2-oxoisovalerate dehydrogenase subunit alpha

Overview
Name2-oxoisovalerate dehydrogenase subunit alpha
Smed IDSMED30010036
Length (bp)4285
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 2-oxoisovalerate dehydrogenase subunit alpha (SMED30010036) t-SNE clustered cells

Violin plots show distribution of expression levels for 2-oxoisovalerate dehydrogenase subunit alpha (SMED30010036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 2-oxoisovalerate dehydrogenase subunit alpha (SMED30010036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 2-oxoisovalerate dehydrogenase subunit alpha (SMED30010036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30010036SMESG000043663.1 dd_Smed_v4_8070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010036SMESG000021409.1 dd_Smed_v4_5802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010036SMESG000021409.1 dd_Smed_v4_5802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010036SMESG000043663.1 Contig55081uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010036SMESG000043663.1 Contig55081newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30010036SMESG000043663.1 dd_Smed_v4_8070_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010036SMESG000021409.1 dd_Smed_v4_5802_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 450.284 bits (1157), Expect = 1.098e-144
Identity = 236/393 (60.05%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SR+ V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   50 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH 442          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: AC011462.1 (novel protein)

HSP 1 Score: 451.055 bits (1159), Expect = 2.034e-144
Identity = 236/393 (60.05%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SR+ V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   84 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH 476          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 435.647 bits (1119), Expect = 4.209e-139
Identity = 236/418 (56.46%), Postives = 293/418 (70.10%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTY-------------------------RIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTY                         RIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SR+ V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   28 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYSSSPILPPDPHSREPTLTWGPLPLCRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH 445          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 320.472 bits (820), Expect = 1.959e-98
Identity = 179/308 (58.12%), Postives = 213/308 (69.16%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKH 1048
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP                              GRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK 
Sbjct:   50 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDP-----------------------------HGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQ 328          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 186.808 bits (473), Expect = 4.358e-53
Identity = 108/209 (51.67%), Postives = 134/209 (64.11%), Query Frame = 2
Query:  176 FIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREA-------------------------------GVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVG 709
            FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREA                               GV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S G
Sbjct:    3 FIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAEARPHHVAQAGLQLLGSSDPPTSASQSAGITGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG 211          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: bckd-1A (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45924])

HSP 1 Score: 422.165 bits (1084), Expect = 9.322e-135
Identity = 217/384 (56.51%), Postives = 277/384 (72.14%), Query Frame = 2
Query:  149 RSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQ-NGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            ++ +T +L  +   D   +P+YRV +  G++ +   DP F ++ S+K+ KTMT LN MDRILYDSQRQGRISFYMT +GEEG  +GSAAAL   DLI+GQYREAGV LWRG+T+E  +NQCYGN  D  KG+QMP+H+  K+ N+ +ISS L TQ+P AVG+AYAFK+ + N +  + YFGDGA+S GDAHAA NF+ATL CP+I  CRNN YAISTP  EQY GDGI  +G  YG+ TIRVDGNDL+AVYNATK AR + +  NRPVLIEAMTYR+G HSTSDDS AYRS DEV  W   D+PI RFK Y+ ++ WW++++E  W+ E +K V+     AEK    +   LFEDVYDE+P R+R Q ++    +   KEHYP+
Sbjct:   42 KAAFTEKLEIVNADDTPALPIYRVTNAVGDVIDKSQDPNFDEQTSLKMYKTMTQLNIMDRILYDSQRQGRISFYMTSFGEEGNHVGSAAALEPQDLIYGQYREAGVLLWRGYTMENFMNQCYGNADDLGKGRQMPMHFGTKERNFVTISSPLTTQLPQAVGSAYAFKQQKDNNRIAVVYFGDGAASEGDAHAAFNFAATLKCPIIFFCRNNGYAISTPTSEQYGGDGIAGKGPAYGLHTIRVDGNDLLAVYNATKEARRVALT-NRPVLIEAMTYRLGHHSTSDDSTAYRSSDEVQTWGDKDHPITRFKKYITERGWWNEEKEMEWQKEVKKRVLTEFAAAEKRKKAHYHDLFEDVYDELPLRLRRQRDELDAHVAEYKEHYPM 424          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: bckd-1A (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45924])

HSP 1 Score: 422.165 bits (1084), Expect = 9.996e-135
Identity = 217/384 (56.51%), Postives = 277/384 (72.14%), Query Frame = 2
Query:  149 RSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQ-NGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            ++ +T +L  +   D   +P+YRV +  G++ +   DP F ++ S+K+ KTMT LN MDRILYDSQRQGRISFYMT +GEEG  +GSAAAL   DLI+GQYREAGV LWRG+T+E  +NQCYGN  D  KG+QMP+H+  K+ N+ +ISS L TQ+P AVG+AYAFK+ + N +  + YFGDGA+S GDAHAA NF+ATL CP+I  CRNN YAISTP  EQY GDGI  +G  YG+ TIRVDGNDL+AVYNATK AR + +  NRPVLIEAMTYR+G HSTSDDS AYRS DEV  W   D+PI RFK Y+ ++ WW++++E  W+ E +K V+     AEK    +   LFEDVYDE+P R+R Q ++    +   KEHYP+
Sbjct:   41 KAAFTEKLEIVNADDTPALPIYRVTNAVGDVIDKSQDPNFDEQTSLKMYKTMTQLNIMDRILYDSQRQGRISFYMTSFGEEGNHVGSAAALEPQDLIYGQYREAGVLLWRGYTMENFMNQCYGNADDLGKGRQMPMHFGTKERNFVTISSPLTTQLPQAVGSAYAFKQQKDNNRIAVVYFGDGAASEGDAHAAFNFAATLKCPIIFFCRNNGYAISTPTSEQYGGDGIAGKGPAYGLHTIRVDGNDLLAVYNATKEARRVALT-NRPVLIEAMTYRLGHHSTSDDSTAYRSSDEVQTWGDKDHPITRFKKYITERGWWNEEKEMEWQKEVKKRVLTEFAAAEKRKKAHYHDLFEDVYDELPLRLRRQRDELDAHVAEYKEHYPM 423          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 136.346 bits (342), Expect = 4.832e-34
Identity = 94/313 (30.03%), Postives = 151/313 (48.24%), Query Frame = 2
Query:  302 MTLLNTMDRILYDSQRQGRI-SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFK-RAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTR 1234
            M ++  M+    +  ++ +I  F   + G+E   +G  AA+ +GD +   YR  G     G T+ E+L +  G    +  GK   +H   K  N++  + ++G Q P   G A A K R Q   CV  Y GDGA++ G    A N +   D PV+ +C NN + + T    +           G  +  I VDG D++AV  ATK A+E C +   P+++E  TYR   HS SD   +YR+ +E+    K  +PI  FK  +   +  +++E +A   E RK V +A++ A    +  P  L+ D+Y   P +
Sbjct:   62 MQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTK--NFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLY-GDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTA--ERSSASTEYYTRGDYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIYHNTPAQ 369          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 136.346 bits (342), Expect = 4.832e-34
Identity = 94/313 (30.03%), Postives = 151/313 (48.24%), Query Frame = 2
Query:  302 MTLLNTMDRILYDSQRQGRI-SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFK-RAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTR 1234
            M ++  M+    +  ++ +I  F   + G+E   +G  AA+ +GD +   YR  G     G T+ E+L +  G    +  GK   +H   K  N++  + ++G Q P   G A A K R Q   CV  Y GDGA++ G    A N +   D PV+ +C NN + + T    +           G  +  I VDG D++AV  ATK A+E C +   P+++E  TYR   HS SD   +YR+ +E+    K  +PI  FK  +   +  +++E +A   E RK V +A++ A    +  P  L+ D+Y   P +
Sbjct:   62 MQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTK--NFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLY-GDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTA--ERSSASTEYYTRGDYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIYHNTPAQ 369          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 136.346 bits (342), Expect = 4.832e-34
Identity = 94/313 (30.03%), Postives = 151/313 (48.24%), Query Frame = 2
Query:  302 MTLLNTMDRILYDSQRQGRI-SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFK-RAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTR 1234
            M ++  M+    +  ++ +I  F   + G+E   +G  AA+ +GD +   YR  G     G T+ E+L +  G    +  GK   +H   K  N++  + ++G Q P   G A A K R Q   CV  Y GDGA++ G    A N +   D PV+ +C NN + + T    +           G  +  I VDG D++AV  ATK A+E C +   P+++E  TYR   HS SD   +YR+ +E+    K  +PI  FK  +   +  +++E +A   E RK V +A++ A    +  P  L+ D+Y   P +
Sbjct:   62 MQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTK--NFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLY-GDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTA--ERSSASTEYYTRGDYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIYHNTPAQ 369          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: CG8199 (gene:FBgn0037709 transcript:FBtr0082067)

HSP 1 Score: 414.846 bits (1065), Expect = 7.709e-132
Identity = 211/398 (53.02%), Postives = 279/398 (70.10%), Query Frame = 2
Query:  119 SADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFK-RAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQ-XXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRI---RSQMNKHYTFLKRNKEHYPI 1297
            S D  NFP +++ + S+LN I P D   IP+YRV+D +G + ++  DP+  +E   K+ + M LLNTMD+ILY+SQRQGRISFYMT++GEE   IGSAAAL   DLI+GQYREAGV +WRGF +++ ++QCYGN  D  +GKQMP+HY +++LN+ +ISS L TQMP AVGAAYA K R  N  CV+CYFG+GA+S GDAHAA NF+ATL CP I+ CRNN +AISTP HEQ       G   +GYGI TIRVDG D+ AVYNA KAARE  + EN+PV+ EA+ YR+G HSTSDDS AYR  +E+  W+  ++PI + K Y+  K W+ +  E  +  + RK V++ I  +EK   PN   +FE VY EMP  +   RS++ KH   ++ +KEHYP+
Sbjct:   40 SEDYANFPGAKAPFVSKLNLIQPEDYAPIPIYRVMDQDGYIADETQDPQLGREVVEKMFRDMVLLNTMDKILYESQRQGRISFYMTNFGEEASHIGSAAALEMRDLIYGQYREAGVLVWRGFRIDQFIDQCYGNTDDLGRGKQMPVHYGSRELNFVTISSPLSTQMPQAVGAAYAMKLRPNNDACVVCYFGEGAASEGDAHAAFNFAATLGCPAILFCRNNGFAISTPSHEQYKGDGIAGRGPMGYGITTIRVDGTDVFAVYNAMKAAREYVLKENKPVVFEALAYRVGHHSTSDDSTAYRPAEEIEIWNSVEHPISKLKRYMVHKGWFDETVENEYVKDIRKKVLKQIAVSEKKLKPNWREMFEGVYAEMPDHLIEQRSELEKH---IEAHKEHYPL 434          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070710)

HSP 1 Score: 105.531 bits (262), Expect = 5.795e-24
Identity = 84/286 (29.37%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  362 SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIH-YANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVY 1216
             F   + G+E   +G  AA+ D D I   YR  G     G +   +L +  G +    +GK   +H YA    N++  + ++G Q+P   G   A K   NG   +  +GDGA++ G    A N +     PVI +C NN Y + T    +           G  +  I VDG D++AV +AT+ A    VN + P+++E  TYR   HS SD   +YR+ +E+    +  +PI  FK    +    +  E +A   + RK V +A   A+         L+ DVY
Sbjct:   22 GFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAP---NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTS--SERASCNTDYYTRGDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVY 301          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070708)

HSP 1 Score: 105.145 bits (261), Expect = 2.086e-23
Identity = 84/286 (29.37%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  362 SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIH-YANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVY 1216
             F   + G+E   +G  AA+ D D I   YR  G     G +   +L +  G +    +GK   +H YA    N++  + ++G Q+P   G   A K   NG   +  +GDGA++ G    A N +     PVI +C NN Y + T    +           G  +  I VDG D++AV +AT+ A    VN + P+++E  TYR   HS SD   +YR+ +E+    +  +PI  FK    +    +  E +A   + RK V +A   A+         L+ DVY
Sbjct:   93 GFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAP---NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTS--SERASCNTDYYTRGDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVY 372          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070709)

HSP 1 Score: 105.145 bits (261), Expect = 2.086e-23
Identity = 84/286 (29.37%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  362 SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIH-YANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVY 1216
             F   + G+E   +G  AA+ D D I   YR  G     G +   +L +  G +    +GK   +H YA    N++  + ++G Q+P   G   A K   NG   +  +GDGA++ G    A N +     PVI +C NN Y + T    +           G  +  I VDG D++AV +AT+ A    VN + P+++E  TYR   HS SD   +YR+ +E+    +  +PI  FK    +    +  E +A   + RK V +A   A+         L+ DVY
Sbjct:   93 GFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAP---NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTS--SERASCNTDYYTRGDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVY 372          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070711)

HSP 1 Score: 105.531 bits (262), Expect = 2.992e-23
Identity = 84/286 (29.37%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  362 SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIH-YANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVY 1216
             F   + G+E   +G  AA+ D D I   YR  G     G +   +L +  G +    +GK   +H YA    N++  + ++G Q+P   G   A K   NG   +  +GDGA++ G    A N +     PVI +C NN Y + T    +           G  +  I VDG D++AV +AT+ A    VN + P+++E  TYR   HS SD   +YR+ +E+    +  +PI  FK    +    +  E +A   + RK V +A   A+         L+ DVY
Sbjct:  137 GFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAP---NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTS--SERASCNTDYYTRGDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVY 416          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 469.544 bits (1207), Expect = 3.908e-152
Identity = 237/395 (60.00%), Postives = 293/395 (74.18%), Query Frame = 2
Query:  119 SADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            S +KP FP + +E+   L FI P  I GIP+YRV+D  G +     DP+ SKE  +   + MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  IGSAAAL+  DL+FGQYREAGV ++RGF L+  + QCY N  D  KG+QMP+HY +K LN+ +ISS L TQ+P A GAAYA KR    + VICYFG+GA+S GDAHA  NFSATL+CP+I  CRNN YAISTP +EQYRGDGI +RG GYG+ +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  ++WW + EE AWR +SRKLV++A E+AE+   PNP ++F DVYDEM   I  Q +  +  +++ KEHYP+ +
Sbjct:   49 SDEKPQFPGASAEFIDHLEFIQPNVISGIPVYRVMDRQGQIINPSEDPQLSKETVLNFYQKMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHIGSAAALDPSDLVFGQYREAGVLMYRGFPLDLFMAQCYANADDLGKGRQMPVHYGSKDLNFVTISSPLATQIPQAAGAAYAVKRENANRVVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGIAARGPGYGLMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPNPDLMFTDVYDEMVPHIAKQKDSMWRHVQQYKEHYPLDH 443          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 469.544 bits (1207), Expect = 3.908e-152
Identity = 237/395 (60.00%), Postives = 293/395 (74.18%), Query Frame = 2
Query:  119 SADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            S +KP FP + +E+   L FI P  I GIP+YRV+D  G +     DP+ SKE  +   + MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  IGSAAAL+  DL+FGQYREAGV ++RGF L+  + QCY N  D  KG+QMP+HY +K LN+ +ISS L TQ+P A GAAYA KR    + VICYFG+GA+S GDAHA  NFSATL+CP+I  CRNN YAISTP +EQYRGDGI +RG GYG+ +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  ++WW + EE AWR +SRKLV++A E+AE+   PNP ++F DVYDEM   I  Q +  +  +++ KEHYP+ +
Sbjct:   49 SDEKPQFPGASAEFIDHLEFIQPNVISGIPVYRVMDRQGQIINPSEDPQLSKETVLNFYQKMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHIGSAAALDPSDLVFGQYREAGVLMYRGFPLDLFMAQCYANADDLGKGRQMPVHYGSKDLNFVTISSPLATQIPQAAGAAYAVKRENANRVVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGIAARGPGYGLMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPNPDLMFTDVYDEMVPHIAKQKDSMWRHVQQYKEHYPLDH 443          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 127.872 bits (320), Expect = 8.004e-31
Identity = 104/374 (27.81%), Postives = 166/374 (44.39%), Query Frame = 2
Query:  152 SEYTSQLNFIYPTDIKGIPLYRVLDGNGN----LREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHY-GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDV-----YDEMPTRIRS 1243
            +++T Q  F    DIK   ++++ +G        RE+GL             +TM  +  M+       +Q  I  +   Y G+E   +G  A +N  D +   YR  G  L RG T+ E++ +  G +    KGK   +H   K  +++  + ++G Q+P   G A A K     +  +C +GDGA++ G      N ++    P I +C NN Y + T V  +           G  I  +RVDG D++ V  ATK A E C +   P+L+E  TYR   HS SD  ++YR+ +E+       +PI   K  +   N  S +E +    E RK     IE A +    +P    ED+     Y++ P  +R 
Sbjct:   38 ADFTPQATF----DIKKCDVHKLEEGPAVQAVLTREEGLQ----------YYRTMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLSDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--HFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSV--ERAAASTDYYKRGDFIPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISLLKDRMLSNNMASVEELKEIDVEVRK----EIEDAAQFATTDPEPPLEDLCNHIFYNDPPLEVRG 389          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 127.487 bits (319), Expect = 8.594e-31
Identity = 104/374 (27.81%), Postives = 166/374 (44.39%), Query Frame = 2
Query:  152 SEYTSQLNFIYPTDIKGIPLYRVLDGNGN----LREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHY-GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDV-----YDEMPTRIRS 1243
            +++T Q  F    DIK   ++++ +G        RE+GL             +TM  +  M+       +Q  I  +   Y G+E   +G  A +N  D +   YR  G  L RG T+ E++ +  G +    KGK   +H   K  +++  + ++G Q+P   G A A K     +  +C +GDGA++ G      N ++    P I +C NN Y + T V  +           G  I  +RVDG D++ V  ATK A E C +   P+L+E  TYR   HS SD  ++YR+ +E+       +PI   K  +   N  S +E +    E RK     IE A +    +P    ED+     Y++ P  +R 
Sbjct:   31 ADFTPQATF----DIKKCDVHKLEEGPAVQAVLTREEGLQ----------YYRTMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLSDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--HFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSV--ERAAASTDYYKRGDFIPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISLLKDRMLSNNMASVEELKEIDVEVRK----EIEDAAQFATTDPEPPLEDLCNHIFYNDPPLEVRG 382          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 127.487 bits (319), Expect = 8.594e-31
Identity = 104/374 (27.81%), Postives = 166/374 (44.39%), Query Frame = 2
Query:  152 SEYTSQLNFIYPTDIKGIPLYRVLDGNGN----LREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHY-GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDV-----YDEMPTRIRS 1243
            +++T Q  F    DIK   ++++ +G        RE+GL             +TM  +  M+       +Q  I  +   Y G+E   +G  A +N  D +   YR  G  L RG T+ E++ +  G +    KGK   +H   K  +++  + ++G Q+P   G A A K     +  +C +GDGA++ G      N ++    P I +C NN Y + T V  +           G  I  +RVDG D++ V  ATK A E C +   P+L+E  TYR   HS SD  ++YR+ +E+       +PI   K  +   N  S +E +    E RK     IE A +    +P    ED+     Y++ P  +R 
Sbjct:   31 ADFTPQATF----DIKKCDVHKLEEGPAVQAVLTREEGLQ----------YYRTMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLSDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--HFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSV--ERAAASTDYYKRGDFIPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISLLKDRMLSNNMASVEELKEIDVEVRK----EIEDAAQFATTDPEPPLEDLCNHIFYNDPPLEVRG 382          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 473.011 bits (1216), Expect = 1.158e-153
Identity = 245/411 (59.61%), Postives = 299/411 (72.75%), Query Frame = 2
Query:   86 KFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEK 1318
            K  +  S + +  +KP FP + +++   L FI P  I GIP+YRV+D  G +     DPK  KE  +K   TMTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAALND DL+FGQYREAGV ++RG+ L+  + QCYGN  D  KGKQMP+HY  K LN+ +ISS L TQ+P AVGAAY+FKR    + VICYFG+GA+S GDAHAA NFSATL+CPV+  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  K WW +++E+ WR +SRK+V++A E+AE+ + P    +F DVY EMP ++R Q       LK   EHYP+  DS EK
Sbjct:   12 KLYITGSEFTSLEEKPQFPGASADFVDSLEFIQPNVISGIPIYRVMDRQGQIINPSEDPKIPKEKVLKFYHTMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALNDTDLVFGQYREAGVLMYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYPL--DSYEK 420          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 471.855 bits (1213), Expect = 2.136e-153
Identity = 244/405 (60.25%), Postives = 297/405 (73.33%), Query Frame = 2
Query:  104 SLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEK 1318
            S + +  +KP FP + +++   L FI P  I GIP+YRV+D  G +     DPK  KE  +K   TMTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAALND DL+FGQYREAGV ++RG+ L+  + QCYGN  D  KGKQMP+HY  K LN+ +ISS L TQ+P AVGAAY+FKR    + VICYFG+GA+S GDAHAA NFSATL+CPV+  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  K WW +++E+ WR +SRK+V++A E+AE+ + P    +F DVY EMP ++R Q       LK   EHYP+  DS EK
Sbjct:   10 SEFTSLEEKPQFPGASADFVDSLEFIQPNVISGIPIYRVMDRQGQIINPSEDPKIPKEKVLKFYHTMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALNDTDLVFGQYREAGVLMYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYPL--DSYEK 412          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 472.241 bits (1214), Expect = 2.289e-153
Identity = 247/417 (59.23%), Postives = 304/417 (72.90%), Query Frame = 2
Query:   77 CASKFNVLV---SLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEK 1318
            CA+ F+ ++   S + +  +KP FP + +++   L FI P  I GIP+YRV+D  G +     DPK  KE  +K   TMTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAALND DL+FGQYREAGV ++RG+ L+  + QCYGN  D  KGKQMP+HY  K LN+ +ISS L TQ+P AVGAAY+FKR    + VICYFG+GA+S GDAHAA NFSATL+CPV+  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  K WW +++E+ WR +SRK+V++A E+AE+ + P    +F DVY EMP ++R Q       LK   EHYP+  DS EK
Sbjct:    4 CAN-FHTIIRSQSEFTSLEEKPQFPGASADFVDSLEFIQPNVISGIPIYRVMDRQGQIINPSEDPKIPKEKVLKFYHTMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALNDTDLVFGQYREAGVLMYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYPL--DSYEK 417          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 472.626 bits (1215), Expect = 2.568e-153
Identity = 244/405 (60.25%), Postives = 297/405 (73.33%), Query Frame = 2
Query:  104 SLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEK 1318
            S + +  +KP FP + +++   L FI P  I GIP+YRV+D  G +     DPK  KE  +K   TMTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAALND DL+FGQYREAGV ++RG+ L+  + QCYGN  D  KGKQMP+HY  K LN+ +ISS L TQ+P AVGAAY+FKR    + VICYFG+GA+S GDAHAA NFSATL+CPV+  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  K WW +++E+ WR +SRK+V++A E+AE+ + P    +F DVY EMP ++R Q       LK   EHYP+  DS EK
Sbjct:   31 SEFTSLEEKPQFPGASADFVDSLEFIQPNVISGIPIYRVMDRQGQIINPSEDPKIPKEKVLKFYHTMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALNDTDLVFGQYREAGVLMYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYPL--DSYEK 433          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 471.47 bits (1212), Expect = 4.645e-153
Identity = 243/403 (60.30%), Postives = 296/403 (73.45%), Query Frame = 2
Query:  110 YCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEK 1318
            + +  +KP FP + +++   L FI P  I GIP+YRV+D  G +     DPK  KE  +K   TMTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAALND DL+FGQYREAGV ++RG+ L+  + QCYGN  D  KGKQMP+HY  K LN+ +ISS L TQ+P AVGAAY+FKR    + VICYFG+GA+S GDAHAA NFSATL+CPV+  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  K WW +++E+ WR +SRK+V++A E+AE+ + P    +F DVY EMP ++R Q       LK   EHYP+  DS EK
Sbjct:   25 FTSLEEKPQFPGASADFVDSLEFIQPNVISGIPIYRVMDRQGQIINPSEDPKIPKEKVLKFYHTMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALNDTDLVFGQYREAGVLMYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYPL--DSYEK 425          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Bckdha (branched chain ketoacid dehydrogenase E1, alpha polypeptide [Source:MGI Symbol;Acc:MGI:107701])

