY  +        AIK +    +      + E  ++K+L    H+ IV+Y G++    ++ +FME  P GSL+  + +K G ++   +  Y+KQILEGLK+LH N+I+HRDIK DN+L++  +  +K++DFG  +   R  G +   +T  GT  + APE++   D  P  Y   ADIWS+G T+I M + RPP+       A +FKV  + K+    P+ ++ + ++FI     P+P+KR +AA LL+
Sbjct:  661 VLGKGSYGIVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIALHKYLK---HRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSK---RLAGINPCTETFTGTLQYMAPEII---DQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKV-GMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQ 908          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 9.709e-40
Identity = 90/259 (34.75%), Postives = 146/259 (56.37%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDE---KYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            G  IGRGAFG+V+K          AIK+++S  +DE   + ++G + + L KL H  IVK  G ++ +  L   +EY   GSL   I   G +  +  I Y  Q+L+GL +LH NK+IHRDIK  NIL+ +E  IKLADFG+   +     +S    + VGT  + APE +E +  +    ++DIWS+G+T+I +++G PPY      A +F+++S +    P P  ++ +   + ++    +P +R +A +LL+  +F
Sbjct:   39 GEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSNKIDESSLQSVKGEV-EILHKLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELCIIYLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQI---DSESQLRFSVVGTPYWMAPESIEISGCS---SASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQH--PPFPTDISKEFLDYFQQSFKKDPTQRPTAQELLQHPIF 288          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q39008|M3K1_ARATH (Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana OX=3702 GN=MEKK1 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 4.936e-39
Identity = 99/263 (37.64%), Postives = 150/263 (57.03%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQG-SGISSVFAIKRMN--SEGVDEK----YIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPE-PQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            S+ KG ++GRG+FG VY  +G SG    FA+K ++   +G   +     +EG I K L++L HQ IV+Y G  +   +L +F+E   +GSL  ++  +  +    V  Y++QIL+GLK+LH    IHRDIK  NIL+D    +KLADFGL +       K   I +  GT  + APEV+   D   Y   ADIWS+G TV+ M +G+ PY +      +F++    +  LPE P  +++  + FI + L  NP++R +AA+LL
Sbjct:  332 SWQKGQLLGRGSFGSVY--EGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEI-KLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSL-LKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAK-----VSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRI---GRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELL 582          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 3.849e-38
Identity = 90/263 (34.22%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T I +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIFV-EARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 6.526e-38
Identity = 89/263 (33.84%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ +G ++G+GAFG+VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++      +Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F+  +     ++R SA +LL
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 1.182e-37
Identity = 94/260 (36.15%), Postives = 143/260 (55.00%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRMNSE-GVDEKYIEGNIY----KFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+VY           A+K++  +    E   E N      + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T + +  GT  + +PEV+       Y   ADIWSV  TV+ M++ +PP+      A IFK I+ +  +   P  ++   + F++ +     K R SA +LL+
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGAL-TENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEG---YGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFK-IATQPTNPKLPPHVSDYTRDFLKRIFV-EAKLRPSADELLR 612          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2C9JTY9 (Protein kinase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068194 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.039e-47
Identity = 100/266 (37.59%), Postives = 156/266 (58.65%), Query Frame = 1
Query:  319 TSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKR-----MNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            T+   K +  G ++G G +G+VY    S  S +FA+K+     +NS    E     N  + L+K+ H+RIV+Y G  + ++ L +F+EY P GSL   +   G +        +KQILEGL FLH N I+HRDIK  NIL D   NIKL DFG+ R L  +   ++ ++TT+G+  + APEV++   +A Y ++AD+WSVG TV+ M++ +PP+ +   CA I+K+++ K  +   P  M+  +K+F+      N  KR SA++LL
Sbjct:   56 TTETPKQYTIGRLLGSGGYGRVYLCCDSSTSILFAMKQVDLGNLNSHISKEVQALINEVQILSKIQHERIVQYLGCQENKESLSIFLEYMPGGSLLNHMQQFGPLTEAVAGNCTKQILEGLVFLHKNNIVHRDIKAANILRDTVGNIKLTDFGVSRQL-HSISCASGLNTTIGSPYWMAPEVIK---EAGYGQNADLWSVGCTVVEMLTTKPPFSHLEPCAAIYKIVTCKYPEYELPAGMSDLVKNFLNTAFQLNSSKRKSASELL 317          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.913e-46
Identity = 105/278 (37.77%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  268 SKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++M L C   C+HK C TS + K       I  G++G V+    SG    FA+K++  + +  +YIE NI  F   L H+RIVK+FGA   +++  +FMEY    +L  +   K S    +++ ++KQILE L FLH   IIHRDIKP+N+LLD + N+KL+DFGL   L        +     GT  + APE+L A     Y  S DIWS+GAT+I + +G+PPY N    A+I  + + ++++   P+ M   + + I+ ML  +  KR SA +LL
