C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30010020
Length (bp)1327
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30010020) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30010020) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30010020) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30010020) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A443S1W5 (Uncharacterized protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_06898 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 4.663e-9
Identity = 43/98 (43.88%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  454 EFVGVYPLDKIPYLDDNNA-IVVNTQSSNLGGEHWIAVYV-KPNKIHVFDPMGFYYPAL---LVSKLQTVGKSIV-YNKHRYQNPLTTTCGQHCLVWL 729
            EFVG +P D IP      A  +VNT SSN  GEHW+A+Y+ K NK   FD  G   P L   L   +    K+ V YN    Q+PL+TTCG+ CL ++
Sbjct:    3 EFVGTFPRDNIPTTTRRPASFIVNTDSSNEPGEHWVAIYLTKNNKAEYFDSFGL--PPLHRDLTEFIHEHAKNGVKYNNICIQHPLSTTCGKFCLKYV 98          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A3C1S1Q5 (Uncharacterized protein OS=Tenacibaculum sp. OX=1906242 GN=DDE71_02150 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.952e-9
Identity = 36/137 (26.28%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  418 QVEKIGKQLLGNEFVGVYPLDKIPYLDDNNA--IVVNTQSSNLGGEHWIAVYVKPNKIHVFDPMG--FYYPALLVSKLQTVGKSIVYNKHRYQNPLTTTCGQHCLVWLNSMYKRIDXXXXXXXXXXYFIDISVFENE 816
            ++ K  KQ    +F+GV+ +D++  +  N    ++ NT +S   G+HW+A+ +   +I  FD +   F Y       ++   K +++N  + Q+ ++  CG HCLV+  +M K  + +     + + F+D+S+ E E
Sbjct:    5 EINKFAKQFGLKKFLGVFAVDELSLIPKNRLGLVIFNTDTSQSVGQHWVALCITKTRIFYFDSLNIKFQYSTHFTDFMKYTKKELIWNTIQIQSNISEKCGIHCLVFCYAMQKYKNKRGYKNFLKT-FLDLSIEERE 140          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1I8H9W8 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.392e-8
Identity = 30/101 (29.70%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   27 ETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLP-QNGNILLDIKFSKAVEEPVHVIIYGVFENEIQITANE 326
            + +T  F   NY   Y   +++++G ++++L+  ++  D+ + Y FF + L PD +L    +P + GN+ L IKFS A+   ++V+++G F++ +QIT  +
Sbjct: 1671 QPFTPRFGVHNYAREYAM-LLKSLGKMNRDLDIDVSYSDYGAGYCFFAWNLMPDMELGGHSMPREQGNLTLQIKFSAALTAGINVLVFGYFDSTVQITRGQ 1770          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1I8I4M6 (CN hydrolase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.452e-8
Identity = 31/98 (31.63%), Postives = 60/98 (61.22%), Query Frame = 3
Query:   27 ETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLP-QNGNILLDIKFSKAVEEPVHVIIYGVFENEIQIT 317
            + +T  F   NY   Y   +++++G ++++L+  ++  D+ + Y FF + L PD +L    +P + GN+ L IKFS A+   ++V+++G F+N +QIT
Sbjct: 1363 QPFTPRFGVHNYAREYAM-LLKSLGKMNRDLDIDVSYSDYGAGYCFFAWNLMPDMELGGHSMPRERGNLTLQIKFSAALAAGINVLVFGYFDNTVQIT 1459          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A354GG20 (Uncharacterized protein OS=Tenacibaculum sp. OX=1906242 GN=DDY16_03295 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.290e-7
Identity = 30/114 (26.32%), Postives = 64/114 (56.14%), Query Frame = 1
Query:  418 QVEKIGKQLLGNEFVGVYPLDKIPYLDDNNA--IVVNTQSSNLGGEHWIAVYVKPNKIHVFDPM--GFYYPALLVSKLQTVGKSIVYNKHRYQNPLTTTCGQHCLVWLNSMYKR 747
            ++ ++ ++L+  +F+GV+ +D++  +  +    ++ NT +S   G+HWIA+ +  N I+ FD +   FY+       ++ + K   +N  + Q+ L+  CG H LV+  +M K+
Sbjct:    5 EINELAEKLVIKDFIGVFAVDELILIPKSRTGLLIFNTDTSQNIGQHWIALCITKNNIYYFDSLFCEFYHSKHFKEYMKFIKKKFTWNTIQIQHDLSDKCGIHSLVFCYAMRKK 118          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000050353.1 (SMESG000050353.1)