HSP 1 Score: 450.284 bits (1157), Expect = 7.561e-145
Identity = 235/393 (59.80%), Postives = 291/393 (74.05%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   +E  +K  ++MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL   DL+FGQYREAGV ++R + LE  ++QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SRK V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   51 DKPQFPGASAEFVDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPQEEVLKFYRSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALERTDLVFGQYREAGVLMYRDYPLELFMSQCYGNVNDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQEMPAQLRRQQESLARHLQTYGEHYPLDH 443          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Pdha1 (pyruvate dehydrogenase E1 alpha 1 [Source:MGI Symbol;Acc:MGI:97532])

HSP 1 Score: 121.709 bits (304), Expect = 7.097e-29
Identity = 86/272 (31.62%), Postives = 127/272 (46.69%), Query Frame = 2
Query:  383 GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICY--FGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNP 1192
            G+E   +G  A +N  D +   YR  G    RG  +  +L +  G +    KGK   +H   K  N++  + ++G Q+P   G A A K   NGK  +C   +GDGA++ G    A N +A    P I +C NN Y + T V  +           G  I  +RVDG D++ V  ATK A   C +   P+L+E  TYR   HS SD  ++YR+ +E+       +PI+  K  +   N  S +E +    E RK +  A + A  T  P P
Sbjct:   96 GQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLPVRAILAELTGRRGGCAKGKGGSMHMYAK--NFYGGNGIVGAQVPLGAGIALACK--YNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSV--ERAAASTDYYKRGDFIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFA--TADPEP 359          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Pdha2 (pyruvate dehydrogenase E1 alpha 2 [Source:MGI Symbol;Acc:MGI:97533])

HSP 1 Score: 119.013 bits (297), Expect = 6.888e-28
Identity = 84/277 (30.32%), Postives = 136/277 (49.10%), Query Frame = 2
Query:  383 GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDV 1213
            G+E   +G  A +N  D +   YR  G    RG +++ +L +  G K    KGK   +H   K  N++  + ++G Q+P   G A+A K  +NG+  +  +GDGA++ G    A N SA    P + +C NNLY + T    +           G+ I  +RV+G D++ V  ATK A + C +   P+++E  TYR   HS SD  ++YRS +EV       +PI+  +  +   N  + +E +    + +K V  A + A  T  P P +  ED+
Sbjct:   97 GQEACCVGLEAGINPTDHVITSYRAHGFCYTRGLSVKSILAELTGRKGGCAKGKGGSMHMYGK--NFYGGNGIVGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNLYGMGTS--NERSAASTDYHKKGFIIPGLRVNGMDILCVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFA--TTDPEPAV--EDI 365          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Bckdha (branched chain ketoacid dehydrogenase E1, alpha polypeptide [Source:MGI Symbol;Acc:MGI:107701])

HSP 1 Score: 97.0561 bits (240), Expect = 2.309e-23
Identity = 59/82 (71.95%), Postives = 66/82 (80.49%), Query Frame = 2
Query:  725 LNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTY 970
             NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTY
Sbjct:    1 FNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTY 82          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|P11178|ODBA_BOVIN (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Bos taurus OX=9913 GN=BCKDHA PE=1 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 1.951e-144
Identity = 235/393 (59.80%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   +E  +K  K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL+D DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  ++ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + +L+ + WW D++E+AWR +SRK V++A E+AE+   PNP ++F DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   60 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPQEKVLKFYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDDTDLVFGQYREAGVLMYRDYPLELFMAQCYGNVSDLGKGRQMPVHYGCRERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGILSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHHLQSRGWWDDEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLIFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH 452          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|Q8HXY4|ODBA_MACFA (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Macaca fascicularis OX=9541 GN=BCKDHA PE=2 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 2.490e-144
Identity = 237/393 (60.31%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SRK V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   50 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRKKVMKAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLEH 442          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|A5A6H9|ODBA_PANTR (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Pan troglodytes OX=9598 GN=BCKDHA PE=2 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 3.405e-144
Identity = 236/393 (60.05%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+P+ R + YL  + WW +++E+AWR +SRK V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   50 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPVSRLRHYLLSQGWWDEEQEKAWRKQSRKKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH 442          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|P12694|ODBA_HUMAN (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2)