Sbjct:  668 AEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYL--DTLQKKKYQKKS--PGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNA---ELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A210PFZ5 (Mitogen-activated protein kinase kinase kinase 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24565 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.046e-45
Identity = 96/264 (36.36%), Postives = 143/264 (54.17%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKR-----MNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKL 1113
            ++ KG  +G G+FG+V+           A+K+     MN+E   E     N  + L    H+RIV YFG  Q    L +FMEY P GS+  E++  G +      +Y++Q+LEGL FLH N I+HRDIK  N+L D + NIKLADFG  + L   C  +T   + VGT ++ APEV+       Y   AD+WS+G TV+ MISG+PP+      A I+K+ + ++ +   PQ  +   + F+      NP +R S+  LL+ + 
Sbjct:  129 NWKKGHRLGSGSFGEVFVCYDKDSGRELAVKQVNLNQMNAETSKEVRALENEIQLLRNFQHERIVSYFGCHQDHSILSIFMEYMPGGSIKDELAKYGPLTEGVTRKYTRQMLEGLAFLHKNVIVHRDIKAANVLRDLQGNIKLADFGASKRLHTIC-SATGFKSFVGTPHYMAPEVINGEG---YGRKADVWSLGCTVVEMISGKPPWSELESMAAIYKIATAERPEFELPQRSSEFSREFLRLTFRRNPLERPSSEDLLRHRF 388          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A7S4G7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g104385 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.020e-44
Identity = 98/268 (36.57%), Postives = 150/268 (55.97%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKR-----MNSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            ++ KG ++G GAFG+VY           A+K+     +NS   +E K +EG I +F+    ++RIV+Y+G    + H+ +FMEY P GS++  I   G++      +YS+QILEG+ +LH N+I+HRDIK  NIL D   N+KLADFG  + L +T    T   +  GT  + APEV+       Y   AD+WSVG TV+ M++ +PP+ +    A +FK I+ +  +   P  ++V    F+   L  N K R SA +LL+    +N
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEI-EFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRL-QTIRSKTGFRSVHGTPYWMAPEVINGEG---YGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFK-IATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTN 264          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.376e-44
Identity = 102/269 (37.92%), Postives = 150/269 (55.76%), Query Frame = 1
Query:  313 CPTSLRDKSFDKGSMIGRGAFGKVY----KLQGSGIS-SVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            CP + +      G+++G GAFG+VY    K  G  ++  V  +++MN+E   E     N    L   +H+RIV YFG  Q ++ L +FMEY P GS+  EI+  GS+ T+NV R Y+KQ+LEGL +LH N I+HRDIK  NIL D   NIKL DFG  + L +T   +T + + VGT  + APEV+       Y   ADIWSVG T++ M++ +PP+      A ++K+   K+     P  ++      + +  + NP  R +A  LL
Sbjct:   60 CPVNWK-----AGALLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSKEVRALENEIHLLRNFEHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEITKYGSL-TENVSRKYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKRL-QTIVSATGLHSVVGTPYWMAPEVINGEG---YGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFTLPNHISELCHDVLSKAFDRNPSTRPTAIDLL 318          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 162.155 bits (409), Expect = 4.607e-42
Identity = 95/265 (35.85%), Postives = 147/265 (55.47%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY------IEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K++  +    +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C  ST + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P   + Q + FI  +     K R SA +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPILPSHTSEQTRDFIRRIFV-EAKHRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 162.155 bits (409), Expect = 4.607e-42
Identity = 95/265 (35.85%), Postives = 147/265 (55.47%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY------IEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K++  +    +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C  ST + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P   + Q + FI  +     K R SA +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPILPSHTSEQTRDFIRRIFV-EAKHRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 162.155 bits (409), Expect = 4.607e-42
Identity = 95/265 (35.85%), Postives = 147/265 (55.47%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKY------IEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG+VY           A K++  +    +       +E  I + L  L H+RIV+Y+G ++   EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C  ST + +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK I+ +  +   P   + Q + FI  +     K R SA +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFK-IATQPTNPILPSHTSEQTRDFIRRIFV-EAKHRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 150.599 bits (379), Expect = 1.070e-40
Identity = 93/274 (33.94%), Postives = 154/274 (56.20%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISS---VFAIKRM-----NSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMR---TCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFS 1119