HSP 1 Score: 207.608 bits (527), Expect = 6.762e-97
Identity = 95/108 (87.96%), Postives = 103/108 (95.37%), Query Frame = 3
Query:    3 LSKKSDYKETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNILLDIKFSKAVEEPVHVIIYGVFENEIQITANE 326
            LSK SDY+ETYTQDF+NDNYCATYMQSIVRNMGYLDKNLNCGITL+DFK+KYPFFTFVLAPDFDLNQSQLPQNGN+ LDIKF+KA  EPVHV+IYGVFENE+QITAN 
Sbjct:  162 LSKNSDYRETYTQDFENDNYCATYMQSIVRNMGYLDKNLNCGITLDDFKNKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATSEPVHVVIYGVFENEVQITANR 269          

HSP 2 Score: 166.392 bits (420), Expect = 6.762e-97
Identity = 75/102 (73.53%), Postives = 88/102 (86.27%), Query Frame = 1
Query:  421 VEKIGKQLLGNEFVGVYPLDKIPYLDDNNAIVVNTQSSNLGGEHWIAVYVKPNKIHVFDPMGFYYPALLVSKLQTVGKSIVYNKHRYQNPLTTTCGQHCLVW 726
            V +IGKQ+LG+EF+GV+PLDKIPYL +N AI+VNTQSS+LGGEHW+A+Y+KP KI VFDPMGFYYPAL+VSKLQ +GK IVYNK  YQ   T TCGQHCL W
Sbjct:  273 VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPCKIFVFDPMGFYYPALVVSKLQAMGKPIVYNKTMYQKQWTLTCGQHCLAW 374          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000054630.1 (SMESG000054630.1)

HSP 1 Score: 172.17 bits (435), Expect = 5.340e-87
Identity = 72/109 (66.06%), Postives = 93/109 (85.32%), Query Frame = 1
Query:  421 VEKIGKQLLGNEFVGVYPLDKIPYLDDNNAIVVNTQSSNLGGEHWIAVYVKPNKIHVFDPMGFYYPALLVSKLQTVGKSIVYNKHRYQNPLTTTCGQHCLVWLNSMYKR 747
            ++ I K+L+G  F+GV+PLDKIPY++ N A++VNTQS+NLGGEHW+A+YVKP+KIHVFDPMGFYYP LL+SKL+++   I YN+ RYQNPLT TCGQHCL WL SM+ +
Sbjct: 1297 IQTIAKKLIGKNFIGVFPLDKIPYININKALIVNTQSANLGGEHWLAIYVKPDKIHVFDPMGFYYPPLLISKLESMLMPIEYNRIRYQNPLTKTCGQHCLAWLKSMFSK 1405          

HSP 2 Score: 169.088 bits (427), Expect = 5.340e-87
Identity = 76/108 (70.37%), Postives = 93/108 (86.11%), Query Frame = 3
Query:    3 LSKKSDYKETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNILLDIKFSKAVEEPVHVIIYGVFENEIQITANE 326
            +  ++DY+E Y+QDF NDNY ++YMQSIVRNMGYL+KN+NCGITL DFK+KYPFFTFVLAPDFDLNQSQLPQ+GN+ LDIKF   + E V V++YGVFE EIQIT++ 
Sbjct: 1188 MEDRNDYREKYSQDFANDNYSSSYMQSIVRNMGYLNKNMNCGITLSDFKNKYPFFTFVLAPDFDLNQSQLPQSGNLRLDIKFENPLTESVSVLVYGVFEKEIQITSSR 1295          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031049.1 (SMESG000031049.1)