HSP 1 Score: 450.284 bits (1157), Expect = 5.275e-144
Identity = 236/393 (60.05%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   KE  +K+ K+MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL++ DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SR+ V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   50 DKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH 442          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|P11960|ODBA_RAT (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Bckdha PE=1 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 9.954e-144
Identity = 235/393 (59.80%), Postives = 291/393 (74.05%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            DKP FP + +E+  +L FI P  I GIP+YRV+D  G +     DP   +E  +K+ ++MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL   DL+FGQYREAGV ++R + LE  + QCYGN  D  KG+QMP+HY  K+ ++ +ISS L TQ+P AVGAAYA KRA   + VICYFG+GA+S GDAHA  NF+ATL+CP+I  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + YL  + WW +++E+AWR +SRK V++A E+AE+   PNP +LF DVY EMP ++R Q       L+   EHYP+ +
Sbjct:   46 DKPQFPGASAEFVDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPQEEVLKLYRSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALERTDLVFGQYREAGVLMYRDYPLELFMAQCYGNVSDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANQIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQEMPAQLRRQQESLARHLQTYGEHYPLDH 438          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A2C9JEY2 (2-oxoisovalerate dehydrogenase subunit alpha OS=Biomphalaria glabrata OX=6526 GN=106055402 PE=3 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 1.784e-161
Identity = 250/405 (61.73%), Postives = 311/405 (76.79%), Query Frame = 2
Query:  104 SLYCTSAD--KPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSP 1312
            S Y TSA+  KPNFP SRSE+ S+L FI P + +GIP+YR L+ +GN  +   DPK  +   +K+ K MTLLNTMDR+LYDSQRQGRISFYMT+YGEEG  IGSAAAL+  DLI+GQYREAGV +WRGF L++ ++QCYGN  D  KG+QMP+HY +++LN+ +ISS L TQMP A G+AYAFKR QNG CVICYFG+GA+S GDAHAA NF+A L+CP+I  CRNN YAISTP  +QYRGDGI SR  GYG+ ++RVDGND+ AVYNATK ARE+C++++RPVLIEAMTYRIG HSTSDDS AYRSVDEV+ WDK DNPI RF+ Y+  +  W D +E+ W+ +SRK+V++A   AE      P  LFEDVYDEMP  ++ QMN     +K+ KEHYP+ +  P
Sbjct:   35 SYYSTSAEIGKPNFPGSRSEFISKLEFIDPDNAEGIPVYRALNADGNFIDASQDPKLDESTVLKMYKDMTLLNTMDRVLYDSQRQGRISFYMTNYGEEGTHIGSAAALDPKDLIYGQYREAGVLMWRGFPLQQFMHQCYGNAKDIGKGRQMPVHYGSRELNFVTISSTLATQMPQASGSAYAFKRKQNGLCVICYFGEGAASEGDAHAAFNFAAVLNCPIIFFCRNNGYAISTPTKDQYRGDGIASRAAGYGMLSVRVDGNDVFAVYNATKKAREMCISQSRPVLIEAMTYRIGHHSTSDDSSAYRSVDEVSHWDKTDNPISRFRRYMMNQGLWDDDKEQQWKLDSRKMVMKAFAAAESEKRGRPESLFEDVYDEMPDHLKQQMNSMKNHVKQYKEHYPLEHYQP 439          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: T1IQP4 (2-oxoisovalerate dehydrogenase subunit alpha OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 6.212e-160
Identity = 247/415 (59.52%), Postives = 318/415 (76.63%), Query Frame = 2
Query:   53 RVFRFTTYCASKFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            R+ +F+   +   + L S   T  D+PNFP S+S++T +L+FI      GIP+YRV+D  GN+  +  DPK  K+  +KI + MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAALND DL+FGQYREAGV +WRGF+L++ +NQCY N  D  KG+QMP+HY + + ++ +ISS L TQMP AVGAAY+FKRAQNG CVICYFG+GA+S GDAHAA NF+ATLDCP+I  CRNN YAISTP HEQYRGDGI  RG  YG+A+IRVDGND++AVYN TKAAR +   E RPVLIEAMTYRIG HSTSDDS AYRSVDEV +WD+ D+PI R + ++K++N W D +E+AW++ES+K V+++  KAEK   P P +LF DVYDE+   ++ QM++    + ++ +HYP+
Sbjct:   21 RIKKFSNTFSHVGSRLFSSSSTPDDQPNFPGSKSQFTDKLDFIRSDLYDGIPVYRVMDRKGNIINESEDPKLDKDLLVKIYQKMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHMGSAAALNDKDLVFGQYREAGVLMWRGFSLDQFMNQCYSNCKDLGKGRQMPVHYGSPEHHFVTISSTLATQMPQAVGAAYSFKRAQNGLCVICYFGEGAASEGDAHAAFNFAATLDCPIIFFCRNNGYAISTPTHEQYRGDGIAGRGPAYGLASIRVDGNDVLAVYNVTKAARRIVTEEGRPVLIEAMTYRIGHHSTSDDSTAYRSVDEVRYWDEKDHPISRLRRFMKKQNLWDDDKEKAWKDESKKQVMKSFAKAEKLKKPAPELLFTDVYDELTPHLQEQMDEMKRHVSKHADHYPL 435          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A1D1VN44 (2-oxoisovalerate dehydrogenase subunit alpha OS=Ramazzottius varieornatus OX=947166 GN=RvY_13520-1 PE=3 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 5.818e-159
Identity = 244/391 (62.40%), Postives = 307/391 (78.52%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            DKP FP SRSE+T +L F+ P    GIP+YRV+D  G +R+   +PK  +   +K+ + MTLLN MDRILY+SQRQGRISFYMTH+GEEG+ IGSAA L+D DL + QYREAGV +WRGFTL++ +NQCYGN+ D  KGKQMP+HY +K+L + ++SS L TQMP AVG+AYA+KRAQNG+ VICYFGDGA+S GDAHAA NFSATLDCP+I  CRNN YAISTP  +Q+RGDGI SRG GYGI TIRVDGND +A+YN TKAAR++ + +NRPVLIEAMTYRIG HSTSDDS AYRSVDEV  WDK DNPI RF+ Y+ QK +W+D++E  W+++++K V+QA ++AE    P+P  LF DVYDE+P  ++ Q  +   F++ N EHYP+
Sbjct:   79 DKPRFPGSRSEWTEKLEFLMPEAYPGIPVYRVMDRKGLIRDAAQEPKLDEPTLVKMYQKMTLLNYMDRILYESQRQGRISFYMTHFGEEGILIGSAAGLDDKDLAYVQYREAGVLMWRGFTLDQFMNQCYGNEEDLGKGKQMPVHYGSKELAFVTVSSPLATQMPQAVGSAYAYKRAQNGQIVICYFGDGAASEGDAHAAFNFSATLDCPIIFFCRNNGYAISTPTSQQFRGDGIASRGPGYGIPTIRVDGNDTLAIYNVTKAARDISLQQNRPVLIEAMTYRIGHHSTSDDSSAYRSVDEVKHWDKEDNPIARFRRYITQKGYWNDEKETQWKDQAKKQVMQAFQRAEHKKKPSPEELFNDVYDELPWHLQKQRKEMMDFVRSNPEHYPL 469          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: V4AHL2 (2-oxoisovalerate dehydrogenase subunit alpha OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_202459 PE=3 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 1.329e-158
Identity = 245/393 (62.34%), Postives = 311/393 (79.13%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISY 1303
            ++P FP S+SE+ S+L FI P  + GIP+YR L  +G + ED  DPK   E  IK+ K MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  IGSAAAL+  D++FGQYREAGV +WRGFTL++ ++QCYGN+ D  KG+QMP+HY +K++N+ +ISS L TQMP A GAAYA+KRA+NG CVICYFG+GA+S GDAHAA NF+A LDCPVI  CRNN YAISTPV +QYRGDGI SRGIGYG+ T+RVDGND+ AVYNA K+AR++CV +NRPVLIEAMTYRIG HSTSDDS AYRSVDEV++WDK DNPI R + Y+   N+W +++E+AW+ ++RKLV+++  +AE    PNP  +F DVYD +P  +  Q N+    +K+ KE+YP+ +
Sbjct:   48 ERPEFPGSKSEFISKLKFIDPDKVDGIPVYRALGRDGKILEDSEDPKLDSETVIKMYKDMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHIGSAAALDQKDMVFGQYREAGVLMWRGFTLDQFMDQCYGNENDIGKGRQMPVHYGSKEMNFMTISSPLATQMPQAAGAAYAYKRAKNGLCVICYFGEGAASEGDAHAAFNFAAVLDCPVIFFCRNNGYAISTPVKDQYRGDGIASRGIGYGMPTVRVDGNDVFAVYNAVKSARDMCVAQNRPVLIEAMTYRIGHHSTSDDSSAYRSVDEVSYWDKQDNPISRLRNYMTNNNFWDEEKEKAWKLKARKLVMKSFAEAENRKRPNPEEMFNDVYDILPKHLEEQKNEMKAHVKQYKENYPLEH 440          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A443R1R3 (2-oxoisovalerate dehydrogenase subunit alpha OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_06303 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 1.365e-156
Identity = 249/406 (61.33%), Postives = 306/406 (75.37%), Query Frame = 2
Query:   80 ASKFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            +SK +   +   T+ D+P FP SRSE+T +L F   TD  GIP+YRV++ +G++ ++  DP   +    KI K MTLLNTMDR+LY+SQRQGRISFYMT +GEEG   GSAAALND DL+FGQYRE GV +WRGF L+++++QCYGN   ++KG+QMP+HY +K L++ +ISS L TQMP AVGAAY FKR  NGK VICYFG+GASS GDAHAALNF+ATLDCP+I  CRNN YAISTP HEQYRGDGI  RG GYGIA+IRVDGND +AVYN T AAR  C+ E++PVLIEAMTYRIG HSTSDDS AYRSVDEV +W + D+PI R + Y++ K  W D +E+ W+ ESR+ V+QA   AEK   PN + +F DVY+EMP  +RSQ N     LK  KEHYPI
Sbjct:   34 SSKLSTSEAKVNTNNDRPQFPGSRSEWTQKLAFTRNTDYDGIPVYRVMNRDGSIIDESQDPNLGEAKITKIYKGMTLLNTMDRVLYESQRQGRISFYMTSFGEEGTHFGSAAALNDDDLVFGQYREGGVIMWRGFNLQQVMDQCYGNIDGNDKGRQMPVHYGDKNLHFVTISSTLATQMPQAVGAAYHFKRQANGKVVICYFGEGASSEGDAHAALNFAATLDCPIIFFCRNNGYAISTPTHEQYRGDGIAGRGSGYGIASIRVDGNDTLAVYNVTAAARNYCIEESKPVLIEAMTYRIGHHSTSDDSSAYRSVDEVRYWHQQDHPISRLRKYMELKGLWDDAKEKEWKEESRRQVLQAFVAAEKKPKPNVIEMFTDVYNEMPDNLRSQYNDLKAHLKVYKEHYPI 439          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:NCBI gene;Acc:103041479])

HSP 1 Score: 464.922 bits (1195), Expect = 1.802e-150
Identity = 234/396 (59.09%), Postives = 292/396 (73.74%), Query Frame = 2
Query:  110 YCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            + +SA+KP FP + +E+   L FI P  I GIP+YRV+D  G +     DP  SKE  +   + MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL+  DL+FGQYREAGV ++RGF L+  + QCY N  D  KG+QMP+HY  K LN+ +ISS L TQ+P A GAAYA KR    + VICYFG+GA+S GDAHA  NFSATL+CP+I  CRNN YAISTP +EQYRGDGI +RG GYG+ +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  ++WW + EE AWR +SRKLV++A E+AE+   P+P ++F DVYD+M   +  Q    +  +++ KEHYP+
Sbjct:   46 FDSSAEKPQFPGASAEFVDHLEFIQPNVISGIPIYRVMDRQGQIINPSEDPNLSKETVLNFYQKMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDPTDLVFGQYREAGVLMYRGFPLDLFMAQCYANADDLGKGRQMPVHYGCKDLNFVTISSPLATQIPQAAGAAYAVKRENANRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGIAARGPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPHPDLMFTDVYDQMTPGLEKQKEAMWRHVQQYKEHYPL 441          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:NCBI gene;Acc:103041479])

HSP 1 Score: 421.394 bits (1082), Expect = 3.891e-135
Identity = 209/332 (62.95%), Postives = 256/332 (77.11%), Query Frame = 2
Query:  302 MTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL+  DL+FGQYREAGV ++RGF L+  + QCY N  D  KG+QMP+HY  K LN+ +ISS L TQ+P A GAAYA KR    + VICYFG+GA+S GDAHA  NFSATL+CP+I  CRNN YAISTP +EQYRGDGI +RG GYG+ +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  ++WW + EE AWR +SRKLV++A E+AE+   P+P ++F DVYD+M   +  Q    +  +++ KEHYP+
Sbjct:   39 MTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDPTDLVFGQYREAGVLMYRGFPLDLFMAQCYANADDLGKGRQMPVHYGCKDLNFVTISSPLATQIPQAAGAAYAVKRENANRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGIAARGPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPHPDLMFTDVYDQMTPGLEKQKEAMWRHVQQYKEHYPL 370          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000025204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:7364240:7371214:-1 gene:ENSAMXG00000024490.2 transcript:ENSAMXT00000025204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 1.113e-39
Identity = 97/320 (30.31%), Postives = 168/320 (52.50%), Query Frame = 3
Query: 2796 RTKIISRGSILFQNKEFP--FELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXXXXXXXXXXXXASGFSKR*KIE-KLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYLKLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTG 3746
            R +I+ +G +   + EFP   E P     T+  + R + N +++ RS L++S+S ++ +CF C +L        +      GF K   +   L  HE S  H  +   W E ++R+ +  T+D   +T +Q E + W  V++R++A I  L  +N AL     + +     + GNFL+ ++L+A++DP++  +++        V YLS  IQN+ I+L+     NK+L++I     Y +++D TPD+ H+ QLS V+R V+ D    +++I E F GFI++          V++  LQ  N+ + DCR Q Y N + M G
Sbjct:   30 RCQIVRKGPVQITDIEFPQNSENPPR-RFTKENYRRTMKNGEKILRSWLVYSMSTDSVFCFPCTVLGKRDNALSN-----CGFHKWKNLTYHLKEHEYSKGHCDNMRNWHELQRRLQNKTTIDQRQQTLMQIEIEHWKAVIRRVIAIICHLAERNQAL---RGTTSVLYDPHNGNFLAQVELMAKFDPVMNEHIRRRQNQEAKVHYLSGTIQNEIIALIG----NKVLEEIITQRDYSVIMDCTPDISHKEQLSVVLRLVNCD---PSVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKHNLSISDCRGQSYDNGSNMMG 333          

HSP 2 Score: 38.1206 bits (87), Expect = 1.113e-39
Identity = 19/54 (35.19%), Postives = 30/54 (55.56%), Query Frame = 1
Query: 3760 QQRIRAR----NHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLS 3909
            +Q +RAR    N++AL + C +H LNL    + K   L  +FFG ++ +Y   S
Sbjct:  335 KQGVRARILQLNNKALCIPCSSHKLNLVVADAAKSSVLSTSFFGVLQRLYNLFS 388          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 6.737e-39
Identity = 81/235 (34.47%), Postives = 130/235 (55.32%), Query Frame = 3
Query: 3060 KLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYL-KLASESPGS--VSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTI-NIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTGHI 3752
            K   HE    H++ +  WK  +  ++    +D +++ Q+QTE ++   +L+R+L     L S+NLA   K  +L     ++ GNFL  L+L+A YDP +  +L K+  +  GS    YLSP+ QN+FI L    V + +LK+ +   YY ++ DSTPD+ H  Q   ++R+V  D E++ +  I E F+ F + H K       +I+  LQS+ IPL +CR Q Y N A M+G +
Sbjct:  141 KFPEHEKHTPHKQCYVKWKSLQHSLLVATGVDGHLQKQLQTEAEKHTKILERLLDVTLHLASRNLAFRGKTSNLD---DVHNGNFLGTLELLAHYDPFIHEHLEKVKQKKKGSRLTHYLSPDTQNEFIELCGKRVLSTILKEREDAIYYSVICDSTPDISHTEQNVILVRYVHQDKEDRGVWKIVERFIEFKDFHKKTGQEISEMIIEALQSNGIPLQECRGQGYDNGANMSGKV 372          

HSP 2 Score: 45.0542 bits (105), Expect = 6.737e-39
Identity = 25/70 (35.71%), Postives = 34/70 (48.57%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLSFNSSMGTTKK----CFTHR 3954
            +Q +I   N  A F  C  H+LNL GVH+ +  P V TFFG++  +Y   S +       K    C  HR
Sbjct:  375 VQAQILKANPLATFSPCATHTLNLVGVHAAESCPEVATFFGSVNRLYNLFSASPERWAILKEKTGCSLHR 444          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000044961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:419978:423709:1 gene:ENSAMXG00000036481.1 transcript:ENSAMXT00000044961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.665 bits (361), Expect = 9.957e-39
Identity = 93/322 (28.88%), Postives = 169/322 (52.48%), Query Frame = 3
Query: 2796 RTKIISRGSILFQNKEFP--FELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXXXXXXXXXXXXASGFSKR*KIE-KLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAE-AGMNFGNFLSLLKLIAEYDPLLESYLKLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTGH 3749
            R +I+ +G++   + +FP   E P     T+  + R + N +++ RS L++S+S ++ +CF C +           +     F K   +   L  HE S  H  +   W E ++R+ +  T+D   +  +Q E + W  V++R++A I  L  +N AL       T+E    + GNFL+ ++L+A++DP++  +++        V YLS  IQN+ I+L+ + V  ++++  +  +YY +++D TPD+ H+ QLS V+R V+ D    +++I E F GFI++          V++  LQ  N+ + DCR Q Y N + M G 
Sbjct:   80 RCQIVRKGTVQITDIQFPQNSENPPR-RFTKENYRRTMKNGEKILRSWLVYSMSTDSVFCFPCTVFGKRDNALSKLW-----FHKWKNLTYHLKEHEYSKGHCDNMRNWHELQRRLQNKTTIDQRQQALMQIEIEHWKAVIRRVIAIICHLAERNQALR----GTTSELYDPHNGNFLAQVELMAKFDPVMNEHIRRIQNQEAKVHYLSGTIQNEIIALIGNKVLEEIVRRAQRAKYYSVIMDCTPDISHKEQLSVVLRLVNCD---PSVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKHNLSISDCRGQSYDNGSNMMGQ 388          

HSP 2 Score: 38.5058 bits (88), Expect = 9.957e-39
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLS 3909
            +Q RI   N++AL + C +H+LNL    + K   L  +FFG ++ +Y   S
Sbjct:  392 VQARILQLNNKALCIPCSSHTLNLVVADAAKSSVLSTSFFGVLQRLYNLFS 442          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Sea Lamprey
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 458.759 bits (1179), Expect = 1.817e-149
Identity = 242/396 (61.11%), Postives = 295/396 (74.49%), Query Frame = 2
Query:  125 DKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPH-----AVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            DKP FP + +EY+  + FI P  I GIP+YRV+D  G +     DPK  KE  +K+ K MTLLNTMDRILY+SQRQGRISFYMT+YGEEG  +GSAAAL   DL+FGQYREAGV +WR F L+  ++QCYGN  D  KG+QMP+HY + +LN+ +ISS L TQ+P      AVGAAYA+KRA N + VICYFG+GA+S GDAHA  NFSATL+CPVI  CRNN YAISTP  EQYRGDGI +RG GYGI +IRVDGND+ AVYNAT+ AR   V+EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+ +++ W+D  E+ WR +SRKLV++A EKAEK   P+P  LF DVY EM   I+ QM++    +K   EHYP+
Sbjct:    4 DKPLFPGASAEYSDTMEFIQPNVIAGIPVYRVMDRQGQIINPKEDPKLDKETVLKMYKKMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHMGSAAALEPHDLVFGQYREAGVLMWRDFPLDMFMSQCYGNVDDPGKGRQMPVHYGSNELNFVTISSPLATQIPQARTHAAVGAAYAYKRANNDRVVICYFGEGAASEGDAHAGFNFSATLECPVIFFCRNNGYAISTPTDEQYRGDGIAARGPGYGILSIRVDGNDVFAVYNATREARRRAVSENQPTLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRNYMLRESMWNDSLEKDWRKQSRKLVLEAFEKAEKRLKPSPSELFHDVYKEMTPHIQRQMDEMRRHVKIYAEHYPM 399          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Yeast
Match: PDA1 (E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex; catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA; phosphorylated; regulated by glucose; PDH complex is concentrated in spots within the mitochondrial matrix, often near the ERMES complex and near peroxisomes [Source:SGD;Acc:S000000980])

HSP 1 Score: 137.502 bits (345), Expect = 6.136e-35
Identity = 87/289 (30.10%), Postives = 140/289 (48.44%), Query Frame = 2
Query:  383 GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIH-YANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPL--ILFEDVY---DEMPT 1231
            G+E + +G   A+   D I   YR  G    RG +++ +L +  G +   + GK   +H YA     ++  + ++G Q+P   G A+A +      C    +GDGAS+ G    + N +   + PV+  C NN Y + T             RG       ++V+G D++AVY A+K A++ C++   P+++E  TYR G HS SD    YR+ DE+      ++PI   K +L      ++ E +A+   +RK V + +E A+    P     ILFEDVY    E PT
Sbjct:  116 GQEAIAVGIENAITKLDSIITSYRCHGFTFMRGASVKAVLAELMGRRAGVSYGKGGSMHLYAP---GFYGGNGIVGAQVPLGAGLAFAHQYKNEDACSFTLYGDGASNQGQVFESFNMAKLWNLPVVFCCENNKYGMGTAASRSSAMTEYFKRGQYI--PGLKVNGMDILAVYQASKFAKDWCLSGKGPLVLEYETYRYGGHSMSDPGTTYRTRDEIQHMRSKNDPIAGLKMHLIDLGIATEAEVKAYDKSARKYVDEQVELADAAPPPEAKLSILFEDVYVKGTETPT 399          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Nematostella
Match: EDO43057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV6])

HSP 1 Score: 443.736 bits (1140), Expect = 7.277e-143
Identity = 227/392 (57.91%), Postives = 279/392 (71.17%), Query Frame = 2
Query:  125 DKPNFPQSRS-EYTSQLNFIYPTDIKGI-PLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYP 1294
            DKP +P + +  +T +L F+ P D +GI P+YRV+D  G +  D  DPK  +   + + K MTLLNTMDRILY+SQRQGRISFYMT+YGEE    GSAAAL   DLI GQYREAGV +WRGFTL + +NQCY N++D+ KG+QMP+HY +K+LN+ +ISS L TQMP A GAAYA KR   G CV+CYFGDGA+S GDAH+A NF+ATLD PVI  CRNN YAISTP  EQYRGDGI  RG  YG+  IRVDGND+ AVYN TK ARE+ VNENRPVL+EAMTYRIG HSTSDDS  YRS+ EV +WDK D+PI R ++Y++ K WW   +E+ W+ E+R  V+QA   AEK   P    LF DVY E    ++ Q  +    + +    YP
Sbjct:   46 DKPRYPGAMNCSFTEKLEFVDPMDPQGIIPVYRVMDRQGKIIIDSHDPKLPEGTIVDMYKKMTLLNTMDRILYESQRQGRISFYMTNYGEEATHFGSAAALEMEDLIMGQYREAGVLMWRGFTLADFMNQCYANQHDAGKGRQMPVHYGSKELNFVTISSTLATQMPQASGAAYALKRQGKGNCVMCYFGDGAASEGDAHSAFNFAATLDAPVIFFCRNNGYAISTPTREQYRGDGIACRGRSYGMLAIRVDGNDIFAVYNVTKKAREIAVNENRPVLVEAMTYRIGHHSTSDDSSVYRSLKEVNYWDKEDHPISRLRYYMEDKGWWDQDQEQQWKKEARLQVMQAFADAEKALKPPVKELFLDVYKEFTPHLQEQYKECVDHVAKYPHEYP 437          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Nematostella
Match: EDO33561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRY1])

HSP 1 Score: 120.939 bits (302), Expect = 4.723e-29
Identity = 86/287 (29.97%), Postives = 133/287 (46.34%), Query Frame = 2
Query:  362 SFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLI--LFEDVY 1216
             F   + G+E   +G  A+++  D +   YR  G    RG +  E+L +  G K    +GK   +H    +  Y+  + ++G Q+P   G A A K   NG+  +  +GDGA++ G      N +   + P I +C NN Y + T V  +           G  I  IRVDG D++ V  ATK A +   +   P+L+E  TYR   HS SD   +YRS DE+    K  +PI   +  L      S  + +    E++  + +A+E A+  N P P +  LF  VY
Sbjct:   92 GFCHLYSGQEACCVGMEASIDKNDSVITAYRCHGWTYMRGRSAREVLCELTGRKTGCTQGKGGSMHMYGHE--YYGGNGIVGAQVPLGAGIALAHKLRGNGRICLTLYGDGAANQGQLFETYNMAKLWNLPCIFICENNGYGMGTSV--ERAAATTEYYSRGDYIPGIRVDGMDVLTVREATKWAVDYARSGKGPILMELKTYRYYGHSMSDPGTSYRSRDEIQSVRKTRDPITGLREKLLDSGLASTDDIKKIEQEAKAEIDEAVECAK--NDPEPPLDDLFMHVY 372          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:NCBI gene;Acc:101166649])

HSP 1 Score: 461.07 bits (1185), Expect = 6.809e-149
Identity = 232/394 (58.88%), Postives = 290/394 (73.60%), Query Frame = 2
Query:  116 TSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPI 1297
            +S +KP FP + +++   L FI P  I GIP+YRV+D  GN+     DP+ SKE  +   + MT+LNTMDRILY+SQRQGRISFYMT+YGEEG  IGSAAAL   D++FGQYREAGV ++RGF L+  + QCY N  D  KG+QMP+HY  K LN+ +ISS L TQ+P A GAAYA KR    + VICYFG+GA+S GDAHA  NFSATL+CP+I  CRNN YAISTP +EQYRGDGI +RG GYG+ +IRVDGND+ AVYNATK AR   V EN+P LIEAMTYRIG HSTSDDS AYRSVDEV +WDK D+PI R + Y+  + WWS+ +E +WR +SRK V++A E+AE+   PNP +LF DVY EM   +  Q +  +  +++ KEHYP+
Sbjct:   51 SSLEKPQFPGASADFVDHLEFIQPNVISGIPVYRVMDRQGNIINPSQDPQLSKETVLNFYQKMTMLNTMDRILYESQRQGRISFYMTNYGEEGTHIGSAAALEPTDMVFGQYREAGVLMYRGFPLDLFMAQCYANADDLGKGRQMPVHYGCKDLNFVTISSPLATQIPQAAGAAYALKRENLNRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGIAARGPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARGWWSEDDERSWRKQSRKTVMEAFERAERRLKPNPELLFTDVYQEMTPGLSRQRDSMWRHVQQYKEHYPV 444          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 141.354 bits (355), Expect = 9.649e-39
Identity = 111/390 (28.46%), Postives = 192/390 (49.23%), Query Frame = 3
Query: 2595 ENSVATDADDRAIEPIDYMNESQDLSDDEKNLVVVTQDVIPAVFLFHDLAYLEFDRETQLSIVSQLLRTKIISRG-SILFQNKEFPFELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXX----XXXXXXXXXXASGFSKR*KIEKLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYL-KLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTG 3746
            E S  ++A+D  +       E+ ++  DE  L    +D             L  D     S ++  +R +++ RG S +  +  FP     G S    +F + L + +++ R+ L++S    + +CF C L ++     + +  +++K AS +        L AHE S  H      WKE   RI  GKT+D      ++ E+ RW  VL R++A ++ L  +NLAL     +L   +    GNFL  ++L+A +DP+++ +L ++   +    SY+   +QN+ I LL+S + + ++ DIK  +Y+ I+LD T D+ H  QLS +IR V +    +   I+E F+GF+E          ++I+ +L+   I  +DCR Q Y N A M G
Sbjct:   82 EQSFDSEAED-VVPSTSTQLETSEMPGDETPLTPTAED-----------QPLPTDPAKWPSPLTDRIRMELVRRGPSSIPPDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTY--------LTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSN---GNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL---MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKG 445          

HSP 2 Score: 41.2022 bits (95), Expect = 9.649e-39
Identity = 17/51 (33.33%), Postives = 30/51 (58.82%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLS 3909
            +Q R+  +N RALF+ C  H+LNL    + K+    +++FG ++ +Y   S
Sbjct:  450 VQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFS 500          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 141.354 bits (355), Expect = 9.649e-39
Identity = 111/390 (28.46%), Postives = 192/390 (49.23%), Query Frame = 3
Query: 2595 ENSVATDADDRAIEPIDYMNESQDLSDDEKNLVVVTQDVIPAVFLFHDLAYLEFDRETQLSIVSQLLRTKIISRG-SILFQNKEFPFELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXX----XXXXXXXXXXASGFSKR*KIEKLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYL-KLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTG 3746
            E S  ++A+D  +       E+ ++  DE  L    +D             L  D     S ++  +R +++ RG S +  +  FP     G S    +F + L + +++ R+ L++S    + +CF C L ++     + +  +++K AS +        L AHE S  H      WKE   RI  GKT+D      ++ E+ RW  VL R++A ++ L  +NLAL     +L   +    GNFL  ++L+A +DP+++ +L ++   +    SY+   +QN+ I LL+S + + ++ DIK  +Y+ I+LD T D+ H  QLS +IR V +    +   I+E F+GF+E          ++I+ +L+   I  +DCR Q Y N A M G
Sbjct:   82 EQSFDSEAED-VVPSTSTQLETSEMPGDETPLTPTAED-----------QPLPTDPAKWPSPLTDRIRMELVRRGPSSIPPDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTY--------LTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSN---GNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL---MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKG 445          

HSP 2 Score: 41.2022 bits (95), Expect = 9.649e-39
Identity = 17/51 (33.33%), Postives = 30/51 (58.82%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLS 3909
            +Q R+  +N RALF+ C  H+LNL    + K+    +++FG ++ +Y   S
Sbjct:  450 VQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFS 500          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 141.354 bits (355), Expect = 9.649e-39
Identity = 111/390 (28.46%), Postives = 192/390 (49.23%), Query Frame = 3
Query: 2595 ENSVATDADDRAIEPIDYMNESQDLSDDEKNLVVVTQDVIPAVFLFHDLAYLEFDRETQLSIVSQLLRTKIISRG-SILFQNKEFPFELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXX----XXXXXXXXXXASGFSKR*KIEKLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYL-KLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTG 3746
            E S  ++A+D  +       E+ ++  DE  L    +D             L  D     S ++  +R +++ RG S +  +  FP     G S    +F + L + +++ R+ L++S    + +CF C L ++     + +  +++K AS +        L AHE S  H      WKE   RI  GKT+D      ++ E+ RW  VL R++A ++ L  +NLAL     +L   +    GNFL  ++L+A +DP+++ +L ++   +    SY+   +QN+ I LL+S + + ++ DIK  +Y+ I+LD T D+ H  QLS +IR V +    +   I+E F+GF+E          ++I+ +L+   I  +DCR Q Y N A M G
Sbjct:   82 EQSFDSEAED-VVPSTSTQLETSEMPGDETPLTPTAED-----------QPLPTDPAKWPSPLTDRIRMELVRRGPSSIPPDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTY--------LTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSN---GNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL---MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKG 445          

HSP 2 Score: 41.2022 bits (95), Expect = 9.649e-39
Identity = 17/51 (33.33%), Postives = 30/51 (58.82%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLS 3909
            +Q R+  +N RALF+ C  H+LNL    + K+    +++FG ++ +Y   S
Sbjct:  450 VQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFS 500          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101165911])

HSP 1 Score: 127.872 bits (320), Expect = 4.421e-31
Identity = 84/270 (31.11%), Postives = 130/270 (48.15%), Query Frame = 2
Query:  383 GEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNP 1192
            G+E   +G  A++N  D +   YR  G    RG T+++++ +  G +    KGK   +H   K  N++  + ++G Q+P   G A A K   N +  +C +GDGA++ G      N ++    PVI +C NN Y + T V  +           G  I  +RVDG D++ V  AT+ A E C +   P+L+E  TYR   HS SD  ++YR+ +E+       +PI   K  L   N  S +E +    E RK +  A + A  T  P P
Sbjct:   92 GQEACAVGIEASINMSDHLITAYRAHGYTYTRGGTVKKIMAELTGRRGGIAKGKGGSMHMYCK--NFYGGNGIVGAQVPLGAGVALACKYQGNNELCVCLYGDGAANQGQIFETYNMASLWKLPVIFICENNRYGMGTSV--ERAAASTDYYKRGEFIPGLRVDGMDVLCVREATRFAAEHCRSGKGPILMELQTYRYHGHSMSDPGISYRTREEIQEVRSKSDPISLLKDRLLSNNMASVEELKVIDVEVRKEIEDAAQFA--TTDPEP 355          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000021409.1 (SMESG000021409.1)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 427/427 (100.00%), Postives = 427/427 (100.00%), Query Frame = 2
Query:   41 MLLNRVFRFTTYCASKFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEKI 1321
            MLLNRVFRFTTYCASKFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPKFSKEFSIKIIKTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQYRGDGIGSRGIGYGIATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEKI
Sbjct:    1 MLLNRVFRFTTYCASKFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPKFSKEFSIKIIKTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQYRGDGIGSRGIGYGIATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEKI 427          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000021408.1 (SMESG000021408.1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 279/402 (69.40%), Postives = 328/402 (81.59%), Query Frame = 2
Query:  116 TSADKPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEKI 1321
             S D P FP SRSEYT+ L F++PTDI+GI +YRVL+  G +     DP  SKE  I++ K MTLLN  DRI+YDSQRQGRISFYMT++GEEG Q+GSA AL+  DL+FGQYREAGVGLWRG+T+E MLNQCYGNK D  KG+QMP+HY NK  N FSISS LGTQ+ HA GAAYAFKR QNG C +CYFGDGA+S GDAHAA+NFS+TLDCP+I  CRNN YAISTP  EQYRGDGI SR  GYG+A IRVDGND+ AVYNATKAAR LCVNENRPVLIEAMTYR+GSHSTSDDSLAYRSVDE++WWDKHDNPI R K YL  + WWS+ EE+ WR+E+RKLVV+AIEK EK  LPNP+ LFEDVYD+MP R+  QM+K Y+F+ +NK+ +P +Y++P+ I
Sbjct:   24 VSIDTPQFPGSRSEYTTHLKFLFPTDIEGISVYRVLNREGQIMGQDNDPNISKETLIEMFKKMTLLNIFDRIMYDSQRQGRISFYMTNFGEEGAQLGSAVALDKNDLVFGQYREAGVGLWRGYTIEGMLNQCYGNKNDFGKGRQMPVHYTNKDANIFSISSPLGTQLLHAAGAAYAFKRNQNGLCTVCYFGDGAASEGDAHAAMNFSSTLDCPMIFFCRNNGYAISTPTSEQYRGDGIASRASGYGMACIRVDGNDIFAVYNATKAARNLCVNENRPVLIEAMTYRVGSHSTSDDSLAYRSVDEISWWDKHDNPISRLKHYLLNQGWWSEGEEKIWRDEARKLVVKAIEKTEKVPLPNPMELFEDVYDKMPQRLYKQMSKQYSFMVKNKDLFPTAYETPKPI 425          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000021412.1 (SMESG000021412.1)

HSP 1 Score: 400.979 bits (1029), Expect = 7.957e-127
Identity = 207/422 (49.05%), Postives = 294/422 (69.67%), Query Frame = 2
Query:   59 FRFTTYCASKFNVLVSLYCTSAD-KPNFPQSRSEYTSQLNFIYPTDIKGIPLYRVLDGNGNLREDGLDPXXXXXXXXXXXXTMTLLNTMDRILYDSQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQXXXXXXXXXXXXXXXATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEKI 1321
            +RF    ++    +   Y  S + + +FP   + YT++L F    +    P++++LD NG L +   +   ++E  +K+++TM +LNT D +  + Q++  IS Y T +GEEG+QIGSAAAL + D++F QYRE GVGLWRGF +E+MLNQ + NK D N+GKQMPIHY+NK +N+FSISS LGTQMP AVG +Y  K  +  + VICYFG+G +SVGDA  ALNF+ATL+CP+I  CRNN YAISTP  EQY GDG+ +RG G+GI+T++VDGND +AVY ATK ARE  + +N+PVLIEAMTYR+G+H+T +  +AYR +DEV +W+ +DNP+LRF+ +L  +  WS ++ + +  E R  +   IE+A+  +  NPL+LFEDVYD M   ++ QM K   FL  N+EHYP ++++P  I
Sbjct:    8 WRFNVIKSTMLKQVTCFYQKSVETRDHFPPPETIYTNKLKFYDCLNKWNFPIFQILDTNGQLIDPNQEIGITQEDLVKMMQTMIILNTFDILANELQQKKIISLYATSFGEEGLQIGSAAALAENDMVFTQYREPGVGLWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGLAARGCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGIAYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 429          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000069312.1 (SMESG000069312.1)

HSP 1 Score: 340.887 bits (873), Expect = 5.066e-102
Identity = 181/318 (56.92%), Postives = 227/318 (71.38%), Query Frame = 3
Query: 2847 PFELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXXXXXXXXXXXXASGFSKR*KIEKLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYLKLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKV-IRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTGHILSSTEDSC*KSPSPV 3797
            PFE   G S   +WF R LAN DE+N++ LL+S    +AYCF CLL   S  N RS   L  GF+K  K EK+ AHENS +HR SFT WKEAE+RI+ GK +DA ++ Q+Q EKQ+W +VLKR+L+C+K L SQNLAL     SL      N GNFL+ LKL+AEYDPLL +++  A ++PGSVSYLSP+ QN+ ISLLAS VRNKLL DIK N+YY IL DSTPD  HR  LS+V +R+V++ F NKT+ IKESFLGFIE+HAKDAAT E VI   L++DN+ LDDCR QCY NAA+M+GHI    +  C ++P  +
Sbjct:  150 PFEFRNGRSSHSSWFTRRLANGDEINQTWLLYSPLKSSAYCFCCLLFPKSINNQRSGLTLPEGFNKLRKPEKMSAHENSPTHRASFTAWKEAERRIMSGKGIDAELQAQMQNEKQKWRDVLKRLLSCVKFLASQNLALRGHAESLATNNSSNVGNFLATLKLLAEYDPLLSNHIDHARQNPGSVSYLSPQTQNESISLLASKVRNKLLNDIKRNKYYGILFDSTPDQAHRELLSRVSMRYVNVYFSNKTVTIKESFLGFIELHAKDAATLEHVIADTLEADNLRLDDCRSQCYDNAALMSGHISGLQQRICNRNPRAI 467          

HSP 2 Score: 85.1149 bits (209), Expect = 2.146e-16
Identity = 52/120 (43.33%), Postives = 71/120 (59.17%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLSFNS----------SMGTTKKCFTHRG*T*I*NMLNA*VEPVNAIYEGLGELVDLLEKLS--DIEKCDTR 4080
            LQQRI  RN RA+FVNC+NHSLNLAG+HS KQD + VTFF TI+SIY++ S ++          S    ++C T           +A  + V A++ G+ E+V LLE  S  + +  DTR
Sbjct:  455 LQQRICNRNPRAIFVNCNNHSLNLAGMHSAKQDAVAVTFFRTIKSIYLYFSRSTLRWNELKNVISNTVKRECETR---------WSARADAVKAVHNGVNEIVGLLEIFSADNSQTQDTR 565          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000049700.1 (SMESG000049700.1)

HSP 1 Score: 312.383 bits (799), Expect = 1.130e-93
Identity = 176/362 (48.62%), Postives = 222/362 (61.33%), Query Frame = 3
Query: 2712 IPAVFLFHDLAYLEFDRETQLSIVSQLLRTKIISRGSILFQNKEFPFELPKGCSITRAWFMR*LANEDEVNRS*LLFSLSDEAAYCF*CXXXXXXXXXXXXXXXXASGFSKR*KIEKLIAHENSHSHRKSFTTWKEAEQRIIDGKTLDAYIRTQIQTEKQRW*NVLKRILACIKLLDSQNLALC*KN*SLTAEAGMNFGNFLSLLKLIAEYDPLLESYLKLASESPGSVSYLSPEIQNKFISLLASIVRNKLLKDIK*NEYY*ILLDSTPDLGHRGQLSKVIRFVDIDFENKTINIKESFLGFIEMHAKDAATFETVIVAKLQSDNIPLDDCRLQCYGNAAVMTGHILSSTEDSC*KSPSPV 3797
            IP+V   +++ YLEFD+ +Q  I+SQ L+ +++ RGS  FQNK  PFE   G S+  +WF R LAN DE+NR+ LL+S    +AYCF  LL   S  N RS   L    +K  K EK+ AHENS +HR SFT WKEAE+ I+ G                                            SL    G N GNFL+ LKL+AEYDPLL ++L  A ++PGSVSYLSP+ QN+F+ LLAS VRNKLL DIK N+YY    DSTPD  HR  LS+V R+VD+DF NKT+ IKESFL FIE+HAKDAAT E VIV  L++DN+ LDDCR QCY NAA+M+GHI    +  C ++P  +
Sbjct:   37 IPSVLSCNNIGYLEFDKISQRLIISQRLKDELVERGSSAFQNKNGPFEFRDGRSMHSSWFTRRLANGDEINRTRLLYSPLKSSAYCFCGLLFPKSINNQRSGLTLPDDINKWRKPEKMSAHENSPNHRASFTVWKEAERWIMSGHAE-----------------------------------------SLATNNGSNVGNFLATLKLLAEYDPLLFNHLDHARQNPGSVSYLSPQTQNEFMGLLASKVRNKLLNDIKRNKYYGSFFDSTPDQAHREHLSRVKRYVDVDFSNKTVTIKESFLRFIELHAKDAATLEYVIVDTLEADNLRLDDCRSQCYDNAALMSGHISGLQQRICNRNPRAI 357          

HSP 2 Score: 94.3597 bits (233), Expect = 1.359e-19
Identity = 53/111 (47.75%), Postives = 70/111 (63.06%), Query Frame = 1
Query: 3757 LQQRIRARNHRALFVNCDNHSLNLAGVHSTKQDPLVVTFFGTIESIYVFLSFNS----------SMGTTKKCFTHRG*T*I*NMLNA*VEPVNAIYEGLGELVDLLEKLSD 4059
            LQQRI  RN RA+FVNC+N+SLNLAG+HS KQD + VTFFGTIESIY++ S ++          S    ++C T           +A  + V A++ G+ E+V LLEKLSD
Sbjct:  345 LQQRICNRNPRAIFVNCNNYSLNLAGMHSAKQDAVAVTFFGTIESIYLYFSRSTLRWNELKNVISNTVKRECDTR---------WSARADAVKAVHNGVNEIVGLLEKLSD 446          
The following BLAST results are available for this feature:
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BCKDHA1.098e-14460.05branched chain keto acid dehydrogenase E1 subunit ... [more]
AC011462.12.034e-14460.05novel protein[more]
BCKDHA4.209e-13956.46branched chain keto acid dehydrogenase E1 subunit ... [more]
BCKDHA1.959e-9858.12branched chain keto acid dehydrogenase E1 subunit ... [more]
BCKDHA4.358e-5351.67branched chain keto acid dehydrogenase E1 subunit ... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckd-1A9.322e-13556.512-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
bckd-1A9.996e-13556.512-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
pdha-14.832e-3430.03Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-14.832e-3430.03Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-14.832e-3430.03Probable pyruvate dehydrogenase E1 component subun... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81997.709e-13253.02gene:FBgn0037709 transcript:FBtr0082067[more]
Pdha5.795e-2429.37gene:FBgn0028325 transcript:FBtr0070710[more]
Pdha2.086e-2329.37gene:FBgn0028325 transcript:FBtr0070708[more]
Pdha2.086e-2329.37gene:FBgn0028325 transcript:FBtr0070709[more]
Pdha2.992e-2329.37gene:FBgn0028325 transcript:FBtr0070711[more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckdha3.908e-15260.00branched chain keto acid dehydrogenase E1 subunit ... [more]
bckdha3.908e-15260.00branched chain keto acid dehydrogenase E1 subunit ... [more]
pdha1a8.004e-3127.81pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
pdha1a8.594e-3127.81pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
pdha1a8.594e-3127.81pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h6pd1.158e-15359.61hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd2.136e-15360.25hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd2.289e-15359.23hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd2.568e-15360.25hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd4.645e-15360.30hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Bckdha7.561e-14559.80branched chain ketoacid dehydrogenase E1, alpha po... [more]
Pdha17.097e-2931.62pyruvate dehydrogenase E1 alpha 1 [Source:MGI Symb... [more]
Pdha26.888e-2830.32pyruvate dehydrogenase E1 alpha 2 [Source:MGI Symb... [more]
Bckdha2.309e-2371.95branched chain ketoacid dehydrogenase E1, alpha po... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11178|ODBA_BOVIN1.951e-14459.802-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|Q8HXY4|ODBA_MACFA2.490e-14460.312-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|A5A6H9|ODBA_PANTR3.405e-14460.052-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|P12694|ODBA_HUMAN5.275e-14460.052-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|P11960|ODBA_RAT9.954e-14459.802-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JEY21.784e-16161.732-oxoisovalerate dehydrogenase subunit alpha OS=Bi... [more]
T1IQP46.212e-16059.522-oxoisovalerate dehydrogenase subunit alpha OS=St... [more]
A0A1D1VN445.818e-15962.402-oxoisovalerate dehydrogenase subunit alpha OS=Ra... [more]
V4AHL21.329e-15862.342-oxoisovalerate dehydrogenase subunit alpha OS=Lo... [more]
A0A443R1R31.365e-15661.332-oxoisovalerate dehydrogenase subunit alpha OS=Di... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckdha1.802e-15059.09branched chain keto acid dehydrogenase E1 subunit ... [more]
bckdha3.891e-13562.95branched chain keto acid dehydrogenase E1 subunit ... [more]
ENSAMXT00000025204.21.113e-3930.31pep primary_assembly:Astyanax_mexicanus-2.0:12:736... [more]
ENSAMXT00000033195.16.737e-3934.47pep primary_assembly:Astyanax_mexicanus-2.0:16:112... [more]
ENSAMXT00000044961.19.957e-3928.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bckdha1.817e-14961.11branched chain keto acid dehydrogenase E1 subunit ... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDA16.136e-3530.10E1 alpha subunit of the pyruvate dehydrogenase (PD... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO430577.277e-14357.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335614.723e-2929.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckdha6.809e-14958.88branched chain keto acid dehydrogenase E1 subunit ... [more]
ENSORLT00000028133.19.649e-3928.46zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.19.649e-3928.46zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.19.649e-3928.46zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
pdha1a4.421e-3131.11pyruvate dehydrogenase E1 component subunit alpha,... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021409.10.000e+0100.00SMESG000021409.1[more]
SMESG000021408.10.000e+069.40SMESG000021408.1[more]
SMESG000021412.17.957e-12749.05SMESG000021412.1[more]
SMESG000069312.15.066e-10256.92SMESG000069312.1[more]
SMESG000049700.11.130e-9348.62SMESG000049700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010036 ID=SMED30010036|Name=2-oxoisovalerate dehydrogenase subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=4285bp
ATATTCTAACTGCTAGTTAACTTTTTAATGAATAAATGAAATGCTTTTGA
ATAGAGTTTTCAGATTTACAACATATTGCGCTTCTAAATTCAATGTTTTA
GTTAGTCTATATTGCACTTCAGCTGATAAACCAAATTTTCCTCAATCTCG
TTCAGAATATACCAGCCAGCTTAACTTTATATATCCTACTGACATCAAAG
GTATTCCATTATATCGAGTATTGGATGGAAATGGAAATTTAAGAGAAGAT
GGATTAGATCCAAAATTTAGTAAAGAATTTTCAATTAAAATTATTAAAAC
TATGACACTTCTCAACACTATGGATAGAATATTGTATGATTCTCAACGAC
AAGGCAGAATATCATTCTACATGACACATTATGGGGAAGAAGGTGTACAA
ATTGGTTCCGCGGCGGCTTTAAATGATGGTGATCTTATATTTGGACAGTA
CAGAGAGGCTGGTGTCGGCCTTTGGAGAGGTTTTACTTTAGAAGAAATGC
TTAATCAATGTTATGGCAACAAATACGATTCCAACAAAGGAAAACAAATG
CCTATCCATTATGCTAATAAAAAACTAAACTATTTTAGCATCAGCTCGGT
TTTAGGTACACAAATGCCACATGCCGTTGGTGCTGCGTATGCTTTTAAAC
GTGCCCAAAATGGGAAATGTGTCATTTGTTACTTCGGAGATGGGGCATCA
TCGGTTGGGGACGCCCATGCAGCTCTTAATTTTTCTGCAACTTTAGACTG
TCCTGTAATTATGTTGTGTAGAAATAATCTTTATGCCATTTCAACTCCTG
TTCATGAACAATATCGAGGAGATGGAATAGGATCCCGTGGTATTGGGTAC
GGCATAGCGACAATACGGGTGGATGGAAATGACCTTATTGCCGTTTACAA
TGCCACAAAGGCAGCACGAGAATTGTGCGTCAATGAAAACAGGCCTGTAT
TAATTGAAGCGATGACATATCGAATTGGGTCACATTCAACGAGTGATGAC
AGTTTGGCCTATCGCTCGGTTGATGAGGTCACTTGGTGGGACAAACACGA
TAACCCCATATTGAGGTTCAAATTCTATTTGAAACAGAAAAATTGGTGGA
GTGATAAAGAAGAGGAGGCCTGGAGAAATGAATCTCGTAAATTGGTAGTG
CAAGCTATCGAAAAAGCTGAGAAAACCAACCTACCAAATCCGTTAATCCT
TTTTGAAGATGTTTATGATGAAATGCCGACTCGAATCCGTTCTCAGATGA
ATAAGCATTATACCTTTCTGAAGAGAAATAAGGAACATTATCCTATTTCT
TACGATTCTCCTGAGAAAATATAATTTTGATACAATATTTGAATTGATTA
TTCTATATGGATGAGTAGTGAGACCTTGAATTTTTTATGAGCTTAAACAA
AAATTTAAAATTTTTGGGATTTTAAAGAAATTATAAAAATAAATATTTAA
AATAATTACTTTTAATCTGGTTGATTAGAAAAAAAATAAAATTGAAAGAG
AAATTCAATGAACCTGCAAATAGCAAAAATACATGAAGGACTGAATCGAA
TAAAATATTTACACACTTTTTTTTGCATCGTTTTAATATGACATCTATCA
AGATTAAAGGTTCGTCACTCTCTTGCAGCCAATTTTTTGTTATGCACTAT
CAATCTCATTTTGTGAATGTGATATTGCTAAACCTACTTAACCTAGTCTA
TAGACTACAGGTTTATTAACCTACTTATGACCAGAAACATACATCTTATT
TGGATATCTGGTTTTATACTACTGGCTACTAGGAAATCGAAAGAGACCAG
AATATAATCAAATACGCTCAGCAGTCAGTATCAACTAACCACCCTCGCCT
GCATCCAGACTGCAAATAAAAAAAAGAAAAGTTTATTTTAATACAACTCG
GTCAATTATGGCTATCATATGCGAGTAATTTCAGCATTCTAATCATTAAA
ACTTGTAATAATTCGATACACAAATCAATGGATAAGAAATCCTATTGCAG
TTAAACACACCATTGTGATATTTGACAGCTTGTGCAGCATCTAGGTTATT
GAGAGCAGTTCCAAGGTATGGATGGATGACATCTTCAGAGAATATTGTAA
TATTGGACGGGGATAGATCAATATTTATGTTAATATTGTTCAGACAGTGG
AGTAAGTCATAAAAAATCTCTAAAATCAGATTCCTTGTTATTTCCTTTTT
TGACACTTTGAACAATATGTTCTATTGTGACGAATGAGTGTGGTGAATTA
GAAATCTAATTAGTCATTTCTGGGAGAAAACTGAGAGGATCGCAAAGCCG
TAAGAGGACGAAAAATGCTGAGCAAGCAGCAAATAGATCCAGTGAATTAT
TCACAAGCATTTTTAAATAAGCTAAGTCAGACAAATCTAAGCCAAAAGAC
GATAATCAGTTGGATGTCCCCGCTACTAACAAAATTGTCGAACAACTTCA
AGGGAATAGTTCTTTGCACGAGAAATTTAACACAAATTAGTTGGTTGCTA
TTGATATAGATGACAATGCTGCTAAACAAATTGAAAATGAGAGTCAGAGT
AAAAAAAAAATGATTCTTTCGAGATGCATCATACATCTGATGACGAAAAC
TCAGTAGCTACTGATGCAGATGACAGAGCTATCGAACCAATTGATTATAT
GAATGAAAGTCAAGATTTATCCGATGATGAAAAAAACTTAGTTGTTGTTA
CTCAAGACGTTATTCCAGCAGTATTTTTGTTCCATGATCTTGCATACCTA
GAATTCGATCGTGAGACGCAACTTTCGATTGTATCGCAATTACTTCGCAC
TAAAATTATATCTCGTGGATCAATTCTGTTTCAAAATAAAGAATTTCCAT
TCGAATTACCTAAAGGATGTTCAATAACTAGAGCATGGTTTATGCGATGA
CTTGCAAACGAAGATGAAGTGAATCGATCGTGATTACTTTTTTCGCTATC
CGATGAAGCTGCGTATTGTTTTTGATGTTTGTTGCTCACTTCATCAAGTC
AGAATTCTCGATCTTCATTTAAATTAGCATCTGGATTTAGTAAGAGGTAA
AAAATCGAAAAGTTGATAGCACACGAGAACAGCCATAGTCATCGCAAATC
TTTTACTACATGGAAAGAAGCTGAGCAAAGGATAATTGATGGAAAAACTT
TAGATGCCTATATCCGAACCCAAATTCAAACAGAAAAACAACGATGGTAA
AATGTTTTGAAAAGAATACTTGCTTGCATTAAATTACTCGATTCTCAAAA
CTTGGCATTATGTTGAAAAAACTAAAGTTTAACAGCTGAAGCTGGAATGA
ATTTCGGAAACTTCCTCTCTCTTCTCAAGCTCATTGCAGAATATGACCCT
CTTTTGGAAAGTTATCTAAAACTTGCCAGTGAAAGTCCAGGATCAGTGTC
GTACTTATCGCCAGAAATTCAAAACAAATTCATCAGCTTGTTGGCATCCA
TTGTTAGAAATAAGTTACTGAAAGACATAAAATGAAATGAATATTACTGA
ATATTGCTAGATTCAACTCCTGATCTCGGACACCGGGGACAATTGTCTAA
AGTCATCCGATTTGTAGATATTGATTTTGAAAATAAAACCATTAATATAA
AAGAATCATTTCTTGGATTCATCGAGATGCATGCTAAAGATGCAGCTACC
TTTGAAACAGTCATCGTTGCGAAATTACAATCTGACAACATACCGTTAGA
TGATTGTAGGTTACAATGTTATGGCAATGCTGCCGTGATGACTGGACACA
TATTGTCTTCAACAGAGGATTCGTGCTAGAAATCACCGAGCCCTGTTTGT
AAATTGCGACAATCACAGTTTGAACTTGGCTGGAGTTCACTCAACCAAAC
AGGATCCACTGGTTGTCACGTTCTTTGGCACAATCGAAAGCATTTATGTT
TTTCTCTCGTTTAACTCTTCGATGGGAACAACTAAAAAATGCTTTACTCA
TCGCGGTTAAACGTGAATCTGAAACATGCTGAATGCTTGAGTGGAACCTG
TTAATGCCATTTATGAAGGACTTGGTGAATTGGTTGATTTACTAGAAAAA
CTATCAGATATTGAAAAATGTGACACACGAAACAAGAAGCGATGAAGTTC
ATTAACGTTGCCGTATGTCTCGGCTATTAAAGCTTTTATTGTTGATTTAT
TTTTCAAAAATTGATTTAAATACTTTTGAATATTGTGATTAATTTTTGAT
TTTACGTTTTTTTAAAAAAAATATTGATTAATGCACTTTTAATGTGTGAA
AATCAATAAAATCATTTGTAAGAGAAACACTGTCA
back to top

protein sequence of SMED30010036-orf-1

>SMED30010036-orf-1 ID=SMED30010036-orf-1|Name=SMED30010036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MLLNRVFRFTTYCASKFNVLVSLYCTSADKPNFPQSRSEYTSQLNFIYPT
DIKGIPLYRVLDGNGNLREDGLDPKFSKEFSIKIIKTMTLLNTMDRILYD
SQRQGRISFYMTHYGEEGVQIGSAAALNDGDLIFGQYREAGVGLWRGFTL
EEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAY
AFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAI
STPVHEQYRGDGIGSRGIGYGIATIRVDGNDLIAVYNATKAARELCVNEN
RPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQK
NWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIR
SQMNKHYTFLKRNKEHYPISYDSPEKI*
back to top

protein sequence of SMED30010036-orf-2

>SMED30010036-orf-2 ID=SMED30010036-orf-2|Name=SMED30010036-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MHHTSDDENSVATDADDRAIEPIDYMNESQDLSDDEKNLVVVTQDVIPAV
FLFHDLAYLEFDRETQLSIVSQLLRTKIISRGSILFQNKEFPFELPKGCS
ITRAWFMR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003826alpha-ketoacid dehydrogenase activity
GO:0016624oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:00038633-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0009083branched-chain amino acid catabolic process
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR034616BCKDH_E1-a
IPR025398DUF4371
IPR029061THDP-binding
IPR001017DH_E1
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.970coord: 26..423
e-value: 8.0E-143
score: 478.0
NoneNo IPR availablePANTHERPTHR43380FAMILY NOT NAMEDcoord: 27..419
NoneNo IPR availableCDDcd02000TPP_E1_PDC_ADC_BCADCcoord: 86..376
e-value: 8.69411E-148
score: 419.593
IPR001017Dehydrogenase, E1 componentPFAMPF00676E1_dhcoord: 86..384
e-value: 2.4E-99
score: 332.0
IPR0346162-oxoisovalerate dehydrogenase subunit alphaPANTHERPTHR43380:SF12-OXOISOVALERATE DEHYDROGENASE SUBUNIT ALPHA-RELATEDcoord: 27..419
IPR029061Thiamin diphosphate-binding foldSUPERFAMILYSSF52518Thiamin diphosphate-binding fold (THDP-binding)coord: 54..419