            ++ KG ++GRGA+G VY     G++S   + A+K++      SE  +++Y  +E  +   L  L+H  IV + G   T+  + +FMEY P GS+++ ++  G +       Y++Q+LEG+ +LH N++IHRD+K +N++L     +KL DFG  R L R   + G S  + +  GT  + APEV+  T    + + +D+WS+G TV  M +G+PP  +    A +F + + K L  P P   + + KSF++  L  N K+R SAA LL+    S
Sbjct:   15 TWAKGEVLGRGAYGTVY----CGLTSQGQLIAVKQVLLDVSTSETAEKEYSRLEREV-DLLKNLEHPNIVGFLGTALTDNVISIFMEYVPGGSISSVLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETG---HGKKSDVWSIGCTVFEMATGKPPLAHMGKMAALFYIGARKGLMPPLPDDFSEEAKSFVKACLI-NQKQRPSAADLLRHPFIS 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 157.532 bits (397), Expect = 1.989e-40
Identity = 94/261 (36.02%), Postives = 148/261 (56.70%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRMNSE------GVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+V+    +      A+K++  +        +   +E  I + L  L H+RIV+Y+G ++   E+ L +FMEY P GS+  ++ + G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  R L   C   T I +  GT  + +PEV+       Y   ADIWSVG TV+ M++ RPP+      A IFK I+ +  +   P  ++   + F++ +     K+R +A +LL+
Sbjct:  362 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEI-QLLKNLFHERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEG---YGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAIFK-IATQPTNPALPAHVSDHCRDFLKRIFVET-KQRPAAEELLR 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 165.236 bits (417), Expect = 8.621e-44
Identity = 89/225 (39.56%), Postives = 132/225 (58.67%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMN-SEGVDEKYIEGNIY----KFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVIS 987
            ++ +G ++G+GAFG+VY    +      A+K++    G  E   E N      + L  L H+RIV+YFG ++   +K L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ FLHGN I+HRDIK  NIL D   N+KL DFG  + L   C + T + +  GT  + +PEV+       Y   ADIWSVG TV+ M++ +PP+      A IFK+ +
Sbjct:  358 NWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGAL-TENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEG---YGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIAT 578          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 138.272 bits (347), Expect = 4.017e-34
Identity = 95/260 (36.54%), Postives = 134/260 (51.54%), Query Frame = 1
Query:  358 IGRGAFGKVYKLQG--SGISSVFAIKRMNSEGVDEKY-IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRY-SKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVL--EATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFS 1119
            +G GAFGKVYK Q   SG+ +   +    SE   E Y +E  I   L   DH  IV    A   E  L +F+E+ P G+++  +        +  IR   KQ+LE L +LH ++IIHRD+K  NILL  E ++KLADFG+     RT     R D+ +GT  + APEV+  E   DAPY   ADIWS+G T+I +    PP        V+ K+       L  P   + +   F+++ L+ NP+ R +A QLL+    S
Sbjct:   39 LGDGAFGKVYKAQNKESGVLAAAKVIETKSEEELEDYMVEIEI---LALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTL---QRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFIS 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 123.25 bits (308), Expect = 1.256e-31
Identity = 80/273 (29.30%), Postives = 136/273 (49.82%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNI--------------YKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGR--SLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPY-DNCPLCAVIFKVISLKKLDLPE-PQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            ++ KG+ +G+GAFG V+ L  +    + A+K +  E  D +   GN                + LT L H  +V+Y G         +FME+ P G++   +   G +       Y  Q+  GL +LHG+ ++H D+K  N ++     +KL DFG  +  +L  +C ++  + +  GTA + APEV+  T    Y   AD+WS+G T+  M  GRPP+ D  P+ A++   I ++   +P  PQ  + + + F+E+    +  KR S+ +LL
Sbjct:   14 TWIKGNRLGKGAFGTVF-LGLTNQGKLIAVKEL--ELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVINGTG---YARRADVWSLGCTLHEMAVGRPPFADMAPMAALLH--IGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELL 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002962.1 (pep scaffold:Pmarinus_7.0:GL476671:16080:33623:-1 gene:ENSPMAG00000002691.1 transcript:ENSPMAT00000002962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 8.440e-30
Identity = 80/252 (31.75%), Postives = 124/252 (49.21%), Query Frame = 1
Query:  358 IGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNI---YKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            IG G+FG VY  +    S V AIK+M+  G        +I    KFLTKL H  I++Y G    E    + MEY    + +    +K  ++   +   +   L+GL FLH + +IHRD+K  NILL E   +KLADFG       +   +   ++ VGT  + APEV+ A D+  Y    D+WS+G T I +   +PP  N    + ++ +       L  P+      ++F++  L  N + R ++A LL+
Sbjct:   36 IGHGSFGAVYFARNIHTSEVVAIKKMSYSGKQSNEKWQDIIKEVKFLTKLKHPNIIEYKGCYLREHTAWMIMEYCLGSASDLLEVHKKPLQEIEIAAIAHGALQGLAFLHNHTMIHRDVKAGNILLTEPGQVKLADFG-------SASLTAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPTLQSPEWSDY-FRNFVDSCLQKNGQDRPTSAGLLR 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 8.830e-30
Identity = 87/298 (29.19%), Postives = 141/298 (47.32%), Query Frame = 1
Query:  283 TCESGCDHKLCPTSLRDKS-FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM----NSEGVDEKYIEG--NIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFL----HGNKIIHRDIKPDNILLDEENN-IKLADFGLGRSLM-RTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYD---NCPLCAVIFKVISLKKLDLPE----PQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLF 1116
            T + G +H       ++ + + +G  IG GAF   ++ Q  G  ++ A+K++    N+    ++ ++      + +++LDH  I++  GA   + +  LF+E+   GS+   ++  G      VI Y +Q+L GL +L    H N++IHRDIK  N+L+D     +++ADFG    L  +  G        +GT  F APEVL       Y  S DIWSVG  +I M   +PP++   +    A+IFK+ S            P L  V ++      L   P  R  A  LLK  +F
Sbjct:    4 TSDVGLEHTRARQPYQEGAEWLRGQQIGLGAFSSCFQAQDIGTGTLMAVKQVTYVRNTASEQDEVVQTLREEIRMMSRLDHPNIIRMLGATCEKSNYNLFIEWMAGGSVANLLNKYGPFHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGLQ---YGRSCDIWSVGCVIIEMSCAKPPWNAEKHSNHLALIFKIASTTTAPTVPPTLCPGLRDVALRC-----LELQPSDRPVARDLLKHPVF 293          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 137.887 bits (346), Expect = 2.873e-34
Identity = 94/254 (37.01%), Postives = 134/254 (52.76%), Query Frame = 1
Query:  355 MIGRGAFGKVYKLQGSGISSVFAIKRM---NSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            +IGRG++G VYK        V AIK +   N E +++   E ++ K    L+H  IVKY G I+    L + +EY   GSL   IS   +  ++N  + Y  Q L GLK+LHG  +IHRDIK  NILL  +N +KLADFG+      T   S+ + T  GT N+ APE+L     +     +DIWS+GATV+ M++  PPY N     + + V   +      P   +  +K F+ +    N  KR +A QLLK
Sbjct:   30 VIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLK---NLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVS-----TIVNSSAL-TLAGTLNWMAPEILGNRGASTL---SDIWSLGATVVEMLTKNPPYHNLTDANIYYAV---ENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 128.257 bits (321), Expect = 2.220e-31
Identity = 89/302 (29.47%), Postives = 145/302 (48.01%), Query Frame = 1
Query:  334 KSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----------------NSE----------------GVDEKYIEGNIYK-----------FLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPE-PQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            K++ KG+ IG G+FG VY    +    + A+K++                 NS+                 V       NI++            L +L H+ IV Y+GA Q   +L +F+EY P GS+++ ++N G  E   +  +++QIL G+ +LH   IIHRDIK  NIL+D +  +K+ DFG+ + L     K  +  +  G+  + +PEV++ T        ADIWS G  VI M +G+ P+ +      IFK+ +      PE P   T + K+F+ +    + + R SA +LL+
Sbjct:  413 KNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTA---KADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTT---PEIPSWATSEGKNFLRKAFELDYQYRPSALELLQ 708          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 128.642 bits (322), Expect = 2.961e-31
Identity = 85/273 (31.14%), Postives = 143/273 (52.38%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVY---KLQGSGISSVFAIKRMNSEGVDEKY-IEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTR-------------IDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCP-LCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            + K S IG G FG+VY    L+   I +V  IK  ++  + + + +       L  L+H  IV+Y+G       + +FMEY   GSL   + + G IE + V + Y+ ++LEGL +LH + ++HRDIKP+NILLD    IK  DFG  R+++ +  ++ R             ++  +GT  + APE +  +       + D+W++G  V+ M +GR P+ N     A+++ V + +   LP    MT   ++F+E  L  +P  R++A +LL
Sbjct: 1034 WQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSL-ASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 126.716 bits (317), Expect = 1.093e-30
Identity = 86/248 (34.68%), Postives = 125/248 (50.40%), Query Frame = 1
Query:  358 IGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            IG+GA G VY     G +   AIK+MN E   +K +  N    +    H  IV +  +   +  L + MEY   GSL T++     +    +    ++ L GL+FLH   ++HRDIK DNILL  E +IKL DFG    +     K T   T VGT  + APEV+   +   Y    DIWS+G  +I MI G PPY N      ++ + +     L EP+ ++  +K F++  L   P+ R+SA +LL
Sbjct:  626 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRT---TMVGTPYWMAPEVVSRKE---YGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELL 866          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 125.176 bits (313), Expect = 5.048e-30
Identity = 84/264 (31.82%), Postives = 133/264 (50.38%), Query Frame = 1
Query:  346 KGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEK------YIEG--NIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTV-GTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKL-DLPEPQLMTVQM--KSFIEEMLNPNPKKRSSAAQLL 1101
            KG MIG+G+FG VY         + A+K++       +       +E   +    L  LDH  IV+Y G         LF+EY   GS+ + I   G  +   +   + Q+L+GL +LH   I+HRD+K DN+LLD++   K++DFG+ R        S   D T+ GT  + APE+++      Y    DIWS+G  V+ M +G+ P+ N  + A +FK+   K    +PE  L  +    ++F++     NP+KR +A +LL
Sbjct: 1177 KGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNS---DMTMRGTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 170.629 bits (431), Expect = 1.455e-48
Identity = 98/268 (36.57%), Postives = 150/268 (55.97%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKR-----MNSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            ++ KG ++G GAFG+VY           A+K+     +NS   +E K +EG I +F+    ++RIV+Y+G    + H+ +FMEY P GS++  I   G++      +YS+QILEG+ +LH N+I+HRDIK  NIL D   N+KLADFG  + L +T    T   +  GT  + APEV+       Y   AD+WSVG TV+ M++ +PP+ +    A +FK I+ +  +   P  ++V    F+   L  N K R SA +LL+    +N
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEI-EFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRL-QTIRSKTGFRSVHGTPYWMAPEVINGEG---YGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFK-IATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTN 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 144.05 bits (362), Expect = 7.733e-36
Identity = 89/277 (32.13%), Postives = 146/277 (52.71%), Query Frame = 1
Query:  325 LRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM----NSEGVDEKYIEG--NIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEE-NNIKLADFGLGRSL-MRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPY---DNCPLCAVIFKV-ISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFS 1119
            L +  + KG ++G GAF   Y  +     S+ A+K++    NS+   +K  +   +    L +L H  ++K  GA +   H  +F+E+   GS++  +S  G  E   +IRY +QIL+G+ +LH N+++HRDIK  NIL+D    +I++ADFG    L  +  G        +GT  F APEVL       Y  S D+WSVG  +I M +G+PP+   ++    A+IFK+  ++   D+PE   +   ++  +   L   P+ R +A  LL+  LF+
Sbjct:  572 LENVHWKKGELLGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQDKVCQTIMDEIAILARLKHPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGES---YGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIPE--HLNPGVRDVVLRCLESKPEDRPAAVDLLQHPLFT 843          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK8])

HSP 1 Score: 133.65 bits (335), Expect = 8.301e-36
Identity = 74/208 (35.58%), Postives = 119/208 (57.21%), Query Frame = 1
Query:  502 HQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKV-ISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            H+ +VK +GA+QTE+ + +FMEY   GS+   +SN GS + D+V    + ILE L +LH   ++H D+K  N+L+D +  +KLADFG    L  T    TR     GT  F +PEV  +    P+  S DIWS   T+  M++G PP+      +++++V I+ K   +P+    + ++K F+  M +  P+ R +AA+LLK  +F +
Sbjct:    1 HENVVKLYGAVQTEQKIIIFMEYMDGGSVEMFLSNNGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNVLMDSKGIVKLADFGASVHLDDTT-THTRNIIPRGTEAFMSPEVCRS---EPFGRSTDIWSAACTLYQMLTGEPPWMQYSGGSILYQVAIATKPPGIPDSLECSQEIKDFMASMFSFVPEDRPTAAELLKNPIFQS 204          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 132.109 bits (331), Expect = 1.141e-34
Identity = 76/259 (29.34%), Postives = 138/259 (53.28%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGV--DEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIE---TDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLL 1101
            + K  +IG+G FG  + ++      ++A+K +N+  +  +++++  N  K L+ L H+ IV+Y  A +      + MEY   G L+T+I  K ++E   ++ ++ +  Q+L  LK +HG  I+HRD+K  NI L +++ +K+ DFG+ R L  TC  +    TTVGT  + +PE+ +     PY   +DIW++G  +  + +   P+    L  ++ K++       P P+     ++  +  ML  NP  R SA QL+
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKI--KQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHAR---TTVGTPYYLSPEICQR---QPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNY--PPIPRFYGPLLEDLVAVMLKINPADRPSAKQLI 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-33
Identity = 84/270 (31.11%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  340 FDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDEKY--IEGNIYKFLTKLDHQRIVKYFGAIQTEKH--LCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRT---CGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQL---MTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            + KG+++G+GAFG V+ L       + A+K++     N +  + +Y  ++  +   L  L H+ IV+Y G    +    + +FME+ P GS+   +   G+       RY++QIL+G+ +LH N +IHRDIK  NI+L     IKL DFG  + +        KS  + +  GT  + APEV+  T    +   +DIWS+G TV  M +G+PP+ N P  + IF + +      P P+L    +     F+   +  +   R SA +LL+
Sbjct:    5 WQKGNVLGKGAFGTVF-LGLVNTGELIAVKQVELHPNNVDAAERQYEKLQEEV-GLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETG---HGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGN----GSPVPRLDESFSAAAIDFVTSCMTRDQDTRPSADELLR 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 158.303 bits (399), Expect = 1.193e-40
Identity = 94/260 (36.15%), Postives = 145/260 (55.77%), Query Frame = 1
Query:  349 GSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            G ++G+GAFG+VY    +      A+K++     + E   E   +E  I + L  L H+RIV+Y+G ++   E+ L +FME+ P GS+  ++ + G++  +   RY++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  R L   C   T I +  GT  + +PEV+       Y   ADIWSVG TV+ M++ RPP+      A IFK I+ +  +   P  ++   + F+  +     K+R SA +LL+
Sbjct:  392 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEI-QLLKNLCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEG---YGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFK-IATQPTNPELPVHVSDHCREFLRRIFVET-KQRPSADELLR 645          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 157.147 bits (396), Expect = 2.318e-40
Identity = 97/265 (36.60%), Postives = 146/265 (55.09%), Query Frame = 1
Query:  337 SFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRM-----NSEGVDE-KYIEGNIYKFLTKLDHQRIVKYFGAIQ--TEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIR-YSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLK 1104
            ++ +G ++G+GAFG VY           A K++     + E   E   +E  I + L  L H+RIV+Y+G ++  +EK L +FMEY P GS+  ++   G++ T+NV R Y++QILEG+ +LH N I+HRDIK  NIL D   N+KL DFG  + L   C   T I +  GT  + +PEV+       Y   AD+WS+G TV+ M++ +PP+      A IFK+ +     L  P   + Q + FI  +     K R SA +LL+
Sbjct:  352 TWRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEG---YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPL-LPSHTSDQARDFIHCIFV-EAKHRPSAEELLR 609          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 150.214 bits (378), Expect = 4.743e-38
Identity = 83/257 (32.30%), Postives = 133/257 (51.75%), Query Frame = 1
Query:  265 ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMN-SEGVDEKYIEGNIY----KFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLK-KLDLPE 1011
            +  +G + +  C      +     ++ +G ++GRGAFG+VY    +      A K++       E   E N      + L  L H RIV+Y+G ++   ++ L +F+E+ P GS+  ++   G++      RY++QIL+G+ +LH N I+HRDIK  NIL D   N+KL DFG  + +   C   T I +  GT  + +PEV+       Y   AD+WSV  TV+ M++ +PP+      A IFK+ +   K  LPE
Sbjct:  302 LRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEG---YGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPE 555          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 150.214 bits (378), Expect = 5.996e-38
Identity = 83/257 (32.30%), Postives = 133/257 (51.75%), Query Frame = 1
Query:  265 ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMN-SEGVDEKYIEGNIY----KFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLK-KLDLPE 1011
            +  +G + +  C      +     ++ +G ++GRGAFG+VY    +      A K++       E   E N      + L  L H RIV+Y+G ++   ++ L +F+E+ P GS+  ++   G++      RY++QIL+G+ +LH N I+HRDIK  NIL D   N+KL DFG  + +   C   T I +  GT  + +PEV+       Y   AD+WSV  TV+ M++ +PP+      A IFK+ +   K  LPE
Sbjct:  332 LRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEG---YGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPE 585          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 150.214 bits (378), Expect = 5.996e-38
Identity = 83/257 (32.30%), Postives = 133/257 (51.75%), Query Frame = 1
Query:  265 ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMN-SEGVDEKYIEGNIY----KFLTKLDHQRIVKYFGAIQT--EKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLK-KLDLPE 1011
            +  +G + +  C      +     ++ +G ++GRGAFG+VY    +      A K++       E   E N      + L  L H RIV+Y+G ++   ++ L +F+E+ P GS+  ++   G++      RY++QIL+G+ +LH N I+HRDIK  NIL D   N+KL DFG  + +   C   T I +  GT  + +PEV+       Y   AD+WSV  TV+ M++ +PP+      A IFK+ +   K  LPE
Sbjct:  332 LRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEG---YGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPE 585          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 311/341 (91.20%), Postives = 316/341 (92.67%), Query Frame = 1
Query:  100 SGNSPMEFAMKSTNIEIIIILNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            SGNSPMEFAMK  N EII ILNEARLERQRQQQL+ QLERQ              ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGIS VFAIKRMNSEGVDEKYIEGNIYKFL KLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPY ESADIWSVGATVINMISGRPPYDNCPLCAVIFKV++LKKLDLPEPQLMT Q+KSFI+EMLNPNPKKRSSAAQLL L LFSN
Sbjct:  629 SGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQ--------------ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNCPLCAVIFKVMTLKKLDLPEPQLMTAQIKSFIKEMLNPNPKKRSSAAQLLNLNLFSN 955          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 311/341 (91.20%), Postives = 316/341 (92.67%), Query Frame = 1
Query:  100 SGNSPMEFAMKSTNIEIIIILNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            SGNSPMEFAMK  N EII ILNEARLERQRQQQL+ QLERQ              ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGIS VFAIKRMNSEGVDEKYIEGNIYKFL KLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPY ESADIWSVGATVINMISGRPPYDNCPLCAVIFKV++LKKLDLPEPQLMT Q+KSFI+EMLNPNPKKRSSAAQLL L LFSN
Sbjct:  596 SGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQ--------------ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNCPLCAVIFKVMTLKKLDLPEPQLMTAQIKSFIKEMLNPNPKKRSSAAQLLNLNLFSN 922          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 308/341 (90.32%), Postives = 313/341 (91.79%), Query Frame = 1
Query:  100 SGNSPMEFAMKSTNIEIIIILNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            SGNSPMEFAMKS N EII ILNEARLERQRQQQLE Q                  ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGK+YKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFL KLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPY ESADIWSVGATVINMISGRPPYDN P  AVIFKV++LKKLDLP+PQLMT Q+KSFIEEMLNPNPKKRSSAAQLLKLKLFSN
Sbjct:  300 SGNSPMEFAMKSGNTEIIKILNEARLERQRQQQLERQ------------------ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKIYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNYPSFAVIFKVMTLKKLDLPKPQLMTAQIKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 622          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 308/341 (90.32%), Postives = 313/341 (91.79%), Query Frame = 1
Query:  100 SGNSPMEFAMKSTNIEIIIILNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEPQLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 1122
            SGNSPMEFAMKS N EII ILNEARLERQRQQQLE Q                  ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGK+YKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFL KLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPY ESADIWSVGATVINMISGRPPYDN P  AVIFKV++LKKLDLP+PQLMT Q+KSFIEEMLNPNPKKRSSAAQLLKLKLFSN
Sbjct:  305 SGNSPMEFAMKSGNTEIIKILNEARLERQRQQQLERQ------------------ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKIYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNYPSFAVIFKVMTLKKLDLPKPQLMTAQIKSFIEEMLNPNPKKRSSAAQLLKLKLFSN 627          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 476.478 bits (1225), Expect = 7.626e-158
Identity = 255/278 (91.73%), Postives = 256/278 (92.09%), Query Frame = 1
Query:  100 SGNSPMEFAMKSTNIEIIIILNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISSVFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYRESADIWSVGATVINMISG 933
            SGNSPMEFAMK  N EII ILNEARLERQRQQQL+ QLERQ              ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGIS VFAIKRMNSEGVDEKYIEGNIYKFL KLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPY ESADIWSVGATVINMISG
Sbjct:  596 SGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQ--------------ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISG 859          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K31.359e-3833.84mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.452e-3833.84mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.688e-3833.84mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.727e-3833.84mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.727e-3833.84mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-13.170e-3535.09Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.255e-3535.09Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.472e-3535.09Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-17.008e-3535.09Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.085e-3334.21Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GckIII4.273e-3335.38gene:FBgn0266465 transcript:FBtr0083399[more]
Pak4.746e-3231.78gene:FBgn0267698 transcript:FBtr0334539[more]
Pak4.746e-3231.78gene:FBgn0267698 transcript:FBtr0081714[more]
Pak4.746e-3231.78gene:FBgn0267698 transcript:FBtr0081716[more]
Pak4.746e-3231.78gene:FBgn0267698 transcript:FBtr0081715[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k35.394e-4135.09mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k38.732e-4135.09mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k38.775e-4135.09mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.145e-4036.02mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k22.308e-4036.78mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd83.207e-4033.71sterile alpha motif domain containing 8 [Source:Xe... [more]
samd83.348e-4033.71sterile alpha motif domain containing 8 [Source:Xe... [more]
dennd1a4.881e-3933.83DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a5.794e-3933.83DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
MAP3K29.830e-3934.23mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k35.503e-3934.22mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k26.159e-3936.78mitogen-activated protein kinase kinase kinase 2 [... [more]
Stk107.512e-3636.33serine/threonine kinase 10 [Source:MGI Symbol;Acc:... [more]
Map3k192.013e-3533.10mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k153.615e-3534.50mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54PX0|Y4251_DICDI9.709e-4034.75Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|Q39008|M3K1_ARATH4.936e-3937.64Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|Q61084|M3K3_MOUSE3.849e-3834.22Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q99759|M3K3_HUMAN6.526e-3833.84Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN1.182e-3736.15Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JTY91.039e-4737.59Protein kinase domain-containing protein OS=Biomph... [more]
A0A0H3YJG21.913e-4637.77Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A210PFZ52.046e-4536.36Mitogen-activated protein kinase kinase kinase 2 O... [more]
A7S4G71.020e-4436.57Predicted protein (Fragment) OS=Nematostella vecte... [more]
K1PKP11.376e-4437.92Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.607e-4235.85mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.607e-4235.85mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.607e-4235.85mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k191.070e-4033.94mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k21.989e-4036.02mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k28.621e-4439.56mitogen-activated protein kinase kinase kinase 2 [... [more]
slka4.017e-3436.54STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
map3k191.256e-3129.30mitogen-activated protein kinase kinase kinase 19 ... [more]
ENSPMAT00000002962.18.440e-3031.75pep scaffold:Pmarinus_7.0:GL476671:16080:33623:-1 ... [more]
ENSPMAT00000006402.18.830e-3029.19pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC152.873e-3437.01Protein kinase of the Mitotic Exit Network; locali... [more]
STE112.220e-3129.47Signal transducing MEK kinase; involved in pheromo... [more]
SSK222.961e-3131.14MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
STE201.093e-3034.68Cdc42p-activated signal transducing kinase; involv... [more]
BCK15.048e-3031.82MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.455e-4836.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361507.733e-3632.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357438.301e-3635.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491381.141e-3429.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478211.247e-3331.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k21.193e-4036.15mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k32.318e-4036.60mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k224.743e-3832.30mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k225.996e-3832.30mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k225.996e-3832.30mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017277.10.000e+091.20SMESG000017277.1[more]
SMESG000017277.10.000e+091.20SMESG000017277.1[more]
SMESG000017274.10.000e+090.32SMESG000017274.1[more]
SMESG000017274.10.000e+090.32SMESG000017274.1[more]
SMESG000017277.17.626e-15891.73SMESG000017277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010050 ID=SMED30010050|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1955bp
AGTCAAACTGCTGATTGAGCATAATTGTGATATCGATGCACGTGACGACG
TAAATAGTTAATAATTGTGATTATAAATTTGACTGATTCATTTATTTAGT
CAGGTAATTCACCGATGGAATTCGCTATGAAATCTACCAATATAGAAATT
ATAATAATTCTGAATGAGGCTAGATTGGAGCGGCAGCGGCAACAACAATT
GGAATCGCAATTGGAGCGGCAGCGGCAATTGGAACAGCAATTAGAACCGC
AATTGGAGCTCCAGATCTCAAAGATGGGGCTGACATGCGAATCCGGCTGC
GATCACAAACTGTGCCCGACATCACTTAGAGACAAATCGTTTGATAAAGG
ATCCATGATTGGACGAGGAGCATTTGGAAAGGTTTATAAATTGCAAGGAT
CAGGAATAAGTTCTGTATTTGCTATCAAGCGGATGAACTCGGAAGGTGTT
GATGAGAAATACATCGAAGGAAATATTTATAAATTCTTGACAAAACTGGA
TCATCAAAGAATTGTTAAATATTTCGGCGCAATTCAAACAGAGAAACATT
TATGCCTCTTCATGGAATACTTTCCAAGGGGGTCCCTCAATACGGAAATA
TCGAACAAAGGCTCCATAGAAACGGATAATGTCATTCGGTACAGCAAGCA
GATCCTCGAAGGCCTGAAATTCTTGCACGGAAACAAAATTATTCATCGAG
ATATAAAGCCTGACAACATATTGTTGGACGAGGAGAATAATATTAAATTG
GCAGATTTTGGACTCGGCCGATCACTAATGAGGACTTGTGGCAAATCAAC
CAGAATTGACACTACTGTTGGAACTGCCAATTTTACAGCTCCTGAAGTCT
TAGAAGCTACGGATGATGCTCCTTACCGTGAGTCGGCTGATATATGGTCT
GTGGGGGCCACTGTGATCAATATGATCTCTGGGAGGCCCCCATATGACAA
TTGCCCATTATGTGCGGTTATATTCAAAGTAATTTCATTGAAAAAGCTGG
ACCTGCCGGAACCTCAACTGATGACAGTCCAAATGAAAAGTTTCATTGAA
GAAATGTTGAATCCGAATCCCAAAAAAAGATCATCCGCAGCGCAATTATT
GAAATTGAAATTATTTTCTAATTAAATTAATTGATTATTTAATTGATTAA
TTGTGTAAATAGAGATCCGAATGTGATTTATATTGAATATATTTTTGATA
TTTATTTTCATTTTGATTTCTAATTATATTTCATTTTCGGACATTTGTTT
AAATGAGTAAATGGAATGACGTCTCGAGTGACCCAGCTGGAACTCATAAA
GTCCCGAAATGGATCATGATAAACTTTCCATTTGAGCTTACTTTCAATGT
TCAAATTCAGCTTTGTCAATGTCAGTTTGGCGTGTCTAACAAACACTTGA
TAAAGGCTGTGCCGAAATATTGTGCACACGAGAAAGAATTGTTATGATTT
ATAGTCTTACGAATATTAATATGAAAATTATTGAATGTTATTATTAAATA
TTTAATTTTTTACAACTTTAATTACAAAAATATTATCTAATATGCCATTT
TTTAATCATTCAATATATAAAAAAATTGACATTTGATCAGAGGTTTACTG
AAAGGTTGGGAACCAAAAAACAAATTAATAAAATTAATAGATATTGAGCC
GAATGTCAAGATAATGGGTTGCCGGGAATTAAGTTAATTGGCATTAAATT
GCCACCCGGCTTAGAAAGGTTTTCTGTTTCTTAAAACAATTAATATAGAG
GAATATATATAAAAGCTGAACGCAAGACAAGCGCCAGTTGGTCGAAGTGA
GTTTTTTAAAGTTAAAGTGTACACAGGAGCGAGGAGCGATTTAGGAAAGA
GAAAATTAGATTGTGTTTTGATTTTACAATGGAAAGTGATACCCATCGAG
CGTCTACTTTATTCGTGAATATTTGGATTGATTTTGTAAATAAAGATTTT
GCTGG
back to top

protein sequence of SMED30010050-orf-1

>SMED30010050-orf-1 ID=SMED30010050-orf-1|Name=SMED30010050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MEFAMKSTNIEIIIILNEARLERQRQQQLESQLERQRQLEQQLEPQLELQ
ISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISS
VFAIKRMNSEGVDEKYIEGNIYKFLTKLDHQRIVKYFGAIQTEKHLCLFM
EYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPD
NILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATD
DAPYRESADIWSVGATVINMISGRPPYDNCPLCAVIFKVISLKKLDLPEP
QLMTVQMKSFIEEMLNPNPKKRSSAAQLLKLKLFSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 23..281
e-value: 4.2E-75
score: 265.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 24..279
e-value: 2.1E-63
score: 214.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 23..281
score: 46.774
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 10..279
e-value: 2.3E-33
score: 113.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 10..283
e-value: 4.7E-72
score: 244.3
NoneNo IPR availablePANTHERPTHR11584SERINE/THREONINE PROTEIN KINASEcoord: 22..277
NoneNo IPR availablePANTHERPTHR11584:SF369APOPTOTIC SIGNAL-REGULATING KINASE 1, ISOFORM Ccoord: 22..277
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 29..52
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 139..151
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 21..280