HSP 1 Score: 209.92 bits (533), Expect = 7.672e-87
Identity = 97/108 (89.81%), Postives = 103/108 (95.37%), Query Frame = 3
Query:    3 LSKKSDYKETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNILLDIKFSKAVEEPVHVIIYGVFENEIQITANE 326
            LSK SDY+ETYTQDF+NDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGN+ LDIKF+KA  EPVHV+IYGVFENE+QITAN 
Sbjct:  287 LSKNSDYRETYTQDFENDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANR 394          

HSP 2 Score: 130.954 bits (328), Expect = 7.672e-87
Identity = 58/76 (76.32%), Postives = 72/76 (94.74%), Query Frame = 1
Query:  421 VEKIGKQLLGNEFVGVYPLDKIPYLDDNNAIVVNTQSSNLGGEHWIAVYVKPNKIHVFDPMGFYYPALLVSKLQTV 648
            V +IGKQ+LG+EF+GV+PLDKIPYL +N AI+VNTQSS+LGGEHW+A+Y+KP+KI VFDPMGFYYPAL+VSKLQT+
Sbjct:  398 VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTM 473          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031049.1 (SMESG000031049.1)

HSP 1 Score: 209.534 bits (532), Expect = 9.753e-87
Identity = 97/108 (89.81%), Postives = 103/108 (95.37%), Query Frame = 3
Query:    3 LSKKSDYKETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNILLDIKFSKAVEEPVHVIIYGVFENEIQITANE 326
            LSK SDY+ETYTQDF+NDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGN+ LDIKF+KA  EPVHV+IYGVFENE+QITAN 
Sbjct:  544 LSKNSDYRETYTQDFENDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANR 651          

HSP 2 Score: 130.954 bits (328), Expect = 9.753e-87
Identity = 58/76 (76.32%), Postives = 72/76 (94.74%), Query Frame = 1
Query:  421 VEKIGKQLLGNEFVGVYPLDKIPYLDDNNAIVVNTQSSNLGGEHWIAVYVKPNKIHVFDPMGFYYPALLVSKLQTV 648
            V +IGKQ+LG+EF+GV+PLDKIPYL +N AI+VNTQSS+LGGEHW+A+Y+KP+KI VFDPMGFYYPAL+VSKLQT+
Sbjct:  655 VYRIGKQILGHEFLGVFPLDKIPYLRNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTM 730          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 208.764 bits (530), Expect = 1.499e-86
Identity = 97/108 (89.81%), Postives = 102/108 (94.44%), Query Frame = 3
Query:    3 LSKKSDYKETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNILLDIKFSKAVEEPVHVIIYGVFENEIQITANE 326
            LSK SDY+ETYTQDF+NDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFT VLAPDFDLNQSQLPQNGN+ LDIKFSKA  EPVHV+IYGVFENE+QITAN 
Sbjct:  947 LSKNSDYRETYTQDFENDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTLVLAPDFDLNQSQLPQNGNLRLDIKFSKATTEPVHVVIYGVFENEVQITANR 1054          

HSP 2 Score: 130.954 bits (328), Expect = 1.499e-86
Identity = 58/77 (75.32%), Postives = 73/77 (94.81%), Query Frame = 1
Query:  421 VEKIGKQLLGNEFVGVYPLDKIPYLDDNNAIVVNTQSSNLGGEHWIAVYVKPNKIHVFDPMGFYYPALLVSKLQTVG 651
            V +IGKQ+LG++F+GV+PLDKIPYL +N AI+VNTQSS+LGGEHW+A+Y+KP+KI VFDPMGFYYPAL+VSKLQT+G
Sbjct: 1058 VYRIGKQILGHKFLGVFPLDKIPYLLNNQAIIVNTQSSHLGGEHWLAIYMKPSKIFVFDPMGFYYPALMVSKLQTMG 1134          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443S1W54.663e-943.88Uncharacterized protein (Fragment) OS=Leptotrombid... [more]
A0A3C1S1Q58.952e-926.28Uncharacterized protein OS=Tenacibaculum sp. OX=19... [more]
A0A1I8H9W89.392e-829.70Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A1I8I4M69.452e-831.63CN hydrolase domain-containing protein OS=Macrosto... [more]
A0A354GG201.290e-726.32Uncharacterized protein OS=Tenacibaculum sp. OX=19... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050353.16.762e-9787.96SMESG000050353.1[more]
SMESG000054630.15.340e-8766.06SMESG000054630.1[more]
SMESG000031049.17.672e-8789.81SMESG000031049.1[more]
SMESG000031049.19.753e-8789.81SMESG000031049.1[more]
SMESG000029226.11.499e-8689.81SMESG000029226.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010020 ID=SMED30010020|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1327bp
CTTTATCGAAAAAAAGTGATTATAAAGAAACATATACTCAAGATTTCGAT
AATGATAATTATTGTGCTACATATATGCAGAGTATAGTGAGAAATATGGG
TTATTTGGATAAAAACCTTAATTGTGGTATAACTCTTGAAGATTTTAAAA
GCAAATATCCATTCTTCACATTTGTTTTGGCACCCGATTTCGATTTAAAT
CAGAGTCAATTACCTCAAAATGGAAATATACTATTGGATATAAAGTTTTC
TAAAGCTGTTGAAGAACCAGTACATGTAATAATATATGGCGTATTTGAAA
ACGAAATTCAAATTACTGCAAATGAACTGTACTAGTATAAATATAGTAAC
TCTATGTAATCAGATTATCATGAAGTAAGATTTTAATTATTAATTAATTT
TATTTAATTAGTTCTGTCAGGTTGAAAAAATTGGAAAACAGTTGTTGGGG
AATGAGTTTGTTGGTGTATATCCTTTAGATAAAATTCCATATCTTGATGA
TAACAATGCAATAGTGGTTAATACTCAATCATCTAATCTTGGCGGTGAAC
ACTGGATTGCTGTATATGTGAAACCAAATAAAATCCATGTTTTCGATCCA
ATGGGATTCTATTATCCAGCTTTATTAGTTAGTAAATTACAAACAGTAGG
AAAGTCAATTGTATACAATAAACATCGATATCAAAATCCTTTAACAACAA
CTTGTGGTCAACATTGTCTTGTTTGGCTAAACTCAATGTATAAACGTATT
GATTTTAAATAAATGTTTTTTAAAATGTCTAGTTATTTTATTGATATTAG
TGTTTTTGAAAATGAATTTGGTGGATTAGTTATAAAAGAATTATGTATGA
TCAATACTAATAATATTTTAAGACCATTACATTGGGTGTTTTCGGCAAAC
GAATATCATGAAGATCAAATACTTAACGGACAAAATTTTTTCTGTCCAAC
GTGTATATTAAGTACTATCGGTTCTGATCGAAAAACAGCTATTTTCTATG
TGACAGATGAAACAAAAGAAAAGATTTTAAAAATATATTTCCCATCTTTG
AGAATTGTAAAGTATTCATTAAAAGAATATCAGAGTTTTCCAAGAAACAT
ATCTTGTCCATTTTATGAGCATGATGATGATTGTGCTTATAAAAACTGTT
TACTTGGTGCTTTAGATTATCTGAAATATTAAAAATATATGTATGCAATT
TACCGTGTTTTGATTGGTTAATCTGTTGTAGTGGTGATAACGTAATTATT
CATATATAAGGATAGATTTTTCATTTTATGATCACTTTTTACATATACCC
AACTTCGAACAATAATCAATATGGTAA
back to top

protein sequence of SMED30010020-orf-1

>SMED30010020-orf-1 ID=SMED30010020-orf-1|Name=SMED30010020-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
LSKKSDYKETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKS
KYPFFTFVLAPDFDLNQSQLPQNGNILLDIKFSKAVEEPVHVIIYGVFEN
EIQITANELY*
back to top

protein sequence of SMED30010020-orf-2

>SMED30010020-orf-2 ID=SMED30010020-orf-2|Name=SMED30010020-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MFFKMSSYFIDISVFENEFGGLVIKELCMINTNNILRPLHWVFSANEYHE
DQILNGQNFFCPTCILSTIGSDRKTAIFYVTDETKEKILKIYFPSLRIVK
YSLKEYQSFPRNISCPFYEHDDDCAYKNCLLGALDYLKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004197cysteine-type endopeptidase activity
GO:0008233peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000855Peptidase_C5
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis