E3 ubiquitin-protein ligase TRIP12

Overview
NameE3 ubiquitin-protein ligase TRIP12
Smed IDSMED30010017
Length (bp)6924
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase TRIP12 (SMED30010017) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRIP12 (SMED30010017) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase TRIP12 (SMED30010017) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRIP12 (SMED30010017) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010017

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010017SMESG000007808.1 PL08007A1H04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30010017SMESG000019763.1 SMESG000007808.1 dd_Smed_v4_2525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010017SMESG000019763.1 SMESG000007808.1 dd_Smed_v4_2525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010017SMESG000019763.1 SMESG000007808.1 dd_Smed_v4_2525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010017SMESG000019763.1 SMESG000007808.1 dd_Smed_v4_2525_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Human
Match: TRIP12 (thyroid hormone receptor interactor 12 [Source:HGNC Symbol;Acc:HGNC:12306])

HSP 1 Score: 385.956 bits (990), Expect = 5.123e-108
Identity = 221/530 (41.70%), Postives = 311/530 (58.68%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
             + LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1201 VILLLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYI-QNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1722          

HSP 2 Score: 213.772 bits (543), Expect = 1.063e-54
Identity = 147/492 (29.88%), Postives = 253/492 (51.42%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNC---DIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N    +++E + Q  + EIS  + G     +   MQQ +   GT     ++R  +    S  +      K D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  134 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGT--ARAIQRKPNPLANSNTSGYSESKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 597          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Human
Match: TRIP12 (thyroid hormone receptor interactor 12 [Source:HGNC Symbol;Acc:HGNC:12306])

HSP 1 Score: 386.726 bits (992), Expect = 1.082e-107
Identity = 221/527 (41.94%), Postives = 310/527 (58.82%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1522 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2040          

HSP 2 Score: 201.06 bits (510), Expect = 1.142e-50
Identity = 140/490 (28.57%), Postives = 241/490 (49.18%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNC---DIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N                        ID+ +I      +   T     ++R  +    S  +      K D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  479 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNR-----------------------IDSRII----EQINEDTGTARAIQRKPNPLANSNTSGYSESKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 915          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Human
Match: TRIP12 (thyroid hormone receptor interactor 12 [Source:HGNC Symbol;Acc:HGNC:12306])

HSP 1 Score: 386.341 bits (991), Expect = 1.342e-107
Identity = 221/527 (41.94%), Postives = 310/527 (58.82%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1474 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1992          

HSP 2 Score: 201.445 bits (511), Expect = 7.337e-51
Identity = 142/490 (28.98%), Postives = 244/490 (49.80%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNC---DIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N                        ID+ +I  +Q +   GT     ++R  +    S  +      K D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  431 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNR-----------------------IDSRII--EQINEDTGT--ARAIQRKPNPLANSNTSGYSESKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 867          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Human
Match: TRIP12 (thyroid hormone receptor interactor 12 [Source:HGNC Symbol;Acc:HGNC:12306])

HSP 1 Score: 144.436 bits (363), Expect = 2.108e-38
Identity = 86/231 (37.23%), Postives = 122/231 (52.81%), Query Frame = 3
Query: 5835 LMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVG 6512
            LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL L                                         +++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVG
Sbjct:    1 LMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRL-----------------------------------------DQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVG 187          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Human
Match: HECTD1 (HECT domain E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:20157])

HSP 1 Score: 122.479 bits (306), Expect = 4.775e-27
Identity = 85/286 (29.72%), Postives = 138/286 (48.25%), Query Frame = 3
Query: 5877 PLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL------------GVEDLLIVFVHPL------YTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            P  P ++  +L  E      D   ++P  A  LK + DL  K+  I ++K +S+  K    +EL             +EDL + F          +T ++L   G + ++T+ +   Y+DL+ +  +  G++ QME   +GF+ + P   M   + F   E++ I CG +     A D+   TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   +V K +     D   PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct:  700 PKPPAWFNGILTWE------DFELVNPHRARFLKEIKDLAIKRRQILSNKGLSEDEKNTKLQELVLKNPSGSGPPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQKQMEAFRDGFNKVFP---MEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEP---KLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDAT---DASYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 970          

HSP 2 Score: 103.605 bits (257), Expect = 3.361e-21
Identity = 74/242 (30.58%), Postives = 123/242 (50.83%), Query Frame = 3
Query: 5259 NEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRR-------------MRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYK 5900
            +EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ +F    F  +R +++L+  + +++      TTS VRR              RV+V R + L++ +E +++   D + +LE+ F  E G GLGPT EFY  V+    ++DL  W       DD          L PP        GL+  P    S +L+ ++   F FLG  +A+ + D R +D+P++  F+K
Sbjct:  400 DEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQ--NRREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHADRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCDDNFPDDESRHVDLGGGLKPPGYYVQRSCGLFTAPFPQDSDELE-RITKLFHFLGIFLAKCIQDNRLVDLPISKPFFK 638          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Celegans
Match: hecd-1 (E3 ubiquitin-protein ligase hecd-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CLA2])

HSP 1 Score: 214.542 bits (545), Expect = 3.968e-55
Identity = 161/541 (29.76%), Postives = 258/541 (47.69%), Query Frame = 3
Query: 5250 ISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLE------------------GASNQDSDNFLDSTTSEVRRMRVQVNXXXXX-XXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV------SSESHDD-------------YVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV----LGQE-------ECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELG---------VEDLLIVF-VHP-----LYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            I+ N F S KL+ K  + L D   V AR+LP WC +L +    LF+VETR  +     F  +RT+++L+                   ++ +  D + +     +R  RV+V R++   LD++  L+K   D + +LEI + NE G GLGPT EFY  V+  L +  L LW        +S+S ++             Y +    GL+P P+   + +   +  + F  LG  +A+ LLD R +D+PL+  F K +    +G +       + +   D   ++P+  + LK L  L ++K LI+ND +I    K+    EL          VEDL + F V+P      Y ++EL+  G++  VT+ ++  Y++      L  G+  QM    +GFD + P   +     +   E++ +  G   E    W    +        GYT  S   +   ++M   T ++R++F+QF TG   LP GG   L P   IV K E G   D   PSV TC ++LKLP+YSS  ++R+RLL A++E
Sbjct: 2071 ITPNVFISDKLTLKVTQVLSDALVVAARSLPEWCSRLVYKYPCLFTVETRNMYMQATAFGVSRTIVWLQQRRDAAVERARGSAQAGNSSAARQHDRYHEYRVGRLRHERVKVTRAEETLLDQAIRLMKFHADRKAVLEIEYTNEEGTGLGPTLEFYALVAAELQRKSLALWVCDDDDTHASKSGEEREVDLGEGKKPIGYYVRRVGGLFPAPLPPGTDET-KRAADMFRVLGVFLAKVLLDGRLVDLPLSRPFLKLLVHPQIGDDARGPNLHKILSLDDFEEVNPVKGSFLKELRALAQRKRLIENDTSIDSNSKRRKIAELKLHIKGSTCRVEDLALNFTVNPPSKVFQYAEMELVDGGSDIDVTIDNVEQYVEKCEEFYLNTGIAYQMRAFRDGFDRVFP---LRTLRAYSPEEVQRLLSG---EQCPEWSRDDILNYTEPKLGYTRESPGFLRFVDVMEALTAQERKNFLQFATGCSSLPPGGLANLHPRLTIVRKVESG---DGSYPSVNTCVHYLKLPEYSSSAILRERLLTAINE 2601          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Celegans
Match: hecd-1 (E3 ubiquitin-protein ligase hecd-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CLA2])

HSP 1 Score: 214.542 bits (545), Expect = 4.004e-55
Identity = 161/541 (29.76%), Postives = 258/541 (47.69%), Query Frame = 3
Query: 5250 ISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLE------------------GASNQDSDNFLDSTTSEVRRMRVQVNXXXXX-XXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV------SSESHDD-------------YVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV----LGQE-------ECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELG---------VEDLLIVF-VHP-----LYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            I+ N F S KL+ K  + L D   V AR+LP WC +L +    LF+VETR  +     F  +RT+++L+                   ++ +  D + +     +R  RV+V R++   LD++  L+K   D + +LEI + NE G GLGPT EFY  V+  L +  L LW        +S+S ++             Y +    GL+P P+   + +   +  + F  LG  +A+ LLD R +D+PL+  F K +    +G +       + +   D   ++P+  + LK L  L ++K LI+ND +I    K+    EL          VEDL + F V+P      Y ++EL+  G++  VT+ ++  Y++      L  G+  QM    +GFD + P   +     +   E++ +  G   E    W    +        GYT  S   +   ++M   T ++R++F+QF TG   LP GG   L P   IV K E G   D   PSV TC ++LKLP+YSS  ++R+RLL A++E
Sbjct: 2073 ITPNVFISDKLTLKVTQVLSDALVVAARSLPEWCSRLVYKYPCLFTVETRNMYMQATAFGVSRTIVWLQQRRDAAVERARGSAQAGNSSAARQHDRYHEYRVGRLRHERVKVTRAEETLLDQAIRLMKFHADRKAVLEIEYTNEEGTGLGPTLEFYALVAAELQRKSLALWVCDDDDTHASKSGEEREVDLGEGKKPIGYYVRRVGGLFPAPLPPGTDET-KRAADMFRVLGVFLAKVLLDGRLVDLPLSRPFLKLLVHPQIGDDARGPNLHKILSLDDFEEVNPVKGSFLKELRALAQRKRLIENDTSIDSNSKRRKIAELKLHIKGSTCRVEDLALNFTVNPPSKVFQYAEMELVDGGSDIDVTIDNVEQYVEKCEEFYLNTGIAYQMRAFRDGFDRVFP---LRTLRAYSPEEVQRLLSG---EQCPEWSRDDILNYTEPKLGYTRESPGFLRFVDVMEALTAQERKNFLQFATGCSSLPPGGLANLHPRLTIVRKVESG---DGSYPSVNTCVHYLKLPEYSSSAILRERLLTAINE 2603          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Celegans
Match: hecd-1 (E3 ubiquitin-protein ligase hecd-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CLA2])

HSP 1 Score: 214.542 bits (545), Expect = 4.072e-55
Identity = 161/541 (29.76%), Postives = 258/541 (47.69%), Query Frame = 3
Query: 5250 ISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLE------------------GASNQDSDNFLDSTTSEVRRMRVQVNXXXXX-XXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV------SSESHDD-------------YVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV----LGQE-------ECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELG---------VEDLLIVF-VHP-----LYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            I+ N F S KL+ K  + L D   V AR+LP WC +L +    LF+VETR  +     F  +RT+++L+                   ++ +  D + +     +R  RV+V R++   LD++  L+K   D + +LEI + NE G GLGPT EFY  V+  L +  L LW        +S+S ++             Y +    GL+P P+   + +   +  + F  LG  +A+ LLD R +D+PL+  F K +    +G +       + +   D   ++P+  + LK L  L ++K LI+ND +I    K+    EL          VEDL + F V+P      Y ++EL+  G++  VT+ ++  Y++      L  G+  QM    +GFD + P   +     +   E++ +  G   E    W    +        GYT  S   +   ++M   T ++R++F+QF TG   LP GG   L P   IV K E G   D   PSV TC ++LKLP+YSS  ++R+RLL A++E
Sbjct: 2110 ITPNVFISDKLTLKVTQVLSDALVVAARSLPEWCSRLVYKYPCLFTVETRNMYMQATAFGVSRTIVWLQQRRDAAVERARGSAQAGNSSAARQHDRYHEYRVGRLRHERVKVTRAEETLLDQAIRLMKFHADRKAVLEIEYTNEEGTGLGPTLEFYALVAAELQRKSLALWVCDDDDTHASKSGEEREVDLGEGKKPIGYYVRRVGGLFPAPLPPGTDET-KRAADMFRVLGVFLAKVLLDGRLVDLPLSRPFLKLLVHPQIGDDARGPNLHKILSLDDFEEVNPVKGSFLKELRALAQRKRLIENDTSIDSNSKRRKIAELKLHIKGSTCRVEDLALNFTVNPPSKVFQYAEMELVDGGSDIDVTIDNVEQYVEKCEEFYLNTGIAYQMRAFRDGFDRVFP---LRTLRAYSPEEVQRLLSG---EQCPEWSRDDILNYTEPKLGYTRESPGFLRFVDVMEALTAQERKNFLQFATGCSSLPPGGLANLHPRLTIVRKVESG---DGSYPSVNTCVHYLKLPEYSSSAILRERLLTAINE 2640          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Celegans
Match: hecd-1 (E3 ubiquitin-protein ligase hecd-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CLA2])

HSP 1 Score: 214.542 bits (545), Expect = 4.251e-55
Identity = 161/541 (29.76%), Postives = 258/541 (47.69%), Query Frame = 3
Query: 5250 ISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLE------------------GASNQDSDNFLDSTTSEVRRMRVQVNXXXXX-XXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV------SSESHDD-------------YVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV----LGQE-------ECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELG---------VEDLLIVF-VHP-----LYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            I+ N F S KL+ K  + L D   V AR+LP WC +L +    LF+VETR  +     F  +RT+++L+                   ++ +  D + +     +R  RV+V R++   LD++  L+K   D + +LEI + NE G GLGPT EFY  V+  L +  L LW        +S+S ++             Y +    GL+P P+   + +   +  + F  LG  +A+ LLD R +D+PL+  F K +    +G +       + +   D   ++P+  + LK L  L ++K LI+ND +I    K+    EL          VEDL + F V+P      Y ++EL+  G++  VT+ ++  Y++      L  G+  QM    +GFD + P   +     +   E++ +  G   E    W    +        GYT  S   +   ++M   T ++R++F+QF TG   LP GG   L P   IV K E G   D   PSV TC ++LKLP+YSS  ++R+RLL A++E
Sbjct: 2114 ITPNVFISDKLTLKVTQVLSDALVVAARSLPEWCSRLVYKYPCLFTVETRNMYMQATAFGVSRTIVWLQQRRDAAVERARGSAQAGNSSAARQHDRYHEYRVGRLRHERVKVTRAEETLLDQAIRLMKFHADRKAVLEIEYTNEEGTGLGPTLEFYALVAAELQRKSLALWVCDDDDTHASKSGEEREVDLGEGKKPIGYYVRRVGGLFPAPLPPGTDET-KRAADMFRVLGVFLAKVLLDGRLVDLPLSRPFLKLLVHPQIGDDARGPNLHKILSLDDFEEVNPVKGSFLKELRALAQRKRLIENDTSIDSNSKRRKIAELKLHIKGSTCRVEDLALNFTVNPPSKVFQYAEMELVDGGSDIDVTIDNVEQYVEKCEEFYLNTGIAYQMRAFRDGFDRVFP---LRTLRAYSPEEVQRLLSG---EQCPEWSRDDILNYTEPKLGYTRESPGFLRFVDVMEALTAQERKNFLQFATGCSSLPPGGLANLHPRLTIVRKVESG---DGSYPSVNTCVHYLKLPEYSSSAILRERLLTAINE 2644          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Celegans
Match: hecd-1 (E3 ubiquitin-protein ligase hecd-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CLA2])

HSP 1 Score: 214.157 bits (544), Expect = 4.321e-55
Identity = 161/541 (29.76%), Postives = 258/541 (47.69%), Query Frame = 3
Query: 5250 ISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLE------------------GASNQDSDNFLDSTTSEVRRMRVQVNXXXXX-XXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV------SSESHDD-------------YVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV----LGQE-------ECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELG---------VEDLLIVF-VHP-----LYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            I+ N F S KL+ K  + L D   V AR+LP WC +L +    LF+VETR  +     F  +RT+++L+                   ++ +  D + +     +R  RV+V R++   LD++  L+K   D + +LEI + NE G GLGPT EFY  V+  L +  L LW        +S+S ++             Y +    GL+P P+   + +   +  + F  LG  +A+ LLD R +D+PL+  F K +    +G +       + +   D   ++P+  + LK L  L ++K LI+ND +I    K+    EL          VEDL + F V+P      Y ++EL+  G++  VT+ ++  Y++      L  G+  QM    +GFD + P   +     +   E++ +  G   E    W    +        GYT  S   +   ++M   T ++R++F+QF TG   LP GG   L P   IV K E G   D   PSV TC ++LKLP+YSS  ++R+RLL A++E
Sbjct: 2075 ITPNVFISDKLTLKVTQVLSDALVVAARSLPEWCSRLVYKYPCLFTVETRNMYMQATAFGVSRTIVWLQQRRDAAVERARGSAQAGNSSAARQHDRYHEYRVGRLRHERVKVTRAEETLLDQAIRLMKFHADRKAVLEIEYTNEEGTGLGPTLEFYALVAAELQRKSLALWVCDDDDTHASKSGEEREVDLGEGKKPIGYYVRRVGGLFPAPLPPGTDET-KRAADMFRVLGVFLAKVLLDGRLVDLPLSRPFLKLLVHPQIGDDARGPNLHKILSLDDFEEVNPVKGSFLKELRALAQRKRLIENDTSIDSNSKRRKIAELKLHIKGSTCRVEDLALNFTVNPPSKVFQYAEMELVDGGSDIDVTIDNVEQYVEKCEEFYLNTGIAYQMRAFRDGFDRVFP---LRTLRAYSPEEVQRLLSG---EQCPEWSRDDILNYTEPKLGYTRESPGFLRFVDVMEALTAQERKNFLQFATGCSSLPPGGLANLHPRLTIVRKVESG---DGSYPSVNTCVHYLKLPEYSSSAILRERLLTAINE 2605          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Fly
Match: ctrip (gene:FBgn0260794 transcript:FBtr0334902)

HSP 1 Score: 281.952 bits (720), Expect = 1.541e-75
Identity = 146/326 (44.79%), Postives = 209/326 (64.11%), Query Frame = 3
Query: 5754 GLYPRPIYSKSKKLD--NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVE-----DLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCG-GRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            GL+P P+  KS KL    K + KF FLG+ MA+A++D R LD+P +  FY+W++ +E  I  ADL  + P + N L  L DLV ++  I +D  I  + K E  E+L ++     DL + FV P +  IEL + G +  VTVH+L  Y+ LV    LIEGV+ Q E + EGFDS+ P  R+ +   F   E+E +FCG G  + +  W++K L E C  DHG+  +S++I  L+EI++ + ++++R F+QF TG+PRLP GGF+AL PP  IV K  +  +NP++YLPSVMTC N+LKLPDYSS+EVMRQ+L  A +EG  +F LS
Sbjct: 2415 GLFPLPL-GKSSKLPQMTKAKAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRM---FYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANEGSMSFHLS 2736          

HSP 2 Score: 176.407 bits (446), Expect = 1.714e-43
Identity = 118/404 (29.21%), Postives = 213/404 (52.72%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNS---MTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVIN-PTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGT 1988
            IG+  + K ++L     + D +Q+     E+ Q L++  ED+L    + ++   ++ L++  E N   + N C   L +++EALPRSS  +V ++ +FL K+  +   D  EQ ++ +E +SRRH +A+LQ    +  L Y DF +   Q   L + + C  N+ P +F+++ + +  L   L Q + KC+E V   F RLV +FQ+D  +L+++AS +L  N Q+LL+ +P ++       +++M++++C +C DLA+ L++ +I  T+L +        + S T     +RS  E+  L  LI ELMP LP  + +F ++ +++ PTL          +Q +  W W +     W ++     +L+E + QS + EIS  + G     +   MQQ +   GT
Sbjct:  673 IGNSSSSKANQLLQGLQSHDESQQLQAAIEMCQMLVMGNEDTLAGFPIKQVVPALIQLLR-MEHNFDIMNNAC-RALAYMLEALPRSSGTVVEAVPVFLEKLQVIQCMDVAEQSLSALEILSRRHNKAILQANGISACLTYLDFFSIVAQRAALAIAANCCLNMHPEEFHFVAESLPLLARLLSQQDKKCIESVCSAFCRLVESFQHDGQRLQQIASPDLLKNCQQLLLVTPAILNTGTFTAVVRMLSLMCCSCPDLAISLLRNDIAATLLYLLTGNAEPAAASATHVELISRSPSELYELTCLIGELMPRLPL-DGIFAVDSLLDRPTL---------NTQDQVHWQWRD-DRGSWHNYSTIDSRLIEAANQSSEDEISLSTFGRTYTVDFHAMQQINEDTGT 1063          

HSP 3 Score: 112.464 bits (280), Expect = 4.730e-24
Identity = 71/184 (38.59%), Postives = 101/184 (54.89%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVR---RM--RVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLW 5705
             L +LR + A+NRHW  L   +    +I +++F   K+ +KANRQLQD   ++  NLP W  Q+  AC FLF  ETR   FY  +FDR R L  L      D+   L++  S  R   R+  R +      +L ++E +L++    + +LEI + NE G GLGPT EFY  VS  L ++DL LW
Sbjct: 2080 ALCMLRVIHALNRHWDHLYGCVVRQNIIPQSDFIHPKIMAKANRQLQDPLVIMTGNLPQWLPQIGMACPFLFPFETRHLLFYATSFDRDRALQRL-----LDTTPDLNAAESSERVAPRLDRRKRAISRTEILKQAEHILQDFGHSKALLEIQYENEVGTGLGPTLEFYALVSAELQRTDLGLW 2258          

HSP 4 Score: 54.6842 bits (130), Expect = 1.488e-6
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 4407 KMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAI-NQVIWKSHHNIHYRPV 4598
            K+Q  IGD +LP  MT+YQA++++S  V       ++ +TD E E  + N  IW   H IHYRPV
Sbjct: 1913 KLQFTIGDHVLPYNMTVYQAVKQFSPLV------SEQPETDNESETLLGNASIWVQQHTIHYRPV 1971          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Fly
Match: ctrip (gene:FBgn0260794 transcript:FBtr0303917)

HSP 1 Score: 281.952 bits (720), Expect = 1.567e-75
Identity = 146/326 (44.79%), Postives = 209/326 (64.11%), Query Frame = 3
Query: 5754 GLYPRPIYSKSKKLD--NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVE-----DLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCG-GRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            GL+P P+  KS KL    K + KF FLG+ MA+A++D R LD+P +  FY+W++ +E  I  ADL  + P + N L  L DLV ++  I +D  I  + K E  E+L ++     DL + FV P +  IEL + G +  VTVH+L  Y+ LV    LIEGV+ Q E + EGFDS+ P  R+ +   F   E+E +FCG G  + +  W++K L E C  DHG+  +S++I  L+EI++ + ++++R F+QF TG+PRLP GGF+AL PP  IV K  +  +NP++YLPSVMTC N+LKLPDYSS+EVMRQ+L  A +EG  +F LS
Sbjct: 2416 GLFPLPL-GKSSKLPQMTKAKAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRM---FYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANEGSMSFHLS 2737          

HSP 2 Score: 176.407 bits (446), Expect = 1.672e-43
Identity = 118/404 (29.21%), Postives = 213/404 (52.72%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNS---MTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVIN-PTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGT 1988
            IG+  + K ++L     + D +Q+     E+ Q L++  ED+L    + ++   ++ L++  E N   + N C   L +++EALPRSS  +V ++ +FL K+  +   D  EQ ++ +E +SRRH +A+LQ    +  L Y DF +   Q   L + + C  N+ P +F+++ + +  L   L Q + KC+E V   F RLV +FQ+D  +L+++AS +L  N Q+LL+ +P ++       +++M++++C +C DLA+ L++ +I  T+L +        + S T     +RS  E+  L  LI ELMP LP  + +F ++ +++ PTL          +Q +  W W +     W ++     +L+E + QS + EIS  + G     +   MQQ +   GT
Sbjct:  674 IGNSSSSKANQLLQGLQSHDESQQLQAAIEMCQMLVMGNEDTLAGFPIKQVVPALIQLLR-MEHNFDIMNNAC-RALAYMLEALPRSSGTVVEAVPVFLEKLQVIQCMDVAEQSLSALEILSRRHNKAILQANGISACLTYLDFFSIVAQRAALAIAANCCLNMHPEEFHFVAESLPLLARLLSQQDKKCIESVCSAFCRLVESFQHDGQRLQQIASPDLLKNCQQLLLVTPAILNTGTFTAVVRMLSLMCCSCPDLAISLLRNDIAATLLYLLTGNAEPAAASATHVELISRSPSELYELTCLIGELMPRLPL-DGIFAVDSLLDRPTL---------NTQDQVHWQWRD-DRGSWHNYSTIDSRLIEAANQSSEDEISLSTFGRTYTVDFHAMQQINEDTGT 1064          

HSP 3 Score: 112.464 bits (280), Expect = 4.770e-24
Identity = 71/184 (38.59%), Postives = 101/184 (54.89%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVR---RM--RVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLW 5705
             L +LR + A+NRHW  L   +    +I +++F   K+ +KANRQLQD   ++  NLP W  Q+  AC FLF  ETR   FY  +FDR R L  L      D+   L++  S  R   R+  R +      +L ++E +L++    + +LEI + NE G GLGPT EFY  VS  L ++DL LW
Sbjct: 2081 ALCMLRVIHALNRHWDHLYGCVVRQNIIPQSDFIHPKIMAKANRQLQDPLVIMTGNLPQWLPQIGMACPFLFPFETRHLLFYATSFDRDRALQRL-----LDTTPDLNAAESSERVAPRLDRRKRAISRTEILKQAEHILQDFGHSKALLEIQYENEVGTGLGPTLEFYALVSAELQRTDLGLW 2259          

HSP 4 Score: 54.6842 bits (130), Expect = 1.501e-6
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 4407 KMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAI-NQVIWKSHHNIHYRPV 4598
            K+Q  IGD +LP  MT+YQA++++S  V       ++ +TD E E  + N  IW   H IHYRPV
Sbjct: 1914 KLQFTIGDHVLPYNMTVYQAVKQFSPLV------SEQPETDNESETLLGNASIWVQQHTIHYRPV 1972          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Fly
Match: ctrip (gene:FBgn0260794 transcript:FBtr0303912)

HSP 1 Score: 281.952 bits (720), Expect = 1.567e-75
Identity = 146/326 (44.79%), Postives = 209/326 (64.11%), Query Frame = 3
Query: 5754 GLYPRPIYSKSKKLD--NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVE-----DLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCG-GRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            GL+P P+  KS KL    K + KF FLG+ MA+A++D R LD+P +  FY+W++ +E  I  ADL  + P + N L  L DLV ++  I +D  I  + K E  E+L ++     DL + FV P +  IEL + G +  VTVH+L  Y+ LV    LIEGV+ Q E + EGFDS+ P  R+ +   F   E+E +FCG G  + +  W++K L E C  DHG+  +S++I  L+EI++ + ++++R F+QF TG+PRLP GGF+AL PP  IV K  +  +NP++YLPSVMTC N+LKLPDYSS+EVMRQ+L  A +EG  +F LS
Sbjct: 2416 GLFPLPL-GKSSKLPQMTKAKAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRM---FYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANEGSMSFHLS 2737          

HSP 2 Score: 176.407 bits (446), Expect = 1.672e-43
Identity = 118/404 (29.21%), Postives = 213/404 (52.72%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNS---MTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVIN-PTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGT 1988
            IG+  + K ++L     + D +Q+     E+ Q L++  ED+L    + ++   ++ L++  E N   + N C   L +++EALPRSS  +V ++ +FL K+  +   D  EQ ++ +E +SRRH +A+LQ    +  L Y DF +   Q   L + + C  N+ P +F+++ + +  L   L Q + KC+E V   F RLV +FQ+D  +L+++AS +L  N Q+LL+ +P ++       +++M++++C +C DLA+ L++ +I  T+L +        + S T     +RS  E+  L  LI ELMP LP  + +F ++ +++ PTL          +Q +  W W +     W ++     +L+E + QS + EIS  + G     +   MQQ +   GT
Sbjct:  674 IGNSSSSKANQLLQGLQSHDESQQLQAAIEMCQMLVMGNEDTLAGFPIKQVVPALIQLLR-MEHNFDIMNNAC-RALAYMLEALPRSSGTVVEAVPVFLEKLQVIQCMDVAEQSLSALEILSRRHNKAILQANGISACLTYLDFFSIVAQRAALAIAANCCLNMHPEEFHFVAESLPLLARLLSQQDKKCIESVCSAFCRLVESFQHDGQRLQQIASPDLLKNCQQLLLVTPAILNTGTFTAVVRMLSLMCCSCPDLAISLLRNDIAATLLYLLTGNAEPAAASATHVELISRSPSELYELTCLIGELMPRLPL-DGIFAVDSLLDRPTL---------NTQDQVHWQWRD-DRGSWHNYSTIDSRLIEAANQSSEDEISLSTFGRTYTVDFHAMQQINEDTGT 1064          

HSP 3 Score: 112.464 bits (280), Expect = 4.770e-24
Identity = 71/184 (38.59%), Postives = 101/184 (54.89%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVR---RM--RVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLW 5705
             L +LR + A+NRHW  L   +    +I +++F   K+ +KANRQLQD   ++  NLP W  Q+  AC FLF  ETR   FY  +FDR R L  L      D+   L++  S  R   R+  R +      +L ++E +L++    + +LEI + NE G GLGPT EFY  VS  L ++DL LW
Sbjct: 2081 ALCMLRVIHALNRHWDHLYGCVVRQNIIPQSDFIHPKIMAKANRQLQDPLVIMTGNLPQWLPQIGMACPFLFPFETRHLLFYATSFDRDRALQRL-----LDTTPDLNAAESSERVAPRLDRRKRAISRTEILKQAEHILQDFGHSKALLEIQYENEVGTGLGPTLEFYALVSAELQRTDLGLW 2259          

HSP 4 Score: 54.6842 bits (130), Expect = 1.501e-6
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 4407 KMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAI-NQVIWKSHHNIHYRPV 4598
            K+Q  IGD +LP  MT+YQA++++S  V       ++ +TD E E  + N  IW   H IHYRPV
Sbjct: 1914 KLQFTIGDHVLPYNMTVYQAVKQFSPLV------SEQPETDNESETLLGNASIWVQQHTIHYRPV 1972          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Fly
Match: ctrip (gene:FBgn0260794 transcript:FBtr0303915)

HSP 1 Score: 281.952 bits (720), Expect = 1.679e-75
Identity = 146/326 (44.79%), Postives = 209/326 (64.11%), Query Frame = 3
Query: 5754 GLYPRPIYSKSKKLD--NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVE-----DLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCG-GRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            GL+P P+  KS KL    K + KF FLG+ MA+A++D R LD+P +  FY+W++ +E  I  ADL  + P + N L  L DLV ++  I +D  I  + K E  E+L ++     DL + FV P +  IEL + G +  VTVH+L  Y+ LV    LIEGV+ Q E + EGFDS+ P  R+ +   F   E+E +FCG G  + +  W++K L E C  DHG+  +S++I  L+EI++ + ++++R F+QF TG+PRLP GGF+AL PP  IV K  +  +NP++YLPSVMTC N+LKLPDYSS+EVMRQ+L  A +EG  +F LS
Sbjct: 2818 GLFPLPL-GKSSKLPQMTKAKAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRM---FYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANEGSMSFHLS 3139          

HSP 2 Score: 176.407 bits (446), Expect = 1.884e-43
Identity = 118/404 (29.21%), Postives = 213/404 (52.72%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNS---MTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVIN-PTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGT 1988
            IG+  + K ++L     + D +Q+     E+ Q L++  ED+L    + ++   ++ L++  E N   + N C   L +++EALPRSS  +V ++ +FL K+  +   D  EQ ++ +E +SRRH +A+LQ    +  L Y DF +   Q   L + + C  N+ P +F+++ + +  L   L Q + KC+E V   F RLV +FQ+D  +L+++AS +L  N Q+LL+ +P ++       +++M++++C +C DLA+ L++ +I  T+L +        + S T     +RS  E+  L  LI ELMP LP  + +F ++ +++ PTL          +Q +  W W +     W ++     +L+E + QS + EIS  + G     +   MQQ +   GT
Sbjct: 1076 IGNSSSSKANQLLQGLQSHDESQQLQAAIEMCQMLVMGNEDTLAGFPIKQVVPALIQLLR-MEHNFDIMNNAC-RALAYMLEALPRSSGTVVEAVPVFLEKLQVIQCMDVAEQSLSALEILSRRHNKAILQANGISACLTYLDFFSIVAQRAALAIAANCCLNMHPEEFHFVAESLPLLARLLSQQDKKCIESVCSAFCRLVESFQHDGQRLQQIASPDLLKNCQQLLLVTPAILNTGTFTAVVRMLSLMCCSCPDLAISLLRNDIAATLLYLLTGNAEPAAASATHVELISRSPSELYELTCLIGELMPRLPL-DGIFAVDSLLDRPTL---------NTQDQVHWQWRD-DRGSWHNYSTIDSRLIEAANQSSEDEISLSTFGRTYTVDFHAMQQINEDTGT 1466          

HSP 3 Score: 112.464 bits (280), Expect = 4.218e-24
Identity = 71/184 (38.59%), Postives = 101/184 (54.89%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVR---RM--RVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLW 5705
             L +LR + A+NRHW  L   +    +I +++F   K+ +KANRQLQD   ++  NLP W  Q+  AC FLF  ETR   FY  +FDR R L  L      D+   L++  S  R   R+  R +      +L ++E +L++    + +LEI + NE G GLGPT EFY  VS  L ++DL LW
Sbjct: 2483 ALCMLRVIHALNRHWDHLYGCVVRQNIIPQSDFIHPKIMAKANRQLQDPLVIMTGNLPQWLPQIGMACPFLFPFETRHLLFYATSFDRDRALQRL-----LDTTPDLNAAESSERVAPRLDRRKRAISRTEILKQAEHILQDFGHSKALLEIQYENEVGTGLGPTLEFYALVSAELQRTDLGLW 2661          

HSP 4 Score: 54.6842 bits (130), Expect = 1.623e-6
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 4407 KMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAI-NQVIWKSHHNIHYRPV 4598
            K+Q  IGD +LP  MT+YQA++++S  V       ++ +TD E E  + N  IW   H IHYRPV
Sbjct: 2316 KLQFTIGDHVLPYNMTVYQAVKQFSPLV------SEQPETDNESETLLGNASIWVQQHTIHYRPV 2374          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Fly
Match: ctrip (gene:FBgn0260794 transcript:FBtr0301437)

HSP 1 Score: 281.952 bits (720), Expect = 1.723e-75
Identity = 146/326 (44.79%), Postives = 209/326 (64.11%), Query Frame = 3
Query: 5754 GLYPRPIYSKSKKLD--NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVE-----DLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCG-GRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            GL+P P+  KS KL    K + KF FLG+ MA+A++D R LD+P +  FY+W++ +E  I  ADL  + P + N L  L DLV ++  I +D  I  + K E  E+L ++     DL + FV P +  IEL + G +  VTVH+L  Y+ LV    LIEGV+ Q E + EGFDS+ P  R+ +   F   E+E +FCG G  + +  W++K L E C  DHG+  +S++I  L+EI++ + ++++R F+QF TG+PRLP GGF+AL PP  IV K  +  +NP++YLPSVMTC N+LKLPDYSS+EVMRQ+L  A +EG  +F LS
Sbjct: 2819 GLFPLPL-GKSSKLPQMTKAKAKFKFLGKFMAKAVMDSRMLDLPFSLPFYRWLVSEEHSIGLADLMRVAPEVQNTLVRLQDLVRQREYILSDPNIDAMEKTEKIEQLDLDGCPIADLGLDFVLPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLIEGVQKQFEALREGFDSVFPIQRLRM---FYPEELECVFCGSGSEQQHSRWEIKMLQESCRTDHGFHQDSQAIQYLYEILASYNRDEQRAFLQFVTGSPRLPTGGFKALTPPLTIVRKTLDENQNPNDYLPSVMTCVNYLKLPDYSSREVMRQKLKVAANEGSMSFHLS 3140          

HSP 2 Score: 176.407 bits (446), Expect = 1.982e-43
Identity = 118/404 (29.21%), Postives = 213/404 (52.72%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNS---MTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVIN-PTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGT 1988
            IG+  + K ++L     + D +Q+     E+ Q L++  ED+L    + ++   ++ L++  E N   + N C   L +++EALPRSS  +V ++ +FL K+  +   D  EQ ++ +E +SRRH +A+LQ    +  L Y DF +   Q   L + + C  N+ P +F+++ + +  L   L Q + KC+E V   F RLV +FQ+D  +L+++AS +L  N Q+LL+ +P ++       +++M++++C +C DLA+ L++ +I  T+L +        + S T     +RS  E+  L  LI ELMP LP  + +F ++ +++ PTL          +Q +  W W +     W ++     +L+E + QS + EIS  + G     +   MQQ +   GT
Sbjct: 1077 IGNSSSSKANQLLQGLQSHDESQQLQAAIEMCQMLVMGNEDTLAGFPIKQVVPALIQLLR-MEHNFDIMNNAC-RALAYMLEALPRSSGTVVEAVPVFLEKLQVIQCMDVAEQSLSALEILSRRHNKAILQANGISACLTYLDFFSIVAQRAALAIAANCCLNMHPEEFHFVAESLPLLARLLSQQDKKCIESVCSAFCRLVESFQHDGQRLQQIASPDLLKNCQQLLLVTPAILNTGTFTAVVRMLSLMCCSCPDLAISLLRNDIAATLLYLLTGNAEPAAASATHVELISRSPSELYELTCLIGELMPRLPL-DGIFAVDSLLDRPTL---------NTQDQVHWQWRD-DRGSWHNYSTIDSRLIEAANQSSEDEISLSTFGRTYTVDFHAMQQINEDTGT 1467          

HSP 3 Score: 112.464 bits (280), Expect = 4.290e-24
Identity = 71/184 (38.59%), Postives = 101/184 (54.89%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVR---RM--RVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLW 5705
             L +LR + A+NRHW  L   +    +I +++F   K+ +KANRQLQD   ++  NLP W  Q+  AC FLF  ETR   FY  +FDR R L  L      D+   L++  S  R   R+  R +      +L ++E +L++    + +LEI + NE G GLGPT EFY  VS  L ++DL LW
Sbjct: 2484 ALCMLRVIHALNRHWDHLYGCVVRQNIIPQSDFIHPKIMAKANRQLQDPLVIMTGNLPQWLPQIGMACPFLFPFETRHLLFYATSFDRDRALQRL-----LDTTPDLNAAESSERVAPRLDRRKRAISRTEILKQAEHILQDFGHSKALLEIQYENEVGTGLGPTLEFYALVSAELQRTDLGLW 2662          

HSP 4 Score: 54.6842 bits (130), Expect = 1.636e-6
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 4407 KMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAI-NQVIWKSHHNIHYRPV 4598
            K+Q  IGD +LP  MT+YQA++++S  V       ++ +TD E E  + N  IW   H IHYRPV
Sbjct: 2317 KLQFTIGDHVLPYNMTVYQAVKQFSPLV------SEQPETDNESETLLGNASIWVQQHTIHYRPV 2375          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Zebrafish
Match: trip12 (thyroid hormone receptor interactor 12 [Source:NCBI gene;Acc:564866])

HSP 1 Score: 392.889 bits (1008), Expect = 9.051e-110
Identity = 223/527 (42.31%), Postives = 309/527 (58.63%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L +++R+W  L  N  C  +I   EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  I S DL  IDP +A  ++ L D++ +K  I+ D++ ++   ++A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E   +WDVKTL E C  DHGYT +SR++  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1535 LLRVLHSISRYWFYLYDNAACKEIIPTGEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINRDELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTQEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYMFSS-RGLFAVPFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHESSISSHDLVNIDPGVAKSIQHLEDIIRQKKRIEQDRSHTRETLQQALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYLRLVVYWTLNEGVLRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---SWDVKTLMECCRPDHGYTHDSRAVRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2053          

HSP 2 Score: 220.705 bits (561), Expect = 7.778e-57
Identity = 145/476 (30.46%), Postives = 248/476 (52.10%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PPV+S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            S   TE + W W +    + + HP N    +++E + Q+ + EIS  + G     +   MQQ +   GT     ++R  +          +++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  487 ATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVLTPPVLSSGMFIMVVRMFSLMCSNCPCLAVQLMKQNIAETLRFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPR-EGIFAVDAMLK---------KGSAQTTEGAIWQWRD---DRGLWHPYNRIDSRIIETAHQNGEDEISLSTLGRVYTIDFNSMQQINEDTGT--ARAIQRKPNPLANPNTGGHLEVRREDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 934          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Zebrafish
Match: trip12 (thyroid hormone receptor interactor 12 [Source:NCBI gene;Acc:564866])

HSP 1 Score: 392.504 bits (1007), Expect = 9.396e-110
Identity = 223/527 (42.31%), Postives = 309/527 (58.63%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L +++R+W  L  N  C  +I   EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  I S DL  IDP +A  ++ L D++ +K  I+ D++ ++   ++A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E   +WDVKTL E C  DHGYT +SR++  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1508 LLRVLHSISRYWFYLYDNAACKEIIPTGEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINRDELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTQEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYMFSS-RGLFAVPFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHESSISSHDLVNIDPGVAKSIQHLEDIIRQKKRIEQDRSHTRETLQQALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYLRLVVYWTLNEGVLRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---SWDVKTLMECCRPDHGYTHDSRAVRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2026          

HSP 2 Score: 204.912 bits (520), Expect = 4.649e-52
Identity = 140/474 (29.54%), Postives = 238/474 (50.21%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PPV+S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            S   TE + W W +    + + HP N                        ID+ +I  +Q +   GT     ++R  +          +++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  487 ATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVLTPPVLSSGMFIMVVRMFSLMCSNCPCLAVQLMKQNIAETLRFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPR-EGIFAVDAMLK---------KGSAQTTEGAIWQWRD---DRGLWHPYNR-----------------------IDSRII--EQINEDTGT--ARAIQRKPNPLANPNTGGHLEVRREDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 907          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Zebrafish
Match: trip12 (thyroid hormone receptor interactor 12 [Source:NCBI gene;Acc:564866])

HSP 1 Score: 392.504 bits (1007), Expect = 1.305e-109
Identity = 223/527 (42.31%), Postives = 309/527 (58.63%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L +++R+W  L  N  C  +I   EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  I S DL  IDP +A  ++ L D++ +K  I+ D++ ++   ++A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E   +WDVKTL E C  DHGYT +SR++  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1593 LLRVLHSISRYWFYLYDNAACKEIIPTGEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINRDELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTQEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYMFSS-RGLFAVPFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHESSISSHDLVNIDPGVAKSIQHLEDIIRQKKRIEQDRSHTRETLQQALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYLRLVVYWTLNEGVLRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---SWDVKTLMECCRPDHGYTHDSRAVRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2111          

HSP 2 Score: 221.09 bits (562), Expect = 5.194e-57
Identity = 149/493 (30.22%), Postives = 254/493 (51.52%), Query Frame = 3
Query:  801 IGDQINKKLDELHS---AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PPV+S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            S   TE + W W +    + + HP N    +++E + Q+ + EIS  + G     +   MQQ +   GT     ++R  +          +++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  512 IGSGASSKAQQLLQGLQATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVLTPPVLSSGMFIMVVRMFSLMCSNCPCLAVQLMKQNIAETLRFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPR-EGIFAVDAMLK---------KGSAQTTEGAIWQWRD---DRGLWHPYNRIDSRIIETAHQNGEDEISLSTLGRVYTIDFNSMQQINEDTGT--ARAIQRKPNPLANPNTGGHLEVRREDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 976          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Zebrafish
Match: hectd1 (HECT domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030616-153])

HSP 1 Score: 121.709 bits (304), Expect = 9.330e-27
Identity = 89/287 (31.01%), Postives = 140/287 (48.78%), Query Frame = 3
Query: 5877 PLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL------------GVEDLLIVF-------VHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            P  P +Y  +L  E      D   ++P  A  LK L  L  K+  I  +K++S+  K    ++L             VEDL + F       VH  ++ ++L  +G + +VT+ +   Y++L+ +  +  G++ QME   EGF+ + P   M   + F   E++ I CG +     A D+   TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   IV K +     D   PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct: 2294 PKPPAWYHGILTWE------DFELVNPHRALFLKELKALSVKRRQILGNKSLSEDEKNTRLQDLMLKNPMGSGPPLCVEDLGLNFQFCPSSKVHG-FSSVDLKPNGEDEMVTMDNAEEYVELMFDFCMHTGIQKQMEAFREGFNKVFP---MEKLSSFSHKEVQMILCGNQSPSWTAEDIVNYTEP---KLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTIVRKVDA---TDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 2564          

HSP 2 Score: 109.768 bits (273), Expect = 3.497e-23
Identity = 71/242 (29.34%), Postives = 122/242 (50.41%), Query Frame = 3
Query: 5253 SENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTT-----------SEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYK 5900
            S  EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ +F    F  +R +++L+       +    STT             ++  RV+V R + +++ +E +++   D + +LE+ F  E G GLGPT EFY  V+    ++ L +W    +  DD          L PP        GL+P P    S +L+ ++   F+FLG  +A+ + D R +D+P++  F+K
Sbjct: 1992 SPEEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRGESMMEWAESVMQIHADRKSVLEVEFQGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFPDDESRQVDLGGGLKPPGYYVQRSCGLFPAPFPQDSDELE-RITKLFLFLGIFLAKCIQDNRLVDLPISQPFFK 2232          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Zebrafish
Match: hectd1 (HECT domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030616-153])

HSP 1 Score: 121.709 bits (304), Expect = 9.749e-27
Identity = 89/287 (31.01%), Postives = 140/287 (48.78%), Query Frame = 3
Query: 5877 PLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL------------GVEDLLIVF-------VHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            P  P +Y  +L  E      D   ++P  A  LK L  L  K+  I  +K++S+  K    ++L             VEDL + F       VH  ++ ++L  +G + +VT+ +   Y++L+ +  +  G++ QME   EGF+ + P   M   + F   E++ I CG +     A D+   TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   IV K +     D   PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct: 2233 PKPPAWYHGILTWE------DFELVNPHRALFLKELKALSVKRRQILGNKSLSEDEKNTRLQDLMLKNPMGSGPPLCVEDLGLNFQFCPSSKVHG-FSSVDLKPNGEDEMVTMDNAEEYVELMFDFCMHTGIQKQMEAFREGFNKVFP---MEKLSSFSHKEVQMILCGNQSPSWTAEDIVNYTEP---KLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTIVRKVDA---TDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 2503          

HSP 2 Score: 110.153 bits (274), Expect = 3.278e-23
Identity = 71/242 (29.34%), Postives = 122/242 (50.41%), Query Frame = 3
Query: 5253 SENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTT-----------SEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYK 5900
            S  EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ +F    F  +R +++L+       +    STT             ++  RV+V R + +++ +E +++   D + +LE+ F  E G GLGPT EFY  V+    ++ L +W    +  DD          L PP        GL+P P    S +L+ ++   F+FLG  +A+ + D R +D+P++  F+K
Sbjct: 1931 SPEEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRGESMMEWAESVMQIHADRKSVLEVEFQGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFPDDESRQVDLGGGLKPPGYYVQRSCGLFPAPFPQDSDELE-RITKLFLFLGIFLAKCIQDNRLVDLPISQPFFK 2171          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Xenopus
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1014202])

HSP 1 Score: 390.578 bits (1002), Expect = 6.018e-109
Identity = 224/531 (42.18%), Postives = 311/531 (58.57%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR D L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  LP P G             L+  P    +K     K++ KF FLG+LMA+A++D R +DIPL   FYKW+L QE  + + DL  IDP++A  +  L D+V +K  ++ DK  ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  Y+ LV   +L EGV  Q++   +GF+S+ P   +     F   E++++ CG R +    WDVKTL E C  DHGYT +SR++  LFEI+S F KEQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS + MR++LL A  EGQ +F LS
Sbjct: 1486 LLRVLHAISRYWYYLYDNAVCKEIIPTSEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREDLLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWR-----GEEVTLPNPKGSQEGTKYIHNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDIPLGLPFYKWMLRQESSLATHDLVNIDPVVAKSVYHLEDIVRQKKRLEQDKAQTKESLQFALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYVRLVIYWALNEGVSRQLDSFRDGFESVFPLNHLQY---FYPEELDQLLCGSRAD---PWDVKTLMECCRPDHGYTHDSRAVKFLFEILSSFDKEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEATENPDDFLPSVMTCVNYLKLPDYSSIDNMREKLLMAAREGQQSFHLS 2004          

HSP 2 Score: 207.608 bits (527), Expect = 1.041e-52
Identity = 136/471 (28.87%), Postives = 241/471 (51.17%), Query Frame = 3
Query:  846 AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A D +Q+   + E+ Q L++  E++L    V  +   +V          + + + C   L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +     W  + +   +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +  + ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  432 ATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALVR-------ETLGMNHAC-RALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCLEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD-DRGLWHPYSRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPVANANTTGHSELKRDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 872          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Xenopus
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1014202])

HSP 1 Score: 390.578 bits (1002), Expect = 6.988e-109
Identity = 224/531 (42.18%), Postives = 311/531 (58.57%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR D L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  LP P G             L+  P    +K     K++ KF FLG+LMA+A++D R +DIPL   FYKW+L QE  + + DL  IDP++A  +  L D+V +K  ++ DK  ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  Y+ LV   +L EGV  Q++   +GF+S+ P   +     F   E++++ CG R +    WDVKTL E C  DHGYT +SR++  LFEI+S F KEQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS + MR++LL A  EGQ +F LS
Sbjct: 1546 LLRVLHAISRYWYYLYDNAVCKEIIPTSEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREDLLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWR-----GEEVTLPNPKGSQEGTKYIHNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDIPLGLPFYKWMLRQESSLATHDLVNIDPVVAKSVYHLEDIVRQKKRLEQDKAQTKESLQFALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYVRLVIYWALNEGVSRQLDSFRDGFESVFPLNHLQY---FYPEELDQLLCGSRAD---PWDVKTLMECCRPDHGYTHDSRAVKFLFEILSSFDKEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEATENPDDFLPSVMTCVNYLKLPDYSSIDNMREKLLMAAREGQQSFHLS 2064          

HSP 2 Score: 202.601 bits (514), Expect = 2.898e-51
Identity = 140/490 (28.57%), Postives = 247/490 (50.41%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLE--KSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   +V          + + + C   L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +     W  + +   +++E   + Q  + EIS  + G     +   MQQ +   GT      K +      +  + ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  473 IGSGASSKAQQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALVR-------ETLGMNHAC-RALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCLEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD-DRGLWHPYSRIDSRIIEVKAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPVANANTTGHSELKRDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 932          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Xenopus
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1014202])

HSP 1 Score: 390.578 bits (1002), Expect = 7.142e-109
Identity = 226/531 (42.56%), Postives = 312/531 (58.76%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR D L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  LP P G             L+  P    +K     K++ KF FLG+LMA+A++D R +DIPL   FYKW+L QE  + + DL  IDP++A  +  L D+V +K  ++ DK  ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  Y+ LV   +L EGV  Q++   +GF+S+ P    HL   F   E++++ CG R +    WDVKTL E C  DHGYT +SR++  LFEI+S F KEQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS + MR++LL A  EGQ +F LS
Sbjct: 1518 LLRVLHAISRYWYYLYDNAVCKEIIPTSEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREDLLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWR-----GEEVTLPNPKGSQEGTKYIHNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDIPLGLPFYKWMLRQESSLATHDLVNIDPVVAKSVYHLEDIVRQKKRLEQDKAQTKESLQFALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYVRLVIYWALNEGVSRQLDSFRDGFESVFP--LNHLQ-YFYPEELDQLLCGSRAD---PWDVKTLMECCRPDHGYTHDSRAVKFLFEILSSFDKEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEATENPDDFLPSVMTCVNYLKLPDYSSIDNMREKLLMAAREGQQSFHLS 2036          

HSP 2 Score: 207.608 bits (527), Expect = 9.708e-53
Identity = 140/488 (28.69%), Postives = 247/488 (50.61%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   +V          + + + C   L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +     W  + +   +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +  + ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  447 IGSGASSKAQQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALVR-------ETLGMNHAC-RALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCLEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD-DRGLWHPYSRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPVANANTTGHSELKRDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 904          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Xenopus
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1014202])

HSP 1 Score: 390.193 bits (1001), Expect = 7.506e-109
Identity = 224/531 (42.18%), Postives = 311/531 (58.57%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR D L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  LP P G             L+  P    +K     K++ KF FLG+LMA+A++D R +DIPL   FYKW+L QE  + + DL  IDP++A  +  L D+V +K  ++ DK  ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  Y+ LV   +L EGV  Q++   +GF+S+ P   +     F   E++++ CG R +    WDVKTL E C  DHGYT +SR++  LFEI+S F KEQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS + MR++LL A  EGQ +F LS
Sbjct: 1523 LLRVLHAISRYWYYLYDNAVCKEIIPTSEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREDLLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWR-----GEEVTLPNPKGSQEGTKYIHNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDIPLGLPFYKWMLRQESSLATHDLVNIDPVVAKSVYHLEDIVRQKKRLEQDKAQTKESLQFALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYVRLVIYWALNEGVSRQLDSFRDGFESVFPLNHLQY---FYPEELDQLLCGSRAD---PWDVKTLMECCRPDHGYTHDSRAVKFLFEILSSFDKEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEATENPDDFLPSVMTCVNYLKLPDYSSIDNMREKLLMAAREGQQSFHLS 2041          

HSP 2 Score: 207.994 bits (528), Expect = 6.711e-53
Identity = 140/488 (28.69%), Postives = 247/488 (50.61%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   +V          + + + C   L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +     W  + +   +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +  + ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  466 IGSGASSKAQQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALVR-------ETLGMNHAC-RALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCLEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD-DRGLWHPYSRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPVANANTTGHSELKRDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 923          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Xenopus
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1014202])

HSP 1 Score: 389.808 bits (1000), Expect = 7.939e-109
Identity = 224/531 (42.18%), Postives = 311/531 (58.57%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR D L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  LP P G             L+  P    +K     K++ KF FLG+LMA+A++D R +DIPL   FYKW+L QE  + + DL  IDP++A  +  L D+V +K  ++ DK  ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  Y+ LV   +L EGV  Q++   +GF+S+ P   +     F   E++++ CG R +    WDVKTL E C  DHGYT +SR++  LFEI+S F KEQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS + MR++LL A  EGQ +F LS
Sbjct: 1456 LLRVLHAISRYWYYLYDNAVCKEIIPTSEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREDLLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWR-----GEEVTLPNPKGSQEGTKYIHNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDIPLGLPFYKWMLRQESSLATHDLVNIDPVVAKSVYHLEDIVRQKKRLEQDKAQTKESLQFALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYVRLVIYWALNEGVSRQLDSFRDGFESVFPLNHLQY---FYPEELDQLLCGSRAD---PWDVKTLMECCRPDHGYTHDSRAVKFLFEILSSFDKEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEATENPDDFLPSVMTCVNYLKLPDYSSIDNMREKLLMAAREGQQSFHLS 1974          

HSP 2 Score: 216.468 bits (550), Expect = 1.915e-55
Identity = 144/488 (29.51%), Postives = 251/488 (51.43%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +     W  + +   +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +  + ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  393 IGSGASSKAQQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCLEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD-DRGLWHPYSRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPVANANTTGHSELKRDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 856          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Mouse
Match: Trip12 (thyroid hormone receptor interactor 12 [Source:MGI Symbol;Acc:MGI:1309481])

HSP 1 Score: 379.407 bits (973), Expect = 6.751e-112
Identity = 220/530 (41.51%), Postives = 309/530 (58.30%), Query Frame = 3
Query: 5169 TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWY---------VSSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
             + LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P   +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS ++MR +LL A  EGQ +F LS
Sbjct:  309 VILLLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLCLWRGEEVTLSNPKGSQEGTKYI-QNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVCRQFDSFRDGFESVFPLCHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIDIMRDKLLIAAREGQQSFHLS 830          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Mouse
Match: Trip12 (thyroid hormone receptor interactor 12 [Source:MGI Symbol;Acc:MGI:1309481])

HSP 1 Score: 382.874 bits (982), Expect = 1.145e-106
Identity = 220/527 (41.75%), Postives = 308/527 (58.44%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P   +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS ++MR +LL A  EGQ +F LS
Sbjct: 1507 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLCLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVCRQFDSFRDGFESVFPLCHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIDIMRDKLLIAAREGQQSFHLS 2025          

HSP 2 Score: 216.853 bits (551), Expect = 1.035e-55
Identity = 146/490 (29.80%), Postives = 252/490 (51.43%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N    +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +    ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  437 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANSNTSGYSELKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 900          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Mouse
Match: Trip12 (thyroid hormone receptor interactor 12 [Source:MGI Symbol;Acc:MGI:1309481])

HSP 1 Score: 382.874 bits (982), Expect = 1.145e-106
Identity = 220/527 (41.75%), Postives = 308/527 (58.44%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P   +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS ++MR +LL A  EGQ +F LS
Sbjct: 1507 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLCLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVCRQFDSFRDGFESVFPLCHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIDIMRDKLLIAAREGQQSFHLS 2025          

HSP 2 Score: 216.853 bits (551), Expect = 1.035e-55
Identity = 146/490 (29.80%), Postives = 252/490 (51.43%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N    +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +    ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  437 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANSNTSGYSELKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 900          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Mouse
Match: Trip12 (thyroid hormone receptor interactor 12 [Source:MGI Symbol;Acc:MGI:1309481])

HSP 1 Score: 382.489 bits (981), Expect = 1.254e-106
Identity = 220/527 (41.75%), Postives = 308/527 (58.44%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P   +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS ++MR +LL A  EGQ +F LS
Sbjct: 1474 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLCLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVCRQFDSFRDGFESVFPLCHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIDIMRDKLLIAAREGQQSFHLS 1992          

HSP 2 Score: 202.601 bits (514), Expect = 2.111e-51
Identity = 144/488 (29.51%), Postives = 241/488 (49.39%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNG-TKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N            D  I  Q N        I  +   + N  T   S+LK               K D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  431 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYN----------RIDSRIIEQINEDTGTARAIQRKPNPLANSNTSGYSELK---------------KDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 867          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Mouse
Match: Trip12 (thyroid hormone receptor interactor 12 [Source:MGI Symbol;Acc:MGI:1309481])

HSP 1 Score: 218.779 bits (556), Expect = 2.841e-57
Identity = 146/490 (29.80%), Postives = 252/490 (51.43%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N    +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +    ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  437 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANSNTSGYSELKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 900          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. UniProt/SwissProt
Match: sp|F1RCR6|TRIPC_DANRE (E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio OX=7955 GN=trip12 PE=3 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 7.093e-109
Identity = 223/527 (42.31%), Postives = 309/527 (58.63%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L +++R+W  L  N  C  +I   EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  I S DL  IDP +A  ++ L D++ +K  I+ D++ ++   ++A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E   +WDVKTL E C  DHGYT +SR++  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1508 LLRVLHSISRYWFYLYDNAACKEIIPTGEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINRDELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTQEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYMFSS-RGLFAVPFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHESSISSHDLVNIDPGVAKSIQHLEDIIRQKKRIEQDRSHTRETLQQALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYLRLVVYWTLNEGVLRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---SWDVKTLMECCRPDHGYTHDSRAVRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2026          

HSP 2 Score: 204.912 bits (520), Expect = 3.509e-51
Identity = 140/474 (29.54%), Postives = 238/474 (50.21%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PPV+S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            S   TE + W W +    + + HP N                        ID+ +I  +Q +   GT     ++R  +          +++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  487 ATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVLTPPVLSSGMFIMVVRMFSLMCSNCPCLAVQLMKQNIAETLRFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPR-EGIFAVDAMLK---------KGSAQTTEGAIWQWRD---DRGLWHPYNR-----------------------IDSRII--EQINEDTGT--ARAIQRKPNPLANPNTGGHLEVRREDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 907          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. UniProt/SwissProt
Match: sp|B4F6W9|TRIPC_XENTR (E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis OX=8364 GN=trip12 PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 6.622e-108
Identity = 224/531 (42.18%), Postives = 311/531 (58.57%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR D L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  LP P G             L+  P    +K     K++ KF FLG+LMA+A++D R +DIPL   FYKW+L QE  + + DL  IDP++A  +  L D+V +K  ++ DK  ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  Y+ LV   +L EGV  Q++   +GF+S+ P   +     F   E++++ CG R +    WDVKTL E C  DHGYT +SR++  LFEI+S F KEQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS + MR++LL A  EGQ +F LS
Sbjct: 1538 LLRVLHAISRYWYYLYDNAVCKEIIPTSEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREDLLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWR-----GEEVTLPNPKGSQEGTKYIHNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDIPLGLPFYKWMLRQESSLATHDLVNIDPVVAKSVYHLEDIVRQKKRLEQDKAQTKESLQFALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEDYVRLVIYWALNEGVSRQLDSFRDGFESVFPLNHLQY---FYPEELDQLLCGSRAD---PWDVKTLMECCRPDHGYTHDSRAVKFLFEILSSFDKEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEATENPDDFLPSVMTCVNYLKLPDYSSIDNMREKLLMAAREGQQSFHLS 2056          

HSP 2 Score: 216.083 bits (549), Expect = 1.349e-54
Identity = 144/488 (29.51%), Postives = 251/488 (51.43%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +     W  + +   +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +  + ++K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  473 IGSGASSKAQQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSISPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCLEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD-DRGLWHPYSRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPVANANTTGHSELKRDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 936          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. UniProt/SwissProt
Match: sp|E1B7Q7|TRIPC_BOVIN (E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus OX=9913 GN=TRIP12 PE=2 SV=2)

HSP 1 Score: 387.111 bits (993), Expect = 3.116e-107
Identity = 222/527 (42.13%), Postives = 310/527 (58.82%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L AV+R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1474 LLRVLHAVSRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSLEIMREKLLMAAREGQQSFHLS 1992          

HSP 2 Score: 202.601 bits (514), Expect = 1.690e-50
Identity = 144/488 (29.51%), Postives = 241/488 (49.39%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLN-GTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N            D  I  Q N        I  +   + N  T   S+LK               K D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  431 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYN----------RIDSRIIEQINEDTGTARAIQRKPNPLANTNTSGYSELK---------------KDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 867          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. UniProt/SwissProt
Match: sp|Q14669|TRIPC_HUMAN (E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 6.444e-107
Identity = 221/527 (41.94%), Postives = 310/527 (58.82%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1474 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1992          

HSP 2 Score: 201.445 bits (511), Expect = 3.523e-50
Identity = 142/490 (28.98%), Postives = 244/490 (49.80%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNC---DIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N                        ID+ +I  +Q +   GT     ++R  +    S  +      K D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  431 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNR-----------------------IDSRII--EQINEDTGT--ARAIQRKPNPLANSNTSGYSESKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 867          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. UniProt/SwissProt
Match: sp|F1LP64|TRIPC_RAT (E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus OX=10116 GN=Trip12 PE=1 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.800e-106
Identity = 221/527 (41.94%), Postives = 309/527 (58.63%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L D+V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR +LL A  EGQ +F LS
Sbjct: 1507 LLRVLHAISRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNL-QGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVCRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKAD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMRDKLLIAAREGQQSFHLS 2025          

HSP 2 Score: 218.394 bits (555), Expect = 2.540e-55
Identity = 147/490 (30.00%), Postives = 252/490 (51.43%), Query Frame = 3
Query:  801 IGDQINKKLDELHSA--AGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI-DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            IG   + K  +L     A D +Q+   + E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            +   T+ + W W +    + + HP N    +++E + Q  + EIS  + G     +   MQQ +   GT      K +      +    D+K  D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  437 IGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPK-EGIFAVDTMLK---------KGNAQNTDGAIWQWRD---DRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANTNTSGYSDLKKDDARAQLMKE-----------DPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 900          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. TrEMBL
Match: A0A2S2R5J1 (Putative E3 ubiquitin-protein ligase OS=Sipha flava OX=143950 GN=TRIP12_0 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 3.976e-113
Identity = 237/527 (44.97%), Postives = 325/527 (61.67%), Query Frame = 3
Query: 5172 LALLRCLSAVNRHWHVL-SFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYL-------EGASNQDSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDN--KMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLV--EKKILID---NDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            L+LLR L+A+NR+W  L    L+ N++I  NEF + K+S+KANRQLQD   ++  NLP W  Q+  ACAFL   ETRQ  FY   FDR R L  L       +GA N  + +  +     + R +  V RS+ L     ++ +N    R +LEI + +E G GLGPT EFY  VS  L K+DL LW   S+S  D  +  P GLYP PI S++ KL +  KM++KF FLG+ MA+A++D R LD+PL+   Y+W+LG E  +  +DL YI P +   L  LH LV   K ILID   ND+  ++   K   +   VEDL + F  P ++ +EL K+G N  VT+ +L  Y++LV +  L EGV  QME + EGF+S+    R  L  LF   E+E IFCG  +   + WDV+ L+E C  DHGYT NSR+I  LF+I+S++  +Q+R F++F TG PRLPVGGF++L P   IV +  E  +NPD+YLPSVMTC N+LKLPDYSS ++MR++L  A  EGQ++F LS
Sbjct: 1459 LSLLRVLNAINRYWTSLYPTQLHNNSIIPFNEFINVKISAKANRQLQDPLVIMTGNLPGWLQQVASACAFLLPFETRQLLFYATVFDRDRALQRLLDSSSELQGAGNNTNGDMHERVAPRLDRRKRSVTRSNILSQAEAVISENATS-RALLEIQYEDEVGTGLGPTLEFYALVSKELQKADLELWNNPSKSESDSYVYSPEGLYPNPI-SRTTKLPHQVKMKSKFKFLGKFMAKAIMDSRLLDLPLSITMYRWLLGHENYLSLSDLSYIVPDVYKTLSKLHQLVLERKVILIDESLNDEEKTEKISKITLDGCSVEDLGLNFTLPGHSTVELRKNGQNIDVTIENLDKYIELVCHWFLREGVSKQMESLREGFESVFSLKR--LGQLFYPEELEAIFCG-HINTTKNWDVRMLSESCRLDHGYTANSRAIGFLFQILSEYDNQQQRDFLRFVTGAPRLPVGGFKSLSPALTIVRRIFEDNDNPDDYLPSVMTCVNYLKLPDYSSIDIMRKKLQMAASEGQHSFHLS 1980          

HSP 2 Score: 214.927 bits (546), Expect = 9.761e-52
Identity = 150/500 (30.00%), Postives = 257/500 (51.40%), Query Frame = 3
Query:  765 NYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGT-----KVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            ++L +RS+ A     +  + L  +  A GD  Q+   + E+ Q L++  ED+L    V  + T ++ L+ + E N  D+ N     L ++MEALPRSS  ++ ++   L+K+  +   D  EQ ++ +E +SRRHG+++LQ       L + DF +   Q   L + + C  N+   +F+Y+   +  L++R+ Q + K VE V   F RLV  FQ+D  KLK++AS+ L  NLQ+L+++SPPV+  S    +++MM+ LCTNC +L+  L+K NI +T+  +     S   T      RS +E+  +  LI ELMP LP  + LF ++ +++      +      SQ    W W +  S  W S+     +++E + Q+ + E+        ID  L  M+Q +   GT     + V  +  S +   Q++   D  +D+ +            +   +N  A   +R LF +L ++YN ++   VRYKCL A++RM+Y
Sbjct:  314 HHLFNRSMGAASTTSKAQQLLQGMQ-ATGDEGQQLQAVIEMCQMLVMGNEDTLTGFPVKPVVTALIVLL-SMEHNF-DMMNHACRALTYMMEALPRSSAAVLDAVPAMLDKLQAIQCMDVAEQSLSALEMLSRRHGRSILQSSGVAACLTFIDFFSINAQRAALAITANCCQNMNSDEFHYVFKSLPLLSSRVTQQDKKSVESVCLAFSRLVDNFQSDPNKLKEIASDELLTNLQQLVVASPPVMSTSTFIMVLRMMSTLCTNCPELSQTLLKNNIAETLGYLLTGSPSPELTQIELLPRSSQELYEVTCLIGELMPRLPA-DGLFSVDSLLDRHGIYGAIPGSGSSQQMVQWQWRDDRS-MWHSYTSLDSRIIEVAHQAGEDEVLLSHAPYTID--LHSMRQINEDTGTTRPIQRKVLTVPSSFNNNHQTRSTSD--VDTVV------------ASFGENELAGSFVRLLFSILYEVYNSSAGPLVRYKCLRALLRMVY 792          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. TrEMBL
Match: A0A2D4H2B8 (HECT domain-containing protein OS=Micrurus corallinus OX=54390 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.675e-112
Identity = 220/531 (41.43%), Postives = 312/531 (58.76%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N +CN +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  L  P G             L+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L ++V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  E PD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct:  118 LLRVLHAISRYWYYLYDNASCNEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLW-----RGEEVTLANPKGSQEGTKYIHNIQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFNIDPVVAKSVYHLEEIVRQKRRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKTD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDSEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTETPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAKEGQQSFHLS 636          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. TrEMBL
Match: A0A2D4NQK1 (HECT domain-containing protein OS=Micrurus surinamensis OX=129470 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.675e-112
Identity = 220/531 (41.43%), Postives = 312/531 (58.76%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N +CN +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  L  P G             L+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L ++V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  E PD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct:  118 LLRVLHAISRYWYYLYDNASCNEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLW-----RGEEVTLANPKGSQEGTKYIHNIQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFNIDPVVAKSVYHLEEIVRQKRRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKTD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDSEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTETPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAKEGQQSFHLS 636          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. TrEMBL
Match: A0A2D4J1F5 (HECT domain-containing protein OS=Micrurus lemniscatus lemniscatus OX=129467 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.675e-112
Identity = 220/531 (41.43%), Postives = 312/531 (58.76%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG-------------LYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W+ L  N +CN +I  +EF + KL++KANRQLQD   ++  N+P W  +L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  VNR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW       ++  L  P G             L+  P    +K     K++ KF FLG+LMA+A++D R +D+PL   FYKW+L QE  + S DL+ IDP++A  +  L ++V +K  ++ DK+ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q +   +GF+S+ P + +     F   E++++ CG + +    WD KTL E C  DHGYT +SR++  LFEI+S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  E PD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct:  118 LLRVLHAISRYWYYLYDNASCNEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLW-----RGEEVTLANPKGSQEGTKYIHNIQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFNIDPVVAKSVYHLEEIVRQKRRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQY---FYPEELDQLLCGSKTD---TWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDSEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTETPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAKEGQQSFHLS 636          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. TrEMBL
Match: A0A1S3K657 (E3 ubiquitin-protein ligase TRIP12 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106179131 PE=4 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 7.096e-112
Identity = 227/526 (43.16%), Postives = 325/526 (61.79%), Query Frame = 3
Query: 5172 LALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDD--------YVLPPPAGLYPRPIYSKSK-KLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LALLR L A+N +W  L    + + L+S  EF S KL +KANRQLQD   ++  NLP W  ++  AC FLF  +TRQ  FY   FDR R ++ L+ A+   ++N      +     R +V   D LL ++E +++   + + +LEI + NE G GLGPT EFY+ VS  L +SDL +W   +    D          +  P GL+  P+   +K  L  K++NKF FLG+ MA+AL+D R +DIPL+ VFYKW+L QE+ +   DL ++D +L    + +H +V +K  I++DK+ +   ++ A   L      +EDL + F+ P Y  IEL K G +  VT+ +L  YL+LV + +L+EGV  Q E + EGF+S+ P    HL + F  HE+E++FCG   E    W++K+L E C  DHGY+ +SR++ NLFEI+S +T E++R F+QF TG+PRLPVGGF++L PP  IV K  E  E+PD++LPSVMTC N+LKLPDYSS EVMR++L  A  EGQ +F LS
Sbjct: 1724 LALLRVLHAINIYWGALYETSSYDPLVSSLEFSSSKLIAKANRQLQDPLVIMTGNLPQWLPEIAAACPFLFPFDTRQMLFYATAFDRDRAMMRLQDATQDAANNDTSERVAPRLDRRKRVVSRDDLLKQAEKVMEEMGNSKALLEIQYENEVGTGLGPTLEFYSLVSRELRRSDLDIWRGEATKLKDSSGCDEETLYMHSPCGLFVAPLPRSAKASLVTKVKNKFKFLGKFMAKALMDSRMVDIPLSLVFYKWLLNQEQSLDHRDLQHVDTVLYKSFQQMHHIVRQKKRIESDKSHTPESRQLALNNLTIDGCSIEDLSLDFILPGYANIELKKGGKDTAVTLDNLEEYLNLVVHWTLVEGVYRQFEALREGFESVFP--LRHLQS-FYPHELEQLFCGSSQE---LWEMKSLMECCRPDHGYSHDSRAVKNLFEILSSYTTEEQRSFLQFVTGSPRLPVGGFKSLSPPLTIVRKTFEPNESPDHFLPSVMTCVNYLKLPDYSSIEVMREKLRIAAQEGQLSFHLS 2243          

HSP 2 Score: 226.098 bits (575), Expect = 4.090e-55
Identity = 143/475 (30.11%), Postives = 248/475 (52.21%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVI--SDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLK---RSRHQFRQSQKNCD-IKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD  Q+     E+ Q L++  ED+L    V ++   ++ L+Q   D+  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +++LQ G     L + DF +   Q   L + + C  N+   +F+Y+ D +  L+ RL   + K VE V  CF RLV  FQ DE  LK+++++ L  N+ +LL+ +PPV+       +++M+A++C +C DLAV L+K NI  T+  +    +  ++       R+ +E+  +V LI ELMP+LP N+ +F ++ ++     + + +          W W +    + + HP ++   +++E S QS + E+S  + G     +   MQQ +   GT      K    + H    +  NC  ++ DSR ++L E        DL     A   I+ LF +L ++Y+ ++   VR+KCL+A++RM+Y
Sbjct:  621 AVGDEGQQLTAAIEMCQLLVMGNEDTLAGFPVKQVVPALITLLQ--MDHNFDIMNNSCRALTYMMEALPRSSAVVVDAVPVFLEKLQVIQCMDVAEQALTALEMLSRRHSKSILQAGGIAACLMFLDFFSITAQRCALAITANCCQNMNSDEFHYVRDSLPLLSGRLSHHDKKSVESVCLCFSRLVDNFQTDERILKEISAHGLLTNILQLLVVTPPVVNTGTFVTVLRMLAVMCASCPDLAVVLLKSNIADTLCYLLVGTSETASQGVELVTRTPQELYEIVCLIGELMPSLP-NDGVFSVDSLLRKGCTTNTDAVI--------WQWRD---DRGIWHPYSLIDSRIIEASHQSGEDEVSLSTMGRNYSIDFNSMQQINEDTGTSRPVQRKLNPLAAHGSAAASNNCGVVRSDSRAEILKEDM------DL-----ASSFIKALFAVLYEVYSSSAGPAVRHKCLQAILRMVY 1070          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Cavefish
Match: trip12 (thyroid hormone receptor interactor 12 [Source:NCBI gene;Acc:564866])

HSP 1 Score: 385.956 bits (990), Expect = 1.602e-108
Identity = 225/533 (42.21%), Postives = 311/533 (58.35%), Query Frame = 3
Query: 5160 LETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LE  L LLR L +++R+W  L  N  C  +I  +EF + KL++KANRQLQD   ++  N+P W  +L   C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            S+    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  I S DL  IDP +A  ++ L D++ +K  ++ D++ ++   + A E L      VEDL + F  P +  IEL K G +  VT+H+L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E    WDVKTL E C  DHGYT +SR++  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1136 LEVIL-LLRVLHSISRYWFYLYENAVCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINREELLKQAESVM-QDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLANPKGSQEGTKYMFSS-RGLFAVPFGRSTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHESSISSFDLVNIDPGVAKSIQHLEDIIRQKRRLEQDQSHTRETLQLALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVPVTIHNLEEYLRLVVYWTLNEGVSRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---TWDVKTLMECCRPDHGYTHDSRAVRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1659          

HSP 2 Score: 217.624 bits (553), Expect = 3.862e-56
Identity = 141/475 (29.68%), Postives = 246/475 (51.79%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  D+ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PP++S      +++M +++C+NC  LAV L+KQNI +T+   +C +         +   RS +E+  L +LI ELMP LP+ E +F ++ ++            + +     W W +    + + HP N    +++E + Q+ + EIS  + G     +   MQQ +   GT     ++R  +          +++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:   93 ATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-DIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASRDLLTNIQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPSLAVQLMKQNIAETLRFLLCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPR-EGIFAVDAMLK--------KGSAHTAEGAVWQWRD---DRGLWHPYNRIDSRIIETAHQNGEDEISLSTLGRVYTIDFNSMQQINEDTGT--ARGIQRKPNPLANPNTGGHLEVRGEDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 540          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Cavefish
Match: hectd1 (HECT domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030616-153])

HSP 1 Score: 126.331 bits (316), Expect = 2.987e-28
Identity = 89/287 (31.01%), Postives = 141/287 (49.13%), Query Frame = 3
Query: 5877 PLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL------------GVEDLLIVF-------VHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            P  P +Y  +L  E      D   ++P  A  LK + DL  K+  I  +K++S+  K    ++L             VEDL + F       VH  ++ ++L  +G + +VT+ +   Y++L+ +  +  G++ QME   EGF+ + P   M   + F   E++ I CG +     A D+   TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   IV K +     D   PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct: 2319 PKPPAWYHGILTWE------DFELVNPHRARFLKEMKDLAVKRRQILGNKSLSEDEKNTRLQDLMLKNPMGSGPPLSVEDLGLNFQFCPSSKVHG-FSAVDLKPNGDDEMVTMENAEEYVELMFDFCMHTGIQKQMEAFREGFNRVFP---MEKLSSFSHKEVQMILCGNQSPSWTAEDIVNYTEP---KLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTIVRKVDA---TDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 2589          

HSP 2 Score: 110.538 bits (275), Expect = 2.232e-23
Identity = 71/242 (29.34%), Postives = 122/242 (50.41%), Query Frame = 3
Query: 5253 SENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTT-----------SEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYK 5900
            S  EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ FF    F  +R +++L+       +    STT             ++  RV+V R + +++ +E +++   D + +LE+ F  E G GLGPT EFY  V+    ++ L +W    +  DD          L PP        GL+P P    + +L+ ++   F+FLG  +A+ + D R +D+P++  F+K
Sbjct: 2017 SPEEFTSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLFFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRRETMMEWAESVMQIHADKKSVLEVEFQGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFPDDESRQVDLGGGLKPPGYYVQRSCGLFPAPFPQDNDELE-RITKLFLFLGIFLAKCIQDNRLVDLPISQPFFK 2257          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Cavefish
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:103022206])

HSP 1 Score: 116.316 bits (290), Expect = 1.402e-25
Identity = 94/296 (31.76%), Postives = 137/296 (46.28%), Query Frame = 3
Query: 5817 FVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPL--YTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRAL---RPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQN 6689
            F F+GR +A AL   + +D   +  FYK +L +   +   DL  IDP   N L          I I          K+   EE G+E    V    L   T  EL  +G +  VT  +   Y+ LVA   L  GV  Q +   EGF+ +LP   +     F++ E+E + CG +  D   W   T+         YT  ++ I+  ++++ +   E+R   +QF TGT RLPVGGF  L     P K   +K G E   N+LP   TC N L LP Y S E ++++LL+A+ E + 
Sbjct:  515 FRFIGRFIAMALFHGKFIDTGFSQPFYKRILNKP--LGLGDLESIDPEFYNSL----------IWI----------KENNIEECGLEMFFSVDKDILGEITTHELKPEGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQY---FDAKELEVLLCGMQEIDLADWQRNTIY------RHYTRGNKQIVWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKTGKE---NWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEG 776          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Cavefish
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:103022206])

HSP 1 Score: 116.316 bits (290), Expect = 1.642e-25
Identity = 94/296 (31.76%), Postives = 137/296 (46.28%), Query Frame = 3
Query: 5817 FVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPL--YTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRAL---RPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQN 6689
            F F+GR +A AL   + +D   +  FYK +L +   +   DL  IDP   N L          I I          K+   EE G+E    V    L   T  EL  +G +  VT  +   Y+ LVA   L  GV  Q +   EGF+ +LP   +     F++ E+E + CG +  D   W   T+         YT  ++ I+  ++++ +   E+R   +QF TGT RLPVGGF  L     P K   +K G E   N+LP   TC N L LP Y S E ++++LL+A+ E + 
Sbjct:  609 FRFIGRFIAMALFHGKFIDTGFSQPFYKRILNKP--LGLGDLESIDPEFYNSL----------IWI----------KENNIEECGLEMFFSVDKDILGEITTHELKPEGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQY---FDAKELEVLLCGMQEIDLADWQRNTIY------RHYTRGNKQIVWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKTGKE---NWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEG 870          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Cavefish
Match: itcha (E3 ubiquitin-protein ligase Itchy-like [Source:NCBI gene;Acc:103032591])

HSP 1 Score: 114.775 bits (286), Expect = 4.769e-25
Identity = 95/294 (32.31%), Postives = 135/294 (45.92%), Query Frame = 3
Query: 5817 FVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRAL---RPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQN 6689
            F F+GR +A AL   + +D   +  FYK +L +   +   DL  IDP   N L          I I  +    Q  + E Y  +  E L  V  H      EL  DG N +VT  +   Y+ LVA   L  GV  Q +   EGF+ +LP   +     F++ E+E + CG +  D   W   T+         Y  +S+ II  ++ + +   E+R   +QF TGT RLPVGGF  L     P K   +K G E   N+LP   TC N L LP Y S E ++++L  A+ E + 
Sbjct:  588 FKFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPLAL--KDLESIDPEFYNSL----------IWIKENNL--QECELEMYFSVDKEILGEVTTH------ELKPDGGNILVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQY---FDAKELEVMLCGMQEIDLSDWQRNTIY------RHYARSSKQIIWFWQFVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKE---NWLPRSHTCFNRLDLPPYKSYEQLKEKLTLAIEETEG 849          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006830.1 (pep scaffold:Pmarinus_7.0:GL490676:124:5464:-1 gene:ENSPMAG00000006173.1 transcript:ENSPMAT00000006830.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 6.603e-39
Identity = 90/295 (30.51%), Postives = 152/295 (51.53%), Query Frame = 3
Query: 1116 FDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTK 1991
             D  EQ +  +E +SRRH +AVLQ G     L Y +F +       L + + C  ++   DF+ + D +  L+ RL   + K VE    CF RLV  FQ+DE  L+++A++ L  N+Q+LL+ SPPV+S      +++M+A++C +C  LA  L++QNI +T+   +C +  S +        RS +E+  L +LI ELMP LP++  +F ++ ++            + +    SW W +     W ++    C+++E +  S + EIS  + G     +   MQQ +   GT 
Sbjct:   12 MDVAEQALTALEMLSRRHSKAVLQAGGLAASLLYLEFFSISAHRNALAIAANCCQSVTTDDFHLVSDSLPLLSARLSHQDKKSVESACLCFTRLVDNFQHDEALLQQVAAHELLTNVQQLLVMSPPVLSSGMFIMVVRMLAVVCGHCPQLAARLMRQNIAETLSFLLCGTSDSSNQETIELVARSPQELYELTSLICELMPCLPRD-GIFGVDAMLK--------KGGAHTPDASSWQWRD-DRGAWHAYSHIDCRIIEAAHVSGEDEISLSTLGRVYTIDFNSMQQINEDTGTA 296          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Sea Lamprey
Match: ube3a (ubiquitin protein ligase E3A [Source:ZFIN;Acc:ZDB-GENE-041114-190])

HSP 1 Score: 109.383 bits (272), Expect = 5.517e-24
Identity = 105/369 (28.46%), Postives = 172/369 (46.61%), Query Frame = 3
Query: 5574 KNQNDPRVILEISFNNEAGFGLGP-TNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPD-NYLPSVMTCQNFLKLPDYSSKEVMRQRLLYAL 6674
            +N  D +  L + F  E G   G  + EF+  V   L   D+ ++     +              R  +     L+N+   +F  +G ++  A+ +   LDI    V Y+ ++G+    H  DL    P L    +SL DL+  +  +++D  I    +   ++  G          P+ TQ +L ++G +  VT  +   ++DL A   L + V  Q +    GF   +  +   L ALF   E+E + CG RV D  A     L +    D G+  +SR I + ++ + DF ++++R F+QF TGT R PVGG   L    K++  K G   PD + LP+  TC N L LP+YSS+E +++RLL A+
Sbjct:  538 ENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEELFNPDIGMFTFDEST--------------RLFWFNPSSLENE--GQFTLIGIVLGLAIYNNCILDIHFPMVVYRKLMGKRGTFH--DLADSHPAL---YQSLKDLLAYEGSVEDD--IMATFRISYFDMFGT---------PI-TQ-DLKENGEDIPVTNDNKKEFVDLYAEYILNQSVEKQFKAFRRGFH--MVTSESPLKALFRPEEVELLVCGSRVLDFHA-----LEDATEYDGGFNKSSRVIRDFWDTVHDFCEDKKRLFLQFTTGTDRAPVGGLGKL----KMIIAKNG---PDSDRLPTAHTCFNVLLLPEYSSREKLKERLLKAI 858          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Sea Lamprey
Match: wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-000607-82])

HSP 1 Score: 105.531 bits (262), Expect = 8.595e-23
Identity = 88/296 (29.73%), Postives = 134/296 (45.27%), Query Frame = 3
Query: 5817 FVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPL--YTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRAL---RPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQN 6689
            F F+GR +A AL   + +D   +  FYK +L ++  I   DL  IDP   N L  L D                       EE G+E    V +  L   +  +L  DG++ +VT  +   Y+ L+       GV  Q +  ++GF  ++P   +     F+  E+E + CG +  D   W   T+         Y  +S+ I   ++++ +   E+R   +QF TGT RLPVGGF  L     P K   +K G E    +LP   TC N L LP Y S E ++++LLYA+ E + 
Sbjct:  667 FRFIGRFIAMALYHGKFIDTGFSLPFYKRMLNKKLTI--KDLESIDPEFYNSLIWLRD--------------------NNIEECGLEMFFSVDMELLGKVSSHDLKPDGSDILVTEENKEEYIGLMTEWRFSRGVEEQTKAFLDGFSEVVP---LQWLLYFDERELEVMLCGMQEIDLADWQRSTIYR------HYNRSSKQISWFWQVVKEMDNEKRLRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIEKVGKE---TWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEG 928          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Sea Lamprey
Match: AREL1 (apoptosis resistant E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:20363])

HSP 1 Score: 99.3673 bits (246), Expect = 3.140e-21
Identity = 108/389 (27.76%), Postives = 169/389 (43.44%), Query Frame = 3
Query: 5577 NQNDPRVILEISFNNEAGFGLG-PTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFL-GRLMARALLDCRKLDIPLNPV---FYKWVLGQEECIHSADLYYI----DPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQME-----CVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFL 6701
            + ND     E++F NE     G P  E++  +   L +    L+    + +   V P P     RP         + MR +   L GRL+ + L +    D     V   F +  L Q   +H   LY+     DP      K+    V    + + D T+S+    E Y+E G           L   ++L+  G+   VT  +   YL+++A   L   VR ++E       I+G + ++P    +L A+F+ +E+E + CG   ED    D K           +    + I+  + ++S FT+E+    +QF TG+  LP GGF AL PPF+IV+  + G      LP+  TC N L LP Y S E + + L YA+ EG   F L
Sbjct:  265 SSNDWFRSFEVTFENEEALDRGGPRREWFELMCKALFEPANKLFTHFVDDNQALVHPNPH----RP---------HHMRLRLYELAGRLVGKCLFETSLGDTYRQLVRARFTRSFLAQLIGLHVRFLYFYFETDDPEF---YKTKVSFVLNNDVSEMDLTLSE----EVYDEQG----------KLSQLVDLVPGGSGIGVTNANKLAYLNVLAQYRLATQVRTEVEHFLKVLSIKGLNEMVP---ENLLAIFDENELEMLMCG--TEDISVDDFKA--NAVLVGASWHFRKKVILWFWAVVSSFTQEELARLLQFSTGSSLLPTGGFAALSPPFQIVSSPKHGT-----LPTAHTCFNQLCLPTYDSCEELHKMLRYAITEGSEGFGL 611          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Sea Lamprey
Match: ube3c (ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-GENE-040426-1211])

HSP 1 Score: 94.7449 bits (234), Expect = 1.857e-19
Identity = 85/323 (26.32%), Postives = 141/323 (43.65%), Query Frame = 3
Query: 5757 LYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQL---KSLHDLVEKKIL----IDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LYP P       + +     + FLGR++ +AL +   +++P    F   +LG    +    L  +DP +   L   KS    VE+  L    ++N+   +QV                         +EL   G +  VT  +   Y+ LVA+  L   +R       +G  +++    +    +F+  E++ +  G +V      D++ L        GYT +   I   + ++  FT EQ+R  ++F T   R P+ GF+ L P F + N   GG +P+  LP+  TC N LKLP++  +E M  +LLYA+ E    F LS
Sbjct:  808 LYPNP--EARLLVGDGFTRHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTTGDVDIHHLASLDPEVYRNLLFLKSYQGDVEELGLNFTVVNNELGEAQV-------------------------VELKAGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLATVI---NLEWLRMFDEQELQVLLSGAQV----PIDLQDLKNFTNYSGGYTADHPVIKVFWHVVEGFTDEQKRKLLKFVTSCSRPPLLGFKELFPAFCVHN---GGADPER-LPTASTCMNLLKLPEFLEEETMHGKLLYAI-ESAAGFELS 1091          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Yeast
Match: UFD4 (Ubiquitin-protein ligase (E3); interacts with Rpt4p and Rpt6p, two subunits of the 19S particle of the 26S proteasome; cytoplasmic E3 involved in the degradation of ubiquitin fusion proteins; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000001493])

HSP 1 Score: 243.432 bits (620), Expect = 4.859e-65
Identity = 180/521 (34.55%), Postives = 265/521 (50.86%), Query Frame = 3
Query: 5217 VLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRM---RVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESH---------DDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV------------LGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNK-KEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            +L F  +C   +  + F + KLS+K  RQL +   V +  LP W + L     FLF  +TR  F    +F   R +   +  S    D   D    ++ R+   +++++R        ++L K  + P V LEI +  EAG GLGPT EFY+ VS    +  L +W  +S S+         DDY+      L+P P+   S   + K+   F +LG  +AR+LLD R LD   + VF++ +               E C+   +L  +DP+LA   KSL  +V  K   D++ T+              E L + F  P    IELI  G N+ +   ++  Y+  V +  L +G+  Q++  IEGF  +    RM +  LF   E+ +IF  GRVE++  W + TL      +HGYTM+S  I +   I+S F K +RR F+QF TG+P+LP+GGF++L P F +V K  E G   D YLPSVMTC N+LKLP Y+SK++MR RL  A+ EG  AF LS
Sbjct: 1000 LLDFLHSCG--VKSDSFINSKLSAKLARQLDEPLVVASGALPDWSLFLTRRFPFLFPFDTRMLFLQCTSFGYGRLIQLWKNKSKGSKDLRNDEALQQLGRITRRKLRISRKTIFATGLKILSKYGSSPDV-LEIEYQEEAGTGLGPTLEFYSVVSKYFARKSLNMWRCNSYSYRSEMDVDTTDDYI---TTLLFPEPLNPFSN--NEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIEL--VDPLLA---KSLKYIVANK---DDNMTL--------------ESLSLTFTVPGNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLI--LF-PDELVDIF--GRVEED--WSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLPKYTSKDIMRSRLCQAIEEGAGAFLLS 1483          

HSP 2 Score: 51.6026 bits (122), Expect = 1.661e-6
Identity = 29/105 (27.62%), Postives = 54/105 (51.43%), Query Frame = 3
Query: 1023 LLHLMEALPRSSDYLVTS--LGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENL 1331
            + +L E  P S    V    + +   K+  +   D  EQ++  +E ISR HG+ +L+ G  +I + ++DFLT   Q   + +VS   ++++  DF  I++ +  L
Sbjct:  244 MYNLFEVCPESISIAVDEHVIPILQGKLVEISYIDLAEQVLETVEYISRVHGRDILKTGQLSIYVQFFDFLTIHAQRKAIAIVSNACSSIRTDDFKTIVEVLPTL 348          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Yeast
Match: HUL5 (Multiubiquitin chain assembly factor (E4); proteasome processivity factor that elongates polyUb chains on substrates, opposing Ubp6p, a branched polyubiquitin protease; required for retrograde transport of misfolded proteins during ERAD; required for ubiquitination of a subset of cytosolic misfolded proteins upon heat shock [Source:SGD;Acc:S000003109])

HSP 1 Score: 109.383 bits (272), Expect = 3.198e-24
Identity = 98/363 (27.00%), Postives = 168/363 (46.28%), Query Frame = 3
Query: 5613 FNNEAGF-GLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFV-FLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSA--DLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQ--IELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEG 6683
            F  EAG  G G T EF T VS    K      + +++ ++         LYP  +Y  +K        K++ FLG+++ + L +   +D+     F K +L       S+  DL   D +L N L  L ++                      +E+   DL      P  +   ++LI +G+   VT  ++ LY+  V +  L +     +     G   ++     H   +F S E++ +  G R ++    D+K+ TE      GY    ++I++ +E++++F  E++ +F++F T  P+ P+ GF+AL P F I N   G E     LP+  TC N LKLPDY +K ++R++LLYA++ G
Sbjct:  590 FGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTNDRYE---------LYPSVVYDATKL-------KYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTT--------------------DEIKSLDLTFEIDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAP---HWMEMFNSIELQMLISGER-DNIDLDDLKSNTEYG----GYKEEDQTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAPLQGFKALDPKFGIRNA--GTEK--YRLPTASTCVNLLKLPDYRNKTILREKLLYAINSG 904          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Yeast
Match: TOM1 (E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators; involved in degradation of excess histones; interacts with Dia2p and is required for Dia2p degradation; required to target Cdc6p for ubiquitin-mediated destruction during G1 phase [Source:SGD;Acc:S000002865])

HSP 1 Score: 93.5893 bits (231), Expect = 4.019e-19
Identity = 103/377 (27.32%), Postives = 164/377 (43.50%), Query Frame = 3
Query: 5601 LEISFNNEAGFGLGP-TNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAG---LYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRP-----PFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LEI+F  E+G   G  T E+Y  +S  +   D  L+           LP P+     +P    +++  ++ +  + F F+G ++ +A+ D   LD   +   YK +LG+   +   D+  +DP   +  KSL  ++E  I    ++T S   + + Y E  V              I LI+ G + +VT  +   Y+  V    L   V+ QM+  + GF +L+      L  +F+  E+E +  G    D   W   T T V      YT   + +   +  +  F  E+R   +QF TGT ++P+ GF+ L        F I       E     LPS  TC N L LP Y S E +R  LL A++EG   F L+
Sbjct: 2941 LEITFKGESGVDAGGVTREWYQVLSRQMFNPDYALF-----------LPVPSDKTTFHP----NRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREVYKNILGRP--VSLKDMESLDP---DYYKSLVWILENDITDIIEETFSV--ETDDYGEHKV--------------INLIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISK---DLITIFDEQELELLISGLPDIDVDDWKNNT-TYV-----NYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKVPLNGFKELSGVNGVCKFSIHRDFGSSER----LPSSHTCFNQLNLPPYESYETLRGSLLLAINEGHEGFGLA 3268          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Yeast
Match: RSP5 (NEDD4 family E3 ubiquitin ligase; regulates processes including: MVB sorting, the heat shock response, transcription, endocytosis and ribosome stability; ubiquitinates Sec23p, Sna3p, Ste4p, Nfi1p, Rpo21p and Sem1p; autoubiquitinates; deubiquitinated by Ubp2p; regulated by SUMO ligase Siz1p, in turn regulates Siz1p SUMO ligase activity; required for efficient Golgi-to-ER trafficking in COPI mutants; mutant tolerates aneuploidy; human homolog implicated in Liddle syndrome [Source:SGD;Acc:S000000927])

HSP 1 Score: 88.1965 bits (217), Expect = 9.760e-18
Identity = 97/367 (26.43%), Postives = 163/367 (44.41%), Query Frame = 3
Query: 5601 LEISFNNEAGFGLGP-TNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLP--PPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVE-DNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALR---PPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            L I F+ E G   G  + EF+  +S  +      L+  S+  +D+Y +   P +G+ P  +            N F F+GR++   +   R LD       YK +L ++  +   D+  +D  + N   SL+ ++E  I    D T S     E + E+                ++L  DG N  VT  +   Y++L     +++ V+ Q +  ++GF+ L+P     L  +F+  E+E +  GG  E D + W      +  T   GY  +   I   ++ +S++  EQR   +QF TGT R+PV GF+ L+    P +   +K G       LP   TC N + LP Y   + M+Q+L  A+ E
Sbjct:  484 LMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSA--YDNYTIQINPNSGINPEHL------------NYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQ--DMEGVDAEVYN---SLNWMLENSIDGVLDLTFSA--DDERFGEV--------------VTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIP---EDLVTVFDERELE-LLIGGIAEIDIEDW------KKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAG---EVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEE 802          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Yeast
Match: HUL4 (Protein with similarity to hect domain E3 ubiquitin-protein ligases; not essential for viability; found in association with Trf4 in TRAMP complex [Source:SGD;Acc:S000003797])

HSP 1 Score: 73.559 bits (179), Expect = 2.926e-13
Identity = 89/377 (23.61%), Postives = 162/377 (42.97%), Query Frame = 3
Query: 5574 KNQNDPRVILEISFNNEAGFGLGPTNE--FYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFF 6698
            ++Q D    L I F NE G   G   +  F+    +     + +  Y+   S   + + PP        + KSK  ++++   ++F G +M  A+ +   LD+      YK +    E +   D   + P  +  L  + +  E     DN + +  +  +  Y       L        Y  +EL ++G N  +T  +   ++       L + +  Q    + GF  +   A  +   LF S E+E + CG   E+   +D K+L  V     G++ +SR++   +EI+  +    ++  +QF T + R+P  G   +  PFKI     G  + D+ LP   TC N + L +YSSK+ +  +LL+A++E +   F
Sbjct:  540 EHQGDLLKSLRIEFVNEPGIDAGGLRKEWFFLLTKSLFNPMNGLFIYIKESSRSWFAIDPPN-------FDKSKGKNSQLELYYLF-GVVMGLAIFNSTILDLQFPKALYKKLCS--EPLSFEDYSELFPETSRNLIKMLNYTE-----DNFEDVFSLTFETTYRN-NNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVF--AECNSIKLFNSEELERLVCGD--EEQTKFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVTASDRIPATGISTI--PFKI--SLLGSHDSDD-LPLAHTCFNEICLWNYSSKKKLELKLLWAINESEGYGF 891          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Nematostella
Match: EDO35037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SML1])

HSP 1 Score: 372.859 bits (956), Expect = 5.519e-105
Identity = 214/537 (39.85%), Postives = 317/537 (59.03%), Query Frame = 3
Query: 5142 FTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYL-EGASNQDSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVS------SESHDDYV--LPPPAGLYPRPIYSKSK-KLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            F+++      + L+R +  +N +  +L   +N  +L+S  EF +QKL++K  RQLQD  +V+  N P W ++L   C+FLF  E RQ  F+  +FDR R +  L E   +  +    D     + R +  V+R D L    +++ ++    + ILEI + +E G GLGPT EFY  VS    +S + +W  +      +E  D  +  +   +GL+P PI   ++  + +++++KF FLGR + RALLD R +DIP +  FYKW+LG E      DL+ IDP+LA  +  L  LV +K  ++ D +++    + A E L      VEDL + FV P YT IEL K+G N  VT+H+L  Y+ LV + +L+EGV  QM+   EGFDS+ P   + +   + +  ++++ CG      Q W+VK L E C  DHGY+ +SR+I  LFEI+S++  +Q+R F+QF TG+PRLPVGGFR+L PP  IV K  E   + DNYLPSVMTC N+LKLPDY+SKE+M  +L  A HEGQ +F LS
Sbjct: 1056 FSLTDPSLEIICLMRAIHILNNNAAMLFEEMNSRSLVSVGEFANQKLAAKVLRQLQDPIAVMTGNFPSWVLELPRKCSFLFPFECRQQLFFCTSFDRERAMSKLQESIPDLINTEMSDRVAPRLDRKKSTVSRKDLLSQAEKII-QDLGSSQSILEIQYQSEVGTGLGPTLEFYALVSKEFQRSSMEMWRGTEVAPPVTEDADGGIKYVYSESGLFPIPIPRNARVAMVSRLKSKFRFLGRFLGRALLDFRMVDIPFSCAFYKWMLGFEATFDYRDLFDIDPVLAKSISQLQGLVRQKHRLEKDSSLTPESLQLAVENLTLDGASVEDLGLDFVLPGYTNIELKKNGRNIPVTIHNLEKYIKLVVHWTLVEGVERQMQAFQEGFDSVFPLTNLKV---YYAVNMDQLLCGSV---GQKWEVKELVESCRPDHGYSHDSRAIKCLFEILSEYDADQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFEPPLSADNYLPSVMTCVNYLKLPDYTSKEIMLDKLRTAAHEGQRSFHLS 1585          

HSP 2 Score: 179.874 bits (455), Expect = 4.106e-45
Identity = 136/472 (28.81%), Postives = 230/472 (48.73%), Query Frame = 3
Query:  852 DRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVIS--DIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCN----NRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLS----EQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRM 2237
            D +Q+   + E+ Q L++  E+SL    V ++   ++NL+   ++   +L N     L ++ME+LPRS+  +V ++ +FL K+  +   D  EQ +  +E +S+RH +++LQ G     L + DF +   Q + L + S C +++ P DF+YI D I++          K VE     F RLV +FQ+D+  L+ LA + L  N+Q+LL+ SPP+IS      +++M+A LC NC  LAV ++K NI  T+  +   +      I+N N     RS +E   +   I+EL P LP+   +F ++ ++N +            +TE   + +      W S+    C+++E + QS + E+S  + G     +   +QQ +   GT             R  Q+       + L L S    EQ  R E   L D  +       LF  L +I N +    VR+KC+ AM+R+
Sbjct:   28 DESQQLQAVIEMCQLLVMGNEESLAGFPVKQVVPALINLLN--KEQKFELVNHACRALTYVMESLPRSTVVVVEAVPVFLEKLQVIECMDVAEQSLTALETLSKRHSKSILQAGGLASCLLFLDFFSISAQRSALAIASNCCSSVGPDDFHYIEDAIQD---------KKSVESCCLAFSRLVDSFQHDKAHLEDLAGHGLLTNIQQLLMISPPLISTATFVMVLRMLASLCANCPKLAVQMIKNNIADTLKFL---LVGTLDIINNENVELIARSPQEFYEITCFISELFPQLPKT-GVFSVDALLNKS----------QLRTELGLWQWRDDRGTWHSYSWIDCKIIEAAFQSGEDELSLSTMGRSYTIDFNALQQINEDTGTT------------RPIQRCAGAGESTSLTLQSGSNTEQDERIEI--LQDGPDGNAFTHVLFACLYNIMNSSVGVAVRHKCINAMLRL 460          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Nematostella
Match: EDO49327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD5])

HSP 1 Score: 102.449 bits (254), Expect = 6.450e-23
Identity = 86/296 (29.05%), Postives = 131/296 (44.26%), Query Frame = 3
Query: 5817 FVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPL--YTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRAL---RPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQN 6689
            F F+GR +A AL   + +D      FYK +L ++  +   DL  IDP   N L  +                    K+   EE G+E    V +  L   T  +L   G +  VT  +   Y+ L+    L  G+  Q    +EG   +LP   ++    F+  E+E + CG +  D + W   T+         YT NS+ ++  ++ +  +  E+R   +QF TGT RLPVGGF  L     P K   +K G E    +LP   TC N L LP Y S E + ++L +A+ E + 
Sbjct:   99 FKFIGRFIAMALYHGKFIDRGFTLPFYKRMLNKK--LLMKDLETIDPEFYNSLVWV--------------------KENNIEECGLEMFFTVDMELLGKVTSHDLKPGGTDIAVTEENKEEYISLMTEWRLNRGIEEQTRAFLEGMHEVLP---LYWIQYFDERELELMLCGMQEIDVEDWQQNTVY------RHYTRNSKQVMWFWQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTELMGDNGPQKFCIEKVGKE---TWLPRSHTCFNRLDLPPYKSYEQLVEKLTFAIEETEG 360          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Nematostella
Match: EDO40462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S732])

HSP 1 Score: 95.1301 bits (235), Expect = 1.796e-19
Identity = 84/299 (28.09%), Postives = 132/299 (44.15%), Query Frame = 3
Query: 5814 KFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQI-------ELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQN 6689
            +F  +G ++  A+ +   LDI    V Y+ + G+   +   DL    P+L   L  L                        YE    EDL+  F    YT +       EL  +G +  VT  +   Y++L A+  L + V  Q      GFD ++  + + +   F   E+E + CG +      +D   L +    D G T +S  I   +EI+  F  EQ+R  + F TG+ R+PVGG   L    K++  K G ++P   LP+  TC N L LPDY++KE + +RLL A+   + 
Sbjct:  533 QFCLIGLVLGLAIYNNIILDIHFPMVVYRKLFGKPGTVE--DLKDSHPVLYMSLTELL----------------------TYEGNVEEDLMCTF-KIGYTDVFGSDLTHELKANGESIPVTKENRQEYVNLHADFILNKSVEKQFTAFKRGFDMVVDESPLKI--FFRPDEVEMLVCGSK-----DFDFDALEKATEYDGGLTKDSALIRWFWEIVHSFDMEQKRQLLMFTTGSDRIPVGGLAKL----KLIIAKNGPDSP--RLPTAHTCFNVLLLPDYATKEKLEERLLKAITHAKG 793          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Nematostella
Match: EDO49383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG94])

HSP 1 Score: 90.1225 bits (222), Expect = 6.305e-19
Identity = 100/365 (27.40%), Postives = 157/365 (43.01%), Query Frame = 3
Query: 5601 LEISFNNEAGFGLG-PTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLP-PPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALR---PPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            LEI F  E G   G P  EF+  +S  +      L+  S+  +D Y +   P  LY          +DN     F F GR++   ++    LD      FYK +L +  C    DL  ++ + A   +S+  ++E  I    D T S    +E + ++              T+ ELI  G +  VT  +   Y+  +    +  GV  QME ++ GF+ ++  A   L  +F++ E+E +  G    D + W   T         GY  N + +   ++ +S F  EQR   +QF TGT  +P  GF ALR    P K   ++ G       LP   TC N L +P Y S + + ++L YA+ E
Sbjct:   13 LEIQFAGEEGLDYGGPAREFFFLISRQIFNPYYGLFEYSA--NDTYTVQVSPVSLY----------VDNS-HEWFRFCGRIVGLVIIHQHLLDAFFTRTFYKALL-RSLC----DLSDVEALDALFHQSMTWVIENDIEDVLDLTFSV--SEEIFGQV--------------TERELIPGGKDIAVTEQNKGDYVAEMVKWRVERGVSEQMESIVRGFNEVIDPA---LVNIFDARELELVISGTADIDIKDWRRNT-----EYRSGYHDNHKVVKWFWKAVSSFDNEQRLRLLQFVTGTSSIPYEGFAALRGSTGPRKFSIERWGDYTK---LPRAHTCFNRLDMPIYRSYDELLEKLTYAVEE 332          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Nematostella
Match: EDO30268 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T196])

HSP 1 Score: 86.6557 bits (213), Expect = 6.932e-17
Identity = 64/198 (32.32%), Postives = 100/198 (50.51%), Query Frame = 3
Query: 6117 IELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCG-GRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLF-EIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            +EL+  G    VT  +   YL+L+A   L+E V+ ++E  I+G + L+P    +L  +F+ +E+E + CG G +      D+K    V     G       I++ F  I+S  T+E+    +QF TG+ +LP GGF  L P  +I             LP+  TC N L LPD+ S   M+++LL A++EG   F  S
Sbjct:  578 VELLPGGRLIDVTEQNKCEYLNLMARYKLVESVQKEVEAFIQGLNELVPD---NLLGMFDENELELLMCGTGHI---SVADMKAHHHVLA---GGGQRFTKIMDWFWTIVSSLTQEELARLLQFVTGSSQLPPGGFAELSPQLQISYIAT-----SQALPTAHTCFNQLCLPDFPSFNEMQRKLLLAVNEGCEGFGFS 761          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Medaka
Match: trip12 (thyroid hormone receptor interactor 12 [Source:NCBI gene;Acc:101175421])

HSP 1 Score: 392.889 bits (1008), Expect = 5.534e-110
Identity = 220/527 (41.75%), Postives = 312/527 (59.20%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W  L  +  C  +++ NEF + KL++KANRQLQD   ++  N+P W ++L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            ++    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  + S DL  IDP +A  ++ L D++ +K  ++ D++ ++   ++A E L      VEDL + F  P +  IEL K G +  VT+++L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E    WDVKTL E C  DHGYT +SR+I  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1462 LLRVLHAISRYWFYLHESAACKEILTTNEFINSKLTAKANRQLQDPLVIMTGNIPTWLIELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINREELLKQAESVI-QDLGSSRAMLEIQYENEVGTGLGPTQEFYALVSQELQRADLGLWRGEEVTLTNPKGNQEGTKYMFSS-RGLFAVPFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHETSVSSHDLVNIDPGVAKSIQHLEDIIRQKKRLEQDRSQTRETLQQALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVAVTIYNLEEYLRLVVYWTLNEGVSRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---TWDVKTLMECCRPDHGYTHDSRAIRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 1980          

HSP 2 Score: 218.394 bits (555), Expect = 2.723e-56
Identity = 144/476 (30.25%), Postives = 246/476 (51.68%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  ++ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PPV+S      +++M +++C+NC  LAV L+KQNI +T+   +C +             RS +E+  L +LI ELMP LP+ E +F ++ ++            S   TE + W W +    + + HP N    +++E + Q+ + EIS  + G     +   MQQ +   GT     ++R  +           ++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  413 ATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-EIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQEVASRDLLTNIQQLLVVTPPVLSSGMFIMVVRMFSLMCSNCPSLAVQLMKQNIAETLRFLLCGASNGSCQEQIELVPRSPQELYELTSLICELMPCLPR-EGIFAVDVMLK---------KGSAQTTEGAIWQWRD---DRGLWHPYNRIDSRIIETAHQNGEDEISLSTLGRVYTIDFNSMQQINEDTGT--ARGIQRKPNPLSNPNTGSHQEVRREDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 860          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Medaka
Match: trip12 (thyroid hormone receptor interactor 12 [Source:NCBI gene;Acc:101175421])

HSP 1 Score: 392.889 bits (1008), Expect = 6.566e-110
Identity = 220/527 (41.75%), Postives = 312/527 (59.20%), Query Frame = 3
Query: 5178 LLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQ--DSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYV---------SSESHDDYVLPPPAGLYPRPIYSKSKKLD-NKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL-----GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKK-EGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            LLR L A++R+W  L  +  C  +++ NEF + KL++KANRQLQD   ++  N+P W ++L  +C F F  +TRQ  FY+  FDR R +  L   + +   SD+        + R +  +NR + L     ++ ++    R +LEI + NE G GLGPT EFY  VS  L ++DL LW            ++    Y+     GL+  P    +K     K++ KF FLG+LMA+A++D R LD+PL   FYKW+L  E  + S DL  IDP +A  ++ L D++ +K  ++ D++ ++   ++A E L      VEDL + F  P +  IEL K G +  VT+++L  YL LV   +L EGV  Q E   EGF+S+ P   +H    F   E++++ CG + E    WDVKTL E C  DHGYT +SR+I  LFE++S F  EQ+R F+QF TG+PRLPVGGFR+L PP  IV K  E  ENPD++LPSVMTC N+LKLPDYSS E+MR++LL A  EGQ +F LS
Sbjct: 1540 LLRVLHAISRYWFYLHESAACKEILTTNEFINSKLTAKANRQLQDPLVIMTGNIPTWLIELGKSCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINREELLKQAESVI-QDLGSSRAMLEIQYENEVGTGLGPTQEFYALVSQELQRADLGLWRGEEVTLTNPKGNQEGTKYMFSS-RGLFAVPFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPFYKWMLRHETSVSSHDLVNIDPGVAKSIQHLEDIIRQKKRLEQDRSQTRETLQQALESLNMNGCSVEDLGLDFTLPGFPNIELKKGGKDVAVTIYNLEEYLRLVVYWTLNEGVSRQFESFREGFESVFP---LHHLQYFYPEELDQLLCGSKSE---TWDVKTLMECCRPDHGYTHDSRAIRFLFEVLSSFDAEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLIAAREGQQSFHLS 2058          

HSP 2 Score: 219.164 bits (557), Expect = 1.936e-56
Identity = 144/476 (30.25%), Postives = 246/476 (51.68%), Query Frame = 3
Query:  843 AAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISD--IHEIIQMMAILCTNCSDLAVDLVKQNITQTI-LCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHS-WYWFNASSKQWVSHPQNV--CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKI---DSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIY 2243
            A GD +Q+     E+ Q L++  E++L    V  +   ++ L+Q  E N  ++ N     L ++MEALPRSS  +V ++ +FL K+  +   D  EQ +  +E +SRRH +A+LQ G     L Y +F +   Q   L + + C  ++ P +F+++ D +  LT RL   + K VE    CF RLV  FQ++E  L+++AS +L  N+Q+LL+ +PPV+S      +++M +++C+NC  LAV L+KQNI +T+   +C +             RS +E+  L +LI ELMP LP+ E +F ++ ++            S   TE + W W +    + + HP N    +++E + Q+ + EIS  + G     +   MQQ +   GT     ++R  +           ++   D+R +L+ E           D   A   I+ LF +L ++Y+ ++   VR+KCL A++R+IY
Sbjct:  491 ATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPALITLLQ-MEHNF-EIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQEVASRDLLTNIQQLLVVTPPVLSSGMFIMVVRMFSLMCSNCPSLAVQLMKQNIAETLRFLLCGASNGSCQEQIELVPRSPQELYELTSLICELMPCLPR-EGIFAVDVMLK---------KGSAQTTEGAIWQWRD---DRGLWHPYNRIDSRIIETAHQNGEDEISLSTLGRVYTIDFNSMQQINEDTGT--ARGIQRKPNPLSNPNTGSHQEVRREDARAQLMKE-----------DPELAKCFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIY 938          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Medaka
Match: hectd1 (HECT domain E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101168256])

HSP 1 Score: 186.037 bits (471), Expect = 2.512e-46
Identity = 149/542 (27.49%), Postives = 252/542 (46.49%), Query Frame = 3
Query: 5262 EFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTT-----------SEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWV-LGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGV------------------------------EDLLIVFVHPLYTQ------------IELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ +F    F  +R +++L+       +    STT             ++  RV+V R + +++ +E +++   + + +LE+ F  E G GLGPT EFY  V+    ++ L +W    +  DD          L PP        GL+P P    S++L+   R  F FLG  +A+ + D R +D+P++  F+K + +G  +   S  LY       ++      L E+  L+   +  S+   +E+ E   V                              +D  +V  H L  Q            ++L  +G + +V++ +   Y++L+ +  +  G++ QME   EGF+ + P   M   + F   E++ I CG +     A D+ + TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   IV K +     D+  PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct: 1766 EFSSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRGESMMEWAESVMQIHANRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFPDDESRQVDLGGGLKPPGFYVQRSCGLFPAPFPQDSEELERITR-LFHFLGIFLAKCIQDNRLVDLPVSQPFFKLLCMGDIKSNMSKLLYQ------SRGSPQGHLSERAPLLLLTEVQSEASTEESQETYSVGSFDEDSKSDFIMDPPKPKPPAWFHGIMSWDDFHLVNPHRLNFQFCPSSKIHGFFAVDLKPNGDDEMVSLENAEEYVELMFDFCMHAGIQKQMEAFREGFNRVFP---MEKLSSFSQKEVQMILCGNQSPCWTADDIISYTEP---KLGYTRDSPGFLRFIRVLCGMSTDERKAFLQFTTGCSTLPPGGLANLHPRLTIVRKVDA---TDSSYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 2291          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Medaka
Match: hectd1 (HECT domain E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101168256])

HSP 1 Score: 119.398 bits (298), Expect = 3.859e-26
Identity = 82/287 (28.57%), Postives = 143/287 (49.83%), Query Frame = 3
Query: 5877 PLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL------------GVEDLLIVF-------VHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            P  P ++  ++  +      D + ++P  A+ LK + +L  ++  I   K++S+  K    ++L             VEDL + F       +H  +  ++L  +G + +V++ +   Y++L+ +  +  G++ QME   EGF+ + P   M   + F   E++ I CG +     A D+ + TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   IV K +     D+  PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct: 2240 PKPPAWFHGIMSWD------DFHLVNPHRASFLKEVKELAVRRRQILTSKSLSEDEKNTRLQDLMLRNPLGSGPPLSVEDLGLNFQFCPSSKIHGFFA-VDLKPNGDDEMVSLENAEEYVELMFDFCMHAGIQKQMEAFREGFNRVFP---MEKLSSFSQKEVQMILCGNQSPCWTADDIISYTEP---KLGYTRDSPGFLRFIRVLCGMSTDERKAFLQFTTGCSTLPPGGLANLHPRLTIVRKVDA---TDSSYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 2510          

HSP 2 Score: 104.375 bits (259), Expect = 1.484e-21
Identity = 70/239 (29.29%), Postives = 120/239 (50.21%), Query Frame = 3
Query: 5262 EFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTT-----------SEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYK 5900
            EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ +F    F  +R +++L+       +    STT             ++  RV+V R + +++ +E +++   + + +LE+ F  E G GLGPT EFY  V+    ++ L +W    +  DD          L PP        GL+P P    S++L+   R  F FLG  +A+ + D R +D+P++  F+K
Sbjct: 1932 EFSSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRGESMMEWAESVMQIHANRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFPDDESRQVDLGGGLKPPGFYVQRSCGLFPAPFPQDSEELERITR-LFHFLGIFLAKCIQDNRLVDLPVSQPFFK 2169          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Medaka
Match: hectd1 (HECT domain E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101168256])

HSP 1 Score: 119.398 bits (298), Expect = 3.918e-26
Identity = 82/287 (28.57%), Postives = 143/287 (49.83%), Query Frame = 3
Query: 5877 PLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL------------GVEDLLIVF-------VHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHE 6680
            P  P ++  ++  +      D + ++P  A+ LK + +L  ++  I   K++S+  K    ++L             VEDL + F       +H  +  ++L  +G + +V++ +   Y++L+ +  +  G++ QME   EGF+ + P   M   + F   E++ I CG +     A D+ + TE      GYT +S   +    ++   + ++R+ F+QF TG   LP GG   L P   IV K +     D+  PSV TC ++LKLP+YSS+E+MR+RLL A  E
Sbjct: 2013 PKPPAWFHGIMSWD------DFHLVNPHRASFLKEVKELAVRRRQILTSKSLSEDEKNTRLQDLMLRNPLGSGPPLSVEDLGLNFQFCPSSKIHGFFA-VDLKPNGDDEMVSLENAEEYVELMFDFCMHAGIQKQMEAFREGFNRVFP---MEKLSSFSQKEVQMILCGNQSPCWTADDIISYTEP---KLGYTRDSPGFLRFIRVLCGMSTDERKAFLQFTTGCSTLPPGGLANLHPRLTIVRKVDA---TDSSYPSVNTCVHYLKLPEYSSEEIMRERLLAATME 2283          

HSP 2 Score: 103.99 bits (258), Expect = 1.717e-21
Identity = 69/239 (28.87%), Postives = 121/239 (50.63%), Query Frame = 3
Query: 5262 EFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTT-----------SEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYV--------LPPPA-------GLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYK 5900
            EF S+K+++K  +Q+++  ++ +  LP WC QL   C FL   ETRQ +F    F  +R +++L+       +    STT             ++  RV+V R + +++ +E +++   + + +LE+ F  E G GLGPT EFY  V+    ++ L +W    +  DD          L PP        GL+P P    S++L+ ++   F FLG  +A+ + D R +D+P++  F+K
Sbjct: 1705 EFSSKKITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRGESMMEWAESVMQIHANRKSVLEVEFLGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFPDDESRQVDLGGGLKPPGFYVQRSCGLFPAPFPQDSEELE-RITRLFHFLGIFLAKCIQDNRLVDLPVSQPFFK 1942          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Planmine SMEST
Match: SMESG000007808.1 (SMESG000007808.1)

HSP 1 Score: 4061.14 bits (10531), Expect = 0.000e+0
Identity = 2194/2212 (99.19%), Postives = 2196/2212 (99.28%), Query Frame = 3
Query:   69 MAGKHKQKRQVKDQTNKPLNTLPESNCTEPSTSDIVKRDIRSRKTEKINXXXXXXXXXXXPVXXXXXXXXXXXXDNPKVEKSEILLNSSSIDSDTGSQISKRRRREIRNTXXXXXXXXXXXXXXPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPXXXXXXXXXXXXXXXXXXXXXXXXXQDPXXXXXXXXXXXXXXXXXXXXXXNFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFXXXXXXXXXXXXXQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKEXXXXXXXXXXXXXXXXAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSNKTRGKQTNLXXXXXXXXXXXXXXXXXXXXXFRESGLKALASRRSTRQSQHDSESHAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFMSETILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSESISTFNFMASLMNSASQNNKPHPHLISTDQFHFDXXXXXXXXXXXXXXXXVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            MAGKHKQKRQVKDQTNKPLNTLPESNCTEPSTSDIVKRDIRSRKTEKINSRRISVIRSRSPVTSKSNKKTSKFKDNPKVEKSEILLNSSSIDSDTGSQISKRRRREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLTSQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSS KTRGKQTNLTKS+TGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSESHAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSE ILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSE+              SQNNKPHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS
Sbjct:    1 MAGKHKQKRQVKDQTNKPLNTLPESNCTEPSTSDIVKRDIRSRKTEKINSRRISVIRSRSPVTSKSNKKTSKFKDNPKVEKSEILLNSSSIDSDTGSQISKRRRREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLTSQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSKKTRGKQTNLTKSITGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSESHAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSEIILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSET--------------SQNNKPHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 2198          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Planmine SMEST
Match: SMESG000007808.1 (SMESG000007808.1)

HSP 1 Score: 3902.44 bits (10119), Expect = 0.000e+0
Identity = 2091/2110 (99.10%), Postives = 2094/2110 (99.24%), Query Frame = 3
Query:  375 RRREIRNTXXXXXXXXXXXXXXPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPXXXXXXXXXXXXXXXXXXXXXXXXXQDPXXXXXXXXXXXXXXXXXXXXXXNFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFXXXXXXXXXXXXXQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKEXXXXXXXXXXXXXXXXAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSNKTRGKQTNLXXXXXXXXXXXXXXXXXXXXXFRESGLKALASRRSTRQSQHDSESHAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFMSETILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSESISTFNFMASLMNSASQNNKPHPHLISTDQFHFDXXXXXXXXXXXXXXXXVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            +RREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLTSQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSS KTRGKQTNLTKS+TGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSESHAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSE ILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSE+              SQNNKPHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS
Sbjct:   10 KRREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLTSQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSKKTRGKQTNLTKSITGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSESHAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSEIILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSET--------------SQNNKPHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 2105          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Planmine SMEST
Match: SMESG000007808.1 (SMESG000007808.1)

HSP 1 Score: 3901.29 bits (10116), Expect = 0.000e+0
Identity = 2091/2110 (99.10%), Postives = 2094/2110 (99.24%), Query Frame = 3
Query:  375 RRREIRNTXXXXXXXXXXXXXXPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFXXXXXXXXXXXTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPXXXXXXXXXXXXXXXXXXXXXXXXXQDPXXXXXXXXXXXXXXXXXXXXXXNFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFXXXXXXXXXXXXXQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKEXXXXXXXXXXXXXXXXAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSNKTRGKQTNLXXXXXXXXXXXXXXXXXXXXXFRESGLKALASRRSTRQSQHDSESHAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFMSETILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSESISTFNFMASLMNSASQNNKPHPHLISTDQFHFDXXXXXXXXXXXXXXXXVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNXXXXXXXXXXXXXKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 6704
            +RREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLTSQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSS KTRGKQTNLTKS+TGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSESHAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSE ILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSE+              SQNNKPHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS
Sbjct:    3 KRREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSDTNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQFNMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQINKKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVSQCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQNDEVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVDLVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLPQNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNVCQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLTSQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCEIVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYIERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQRAELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEKINYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKKDVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINEALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSLVNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTEAVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECHFAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVMREIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPDDMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSKKTRGKQTNLTKSITGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSESHAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSEIILKPISKMQILIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWKSHHNIHYRPVCATNPSVYTSRQNFKSTNSET--------------SQNNKPHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQSSLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLPYPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLETTLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTFSVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASNQDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFNNEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPRPIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQEECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEELGVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVRAQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTLTEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGFRALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLYALHEGQNAFFLS 2098          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Planmine SMEST
Match: SMESG000017747.1 (SMESG000017747.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.142e-60
Identity = 152/163 (93.25%), Postives = 153/163 (93.87%), Query Frame = 3
Query: 1932 MCIDTNLILMQQTHVLNGTKVVSDLKRSRHQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRYKCLEAMIRMIYPXXXXXXXXXXXXXXXXXXXXXXXXXQDPXXXXXXXXXXXXXXXXXXXXXXNFKKEGVL 2420
            MCIDTNLILMQQTHVLNGTKVVS+LKRSRHQFRQSQKNCDIKIDSRLKLL EQC RFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVR K LEAMIRM YPTTNKTLNNV NKASLSSLMATLLTSQ PIIIINAIQMGII KKL PSLIINFKKEG L
Sbjct:    1 MCIDTNLILMQQTHVLNGTKVVSNLKRSRHQFRQSQKNCDIKIDSRLKLLLEQCLRFESSDLSDNVEAVELIRHLFPLLIDIYNEASSYQVRTKYLEAMIRMTYPTTNKTLNNVFNKASLSSLMATLLTSQVPIIIINAIQMGIIFKKLLPSLIINFKKEGEL 163          
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Planmine SMEST
Match: SMESG000019763.1 (SMESG000019763.1)

HSP 1 Score: 191.045 bits (484), Expect = 3.843e-54
Identity = 96/113 (84.96%), Postives = 103/113 (91.15%), Query Frame = 3
Query:  870 MLMSEINQHLLVSYEDSLNSLRVSELTTQVVNLIQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDFDSLEQIINVIERISRRHGQAVLQCGAFTII 1208
            +L+SEINQ+LLVSYEDSLN LRVSELTTQVVNLIQNCEDNLVDLKNICYNV LHL+EALPRSSDYLVTSLGMFLNKISNLFDFDS+EQII VI  I R HGQA+ QCG  T+I
Sbjct:  144 LLISEINQYLLVSYEDSLNLLRVSELTTQVVNLIQNCEDNLVDLKNICYNV-LHLIEALPRSSDYLVTSLGMFLNKISNLFDFDSVEQIICVIVIIYRCHGQAISQCGTLTVI 255          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIP125.123e-10841.70thyroid hormone receptor interactor 12 [Source:HGN... [more]
TRIP121.082e-10741.94thyroid hormone receptor interactor 12 [Source:HGN... [more]
TRIP121.342e-10741.94thyroid hormone receptor interactor 12 [Source:HGN... [more]
TRIP122.108e-3837.23thyroid hormone receptor interactor 12 [Source:HGN... [more]
HECTD14.775e-2729.72HECT domain E3 ubiquitin protein ligase 1 [Source:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hecd-13.968e-5529.76E3 ubiquitin-protein ligase hecd-1 [Source:UniPro... [more]
hecd-14.004e-5529.76E3 ubiquitin-protein ligase hecd-1 [Source:UniPro... [more]
hecd-14.072e-5529.76E3 ubiquitin-protein ligase hecd-1 [Source:UniPro... [more]
hecd-14.251e-5529.76E3 ubiquitin-protein ligase hecd-1 [Source:UniPro... [more]
hecd-14.321e-5529.76E3 ubiquitin-protein ligase hecd-1 [Source:UniPro... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctrip1.541e-7544.79gene:FBgn0260794 transcript:FBtr0334902[more]
ctrip1.567e-7544.79gene:FBgn0260794 transcript:FBtr0303917[more]
ctrip1.567e-7544.79gene:FBgn0260794 transcript:FBtr0303912[more]
ctrip1.679e-7544.79gene:FBgn0260794 transcript:FBtr0303915[more]
ctrip1.723e-7544.79gene:FBgn0260794 transcript:FBtr0301437[more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trip129.051e-11042.31thyroid hormone receptor interactor 12 [Source:NCB... [more]
trip129.396e-11042.31thyroid hormone receptor interactor 12 [Source:NCB... [more]
trip121.305e-10942.31thyroid hormone receptor interactor 12 [Source:NCB... [more]
hectd19.330e-2731.01HECT domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
hectd19.749e-2731.01HECT domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
braf6.018e-10942.18B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf6.988e-10942.18B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf7.142e-10942.56B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf7.506e-10942.18B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf7.939e-10942.18B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trip126.751e-11241.51thyroid hormone receptor interactor 12 [Source:MGI... [more]
Trip121.145e-10641.75thyroid hormone receptor interactor 12 [Source:MGI... [more]
Trip121.145e-10641.75thyroid hormone receptor interactor 12 [Source:MGI... [more]
Trip121.254e-10641.75thyroid hormone receptor interactor 12 [Source:MGI... [more]
Trip122.841e-5729.80thyroid hormone receptor interactor 12 [Source:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1RCR6|TRIPC_DANRE7.093e-10942.31E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio ... [more]
sp|B4F6W9|TRIPC_XENTR6.622e-10842.18E3 ubiquitin-protein ligase TRIP12 OS=Xenopus trop... [more]
sp|E1B7Q7|TRIPC_BOVIN3.116e-10742.13E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus O... [more]
sp|Q14669|TRIPC_HUMAN6.444e-10741.94E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens... [more]
sp|F1LP64|TRIPC_RAT1.800e-10641.94E3 ubiquitin-protein ligase TRIP12 OS=Rattus norve... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2R5J13.976e-11344.97Putative E3 ubiquitin-protein ligase OS=Sipha flav... [more]
A0A2D4H2B81.675e-11241.43HECT domain-containing protein OS=Micrurus coralli... [more]
A0A2D4NQK11.675e-11241.43HECT domain-containing protein OS=Micrurus surinam... [more]
A0A2D4J1F51.675e-11241.43HECT domain-containing protein OS=Micrurus lemnisc... [more]
A0A1S3K6577.096e-11243.16E3 ubiquitin-protein ligase TRIP12 isoform X4 OS=L... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trip121.602e-10842.21thyroid hormone receptor interactor 12 [Source:NCB... [more]
hectd12.987e-2831.01HECT domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
itchb1.402e-2531.76E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
itchb1.642e-2531.76E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
itcha4.769e-2532.31E3 ubiquitin-protein ligase Itchy-like [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006830.16.603e-3930.51pep scaffold:Pmarinus_7.0:GL490676:124:5464:-1 gen... [more]
ube3a5.517e-2428.46ubiquitin protein ligase E3A [Source:ZFIN;Acc:ZDB-... [more]
wwp28.595e-2329.73WW domain containing E3 ubiquitin protein ligase 2... [more]
AREL13.140e-2127.76apoptosis resistant E3 ubiquitin protein ligase 1 ... [more]
ube3c1.857e-1926.32ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UFD44.859e-6534.55Ubiquitin-protein ligase (E3); interacts with Rpt4... [more]
HUL53.198e-2427.00Multiubiquitin chain assembly factor (E4); proteas... [more]
TOM14.019e-1927.32E3 ubiquitin ligase of the hect-domain class; has ... [more]
RSP59.760e-1826.43NEDD4 family E3 ubiquitin ligase; regulates proces... [more]
HUL42.926e-1323.61Protein with similarity to hect domain E3 ubiquiti... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO350375.519e-10539.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493276.450e-2329.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404621.796e-1928.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493836.305e-1927.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302686.932e-1732.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trip125.534e-11041.75thyroid hormone receptor interactor 12 [Source:NCB... [more]
trip126.566e-11041.75thyroid hormone receptor interactor 12 [Source:NCB... [more]
hectd12.512e-4627.49HECT domain E3 ubiquitin protein ligase 1 [Source:... [more]
hectd13.859e-2628.57HECT domain E3 ubiquitin protein ligase 1 [Source:... [more]
hectd13.918e-2628.57HECT domain E3 ubiquitin protein ligase 1 [Source:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIP12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007808.10.000e+099.19SMESG000007808.1[more]
SMESG000007808.10.000e+099.10SMESG000007808.1[more]
SMESG000007808.10.000e+099.10SMESG000007808.1[more]
SMESG000017747.11.142e-6093.25SMESG000017747.1[more]
SMESG000019763.13.843e-5484.96SMESG000019763.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010017 ID=SMED30010017|Name=E3 ubiquitin-protein ligase TRIP12|organism=Schmidtea mediterranea sexual|type=transcript|length=6924bp
TCACTTTCATATTTATAATTTCGTTAATCAGCTGACAACAAACGTCTAAT
TTAAATTGCAATGCTCTTATGGCTGGAAAACACAAACAGAAACGGCAAGT
AAAAGATCAAACTAATAAACCATTGAATACTTTACCTGAATCTAATTGTA
CCGAACCATCAACTTCCGACATCGTTAAACGTGATATTCGAAGTAGAAAA
ACCGAAAAGATTAACTCTCGACGAATATCAGTAATTCGATCGCGTTCTCC
AGTAACTTCAAAATCTAATAAAAAAACGTCGAAATTCAAAGATAATCCAA
AAGTTGAAAAATCCGAGATATTACTAAACAGCAGTTCGATAGATTCCGAC
ACGGGAAGTCAAATAAGCAAGAGACGGCGCCGAGAAATTCGTAATACATC
TGTTGAACAGATAACAGAATCACAGAGTATATCATCACAACCAAACGAAA
CAGTTAAATCTCGGCGACGTCGAAGTCTCCTATCTCATATTGAAGATCAT
AAGGTCATATCTTCTGATACAAATATGGCCTCGTCCAGTTCTCAAAGAAC
AACAACAAATGATAGCACATCCCAGTTAAGTAACGACCAACCAAAAAATT
CCTTACCTTCAACCTCGCGAGGTAAAAGAAATAACACATCTAAGAATAAG
TCCAAATTTCCACAATTCAATATGTCTTCAGGTCGCGACCCCAGCATCTT
CCTATCAAATGATAATGCTTTCCAAGGAATAGTTTCAAGTGGTATGGACA
TATCACATTTTCAAAATTATTTAAGTTCACGATCTCTCGCTGCAACGGAA
ATCGGTGATCAGATAAACAAAAAATTAGATGAGTTGCATTCAGCAGCTGG
TGATCGAACTCAGGAATATATGCTCATGAGTGAAATAAATCAACATCTAC
TTGTCAGTTATGAAGACTCATTGAATTCACTGAGAGTATCTGAACTTACA
ACTCAAGTCGTGAATTTAATTCAGAACTGTGAAGATAATTTAGTTGACTT
GAAAAATATTTGCTATAATGTTCTTCTTCACTTAATGGAAGCACTACCTC
GAAGTTCTGATTATCTTGTCACATCATTGGGAATGTTTCTCAATAAAATA
TCAAATCTATTCGATTTTGATTCATTGGAACAAATTATCAATGTTATCGA
AAGAATATCCCGTCGCCATGGGCAAGCAGTTTTACAGTGTGGTGCATTTA
CGATTATTCTTAATTACTATGATTTTCTGACTGCCCCTCAACAACTAACA
ATCCTTAATATGGTCAGTCAGTGCTTTACAAATCTTAAACCTTCAGATTT
CAATTATATAATTGATGGAATAGAAAATCTTACAAACAGACTTAAGCAAT
CTGAACCAAAATGTGTTGAAAAAGTTATTCAATGTTTTGTAAGATTAGTC
AGTGCGTTCCAGAATGATGAAGTCAAATTAAAGAAATTAGCATCAAATAA
TTTATTTGTCAATCTACAAGAATTATTGATTTCATCTCCTCCTGTAATCT
CAGACATTCATGAAATAATCCAAATGATGGCGATATTGTGTACCAATTGT
TCTGATCTAGCAGTTGATCTGGTTAAACAAAATATTACCCAAACCATTCT
CTGTGTCTGTAACAGCATGACAAGTGATTCCACAACGATTAGTAATTGTA
ACAATCGATCTGTTGAAGAGATGTTATCTCTTGTAAATTTGATTGCTGAA
TTGATGCCGACCCTTCCACAAAATGAAGATCTATTTATAATTAATCGAGT
AATTAATCCAACTTTATTTTCACAATCTAAATCCTCAAAATCAATTTCAC
AAACGGAACACAGTTGGTATTGGTTCAATGCCAGTTCTAAGCAATGGGTG
TCACATCCACAAAATGTATGTCAGCTATTAGAGAAAAGTCTTCAATCATG
TGATTTTGAAATCAGTTGTCAGAGTAATGGAATGTGTATTGACACTAATT
TGATTCTAATGCAACAGACTCATGTTCTAAATGGAACTAAAGTCGTGAGC
GACCTGAAGAGATCAAGACACCAATTTAGACAATCACAGAAAAATTGTGA
TATCAAAATAGATTCCAGACTTAAGTTATTATCGGAACAATGTTCAAGAT
TTGAAAGTAGCGATCTATCAGACAATGTTGAAGCAGTTGAATTGATCCGT
CATCTTTTCCCATTATTAATAGACATTTATAATGAAGCCAGCAGTTATCA
AGTTCGATATAAATGCTTGGAAGCAATGATTAGAATGATATATCCTACAA
CTAATAAAACCCTTAATAATGTTTTGAACAAAGCATCTTTAAGTAGCCTA
ATGGCGACTCTTCTTACTAGCCAAGATCCAATCATTATTATCAATGCTAT
TCAAATGGGAATTATTTTAAAAAAGCTTCCACCTTCCTTAATTATTAATT
TCAAAAAAGAAGGCGTTTTATATCAATTAGACCAAATGCTTATTTACTGG
AAAGAAAAATCCTGTGAAATCGTTCCAAGCACTCACCAGTCAACATCATC
CTATTTTCCCAATGAAACTACTAATCAAGCAATGACTGTATCGGCACCGC
CAGGCACATTAGACCAATTATCACTAGATGCTATAAACGAAATTACTGAT
AAACCTGAACATTACATTGAAAGATTTACTGATAATACATCAACTAGCAC
TACAACAAATACAACCCAACGATTTACTAATTGGATTATGAAACGCAGTA
GCTGTATCGGGCGTCCGGTTACCACGGATGTCACTGTTCAAAATATTGCG
AAAAATCGAAAACAAAGGGCTGAATTGGAACAAGCTTTAGATATGAGTAT
CAAACCGATTTCCGATCAACAAAACCACAATAGTAAACGCATTAATCAAA
TTATGAGCATGCTGAATCTCAATACCTCATTCGCATATCTTGAATCAAAG
TCAGGTTTCAATGAGAAAATTAATTACGAAAATCCTAATAAAGAAAATTA
TTGTAAACAATGGATTGTGAAATTCGGTGGCCAATTAAACGCGGATTGGA
AAGAAATCGGCGAAGAATCAGTCAAAATATCTTCAATGGGAAACAGCAAC
GGTCAGCATCAGAAAAAAGATGTTATGTATTATTTGAAAGAAGTGGTTGT
TGGCCTAAAATCAGAAAACAGTACACTCATTAAAAAAGCCCTGATTCTAT
ATTCAGAGTTATTATCAAATGATTGCTACATATCTGTATTTGAAATGGAA
TCATCTGGTATCAATGAAGCGCTTTTGGATTTTTTTACAAACTCTAGTTG
TATTGAATCCAAACGAGATCATTTCATTACTTTTTTGGATGTTTATATGC
ATAATCATTTAGACCACAAATCATCAGATAATAAACCTAGTTTTGTAAAA
AAACCATTTGTAAGTCTTGTAAATCACCTCTTAATGTGTCTACACCAACA
AGAACAATTTCACGTGAGAATGTTCCAATTTCCTTCAATTCAATCAACAA
ACGCACAAAACTCCTCTTCAAGATTAACACTTCAATCTCGATTCAATTTA
ACACAGGCTCTAACAGAAGCAGTCCTTGGGAAAATGTCATCTCGAAGAAT
AGAAAACAATTCAAGAAATCTTGATTCTTCTATAATTGAAGCTAAAATTC
TTCCCAATATTCTGCTAGAACCATCATTTTCTAGGTCATCAAATAAATTG
ACAGATATCGAATGCCATTTTGCACCATATCCTTATGAAACACACGTCTC
TGATGTTGGCAATGGGGTAGAACAATGGAATGGCGGTGAAGTCTTCGTTG
TCAATAATTCTTTTAATGTGATAATGGATGTTTTGGCAACTGTATCGAAC
GTCGAAAAAATTGTAATGAGAGAGATAGCCAGGCACAGACGCTTAACGAA
GCGTTTTGGTATAATGACAAAGGAAAGTTCGATAAACGACTCCAGTGATT
CTGATGATGATTATGATTGCGATGCTATAAACGAATCCCTGCTTAGTGGT
GACATGGATTACCCCGATGACATGTCAGATTTTGCCGATATCAGCTTTCA
TGGTAATTCCAGCAAGAAACACAAGACTATTTCTGATAAACTCAATGCTT
TTAATTTATTTCACATCAATTCTGGACATTCAAACACTAAAGCCACAAGT
AGTAATAAAACTCGTGGGAAACAAACTAATTTAACAAAATCTGTAACTGG
TACATCGAGCTCCTGCTCGAAATCTAACACAAACACTCTCACAAAATTTC
GAGAAAGTGGTCTTAAAGCTTTAGCGAGTAGAAGAAGCACTAGACAATCA
CAGCATGATTCAGAATCTCACGCTGTAACTCCATCAACTTCATCCGGTTG
TTCTTCCTCTTTAGTTACTAGTACAACCAGTCAAGGCACTACTTCAAAAT
CTACAGATTCCCAAAGTAGTAAATTTATGTCGGAAACAATCCTCAAACCT
ATTAGCAAAATGCAGATTTTAATTGGTGATATAATATTACCAACTGAAAT
GACACTATATCAGGCTATTCGACGATACAGTAGTCATGTAATTCAATTCC
TTGCTAATCACAAAGAAGGTAAAACTGATCAAGAACTAGAAGAGGCAATC
AATCAAGTAATTTGGAAATCTCATCATAACATTCATTATCGGCCTGTATG
CGCAACAAATCCGTCTGTATATACTTCTAGACAAAATTTTAAATCTACTA
ACTCAGAAAGTATTTCAACTTTTAATTTTATGGCTTCATTAATGAATTCA
GCTTCTCAGAACAATAAACCACATCCACATTTAATATCCACAGATCAGTT
TCATTTTGATTCTAATATATCTTCCTCTCATCTGAGTTTCATTCCCAGCT
CTTCAAGTGTAAATACACGTCAGCGAACTTTCCACAAGAAAATCATTTTA
CCTCAATTAATCCAATCTTCACTGGAAACTGCCGACCAATCTCATTATTC
ACAAGCCCTTCGTCATAAACGCAGAAGAAAAAATAATCTAGAAACCAATA
TTTTAATAGGTAGGAATGCAAATAATTCACACAAAATTCTATTTTCAAAT
TTAACCAAAAAACTACCTTATCCGGCATTAATTGATTATCCAACAATATT
TGAAGCTGTACCGAATAATAAAAGTGAACAGGCGAATAAAGTTATGATAC
AAGAAGAGTCTAATACAACAAGACATTCTTACGATTTGACATTTACGATG
TCACAAAAGCTTGAAACGACACTTGCTCTACTAAGATGTCTTAGCGCTGT
CAATAGACATTGGCACGTACTAAGTTTTAATTTAAATTGTAATACTCTTA
TTTCTGAAAATGAATTCAGAAGTCAGAAATTGAGTTCCAAAGCTAATAGA
CAATTACAAGACACTTTTTCAGTGTTAGCCAGAAACTTGCCTTTCTGGTG
TGTTCAGTTATTTCATGCATGTGCCTTTTTGTTCTCTGTGGAAACAAGAC
AAAACTTTTTCTATTTATTTAATTTCGATCGTGCCAGAACGTTATTATAT
CTTGAAGGAGCTTCTAATCAAGATTCAGATAACTTTCTCGATTCGACAAC
TTCTGAAGTTCGTCGCATGCGAGTTCAGGTAAATCGATCCGATAGGTTAT
TGGATGAATCAGAACTATTGTTAAAAAATCAAAATGATCCTAGAGTGATT
CTGGAAATTTCTTTTAACAATGAAGCAGGTTTCGGTCTCGGTCCAACCAA
TGAATTTTATACTCAAGTCAGCACCTGCTTAATGAAAAGCGATTTAATGC
TTTGGTATGTATCGAGTGAGTCACATGATGATTATGTGCTACCTCCCCCC
GCGGGTCTCTACCCAAGGCCTATTTACAGTAAGAGTAAAAAATTGGACAA
CAAAATGCGAAACAAATTTGTCTTTCTTGGCCGATTAATGGCCCGTGCTC
TTTTGGACTGTAGAAAATTGGATATTCCCCTTAATCCCGTATTTTATAAA
TGGGTTTTGGGCCAAGAAGAATGCATTCACAGTGCAGATTTATATTATAT
TGATCCAATATTAGCCAATCAGTTAAAATCCTTACATGATCTTGTTGAGA
AAAAGATTTTGATTGATAACGATAAAACTATTAGTCAAGTGCACAAAAAA
GAAGCCTACGAAGAACTCGGTGTTGAAGATTTACTTATCGTTTTTGTGCA
CCCCTTATATACTCAAATTGAATTGATTAAAGATGGAGCTAATCGTGTGG
TAACAGTGCATGATTTGAGTTTATATTTGGACTTGGTTGCTAATGTTTCA
CTCATTGAAGGCGTGCGTGCACAAATGGAGTGTGTTATTGAAGGATTTGA
TAGTCTGTTACCGGGTGCTAGAATGCATTTAAGTGCTCTTTTCGAGTCTC
ACGAGATTGAGGAAATATTTTGTGGTGGTCGAGTAGAAGATAATCAAGCA
TGGGATGTTAAAACATTAACAGAGGTTTGTACTTGTGATCATGGTTACAC
AATGAATTCAAGGTCCATTATCAATTTATTCGAGATAATGTCAGATTTTA
CGAAAGAACAACGCCGACATTTTGTACAGTTTTGTACCGGAACCCCGAGA
TTACCGGTTGGAGGATTTCGAGCTCTACGTCCGCCTTTCAAAATTGTAAA
TAAAAAAGAAGGTGGAGAGAATCCTGATAATTACCTTCCATCAGTAATGA
CTTGTCAGAATTTTTTGAAACTGCCAGATTATTCTTCAAAAGAAGTGATG
CGTCAAAGATTGCTGTATGCGTTACACGAAGGACAAAATGCGTTTTTCTT
ATCATAAGAAACATAAAACTTTAAATAAATTGTGTAATATAATTGACTTG
TAATATCAAATTACAAGGCCTGTTAATATATAGTAATTATGCTTATTCTT
GCAAGTTTTGTCTTTCTAATCATCATACTGTATAAATATTATCATCCATT
TCTTCAAATATGTTTTGTGTAGTTCACATTGTGTACCTCATTAGTTTTTA
CGTAATTAAATTGAAATATTAAGG
back to top

protein sequence of SMED30010017-orf-1

>SMED30010017-orf-1 ID=SMED30010017-orf-1|Name=SMED30010017-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2213bp
MAGKHKQKRQVKDQTNKPLNTLPESNCTEPSTSDIVKRDIRSRKTEKINS
RRISVIRSRSPVTSKSNKKTSKFKDNPKVEKSEILLNSSSIDSDTGSQIS
KRRRREIRNTSVEQITESQSISSQPNETVKSRRRRSLLSHIEDHKVISSD
TNMASSSSQRTTTNDSTSQLSNDQPKNSLPSTSRGKRNNTSKNKSKFPQF
NMSSGRDPSIFLSNDNAFQGIVSSGMDISHFQNYLSSRSLAATEIGDQIN
KKLDELHSAAGDRTQEYMLMSEINQHLLVSYEDSLNSLRVSELTTQVVNL
IQNCEDNLVDLKNICYNVLLHLMEALPRSSDYLVTSLGMFLNKISNLFDF
DSLEQIINVIERISRRHGQAVLQCGAFTIILNYYDFLTAPQQLTILNMVS
QCFTNLKPSDFNYIIDGIENLTNRLKQSEPKCVEKVIQCFVRLVSAFQND
EVKLKKLASNNLFVNLQELLISSPPVISDIHEIIQMMAILCTNCSDLAVD
LVKQNITQTILCVCNSMTSDSTTISNCNNRSVEEMLSLVNLIAELMPTLP
QNEDLFIINRVINPTLFSQSKSSKSISQTEHSWYWFNASSKQWVSHPQNV
CQLLEKSLQSCDFEISCQSNGMCIDTNLILMQQTHVLNGTKVVSDLKRSR
HQFRQSQKNCDIKIDSRLKLLSEQCSRFESSDLSDNVEAVELIRHLFPLL
IDIYNEASSYQVRYKCLEAMIRMIYPTTNKTLNNVLNKASLSSLMATLLT
SQDPIIIINAIQMGIILKKLPPSLIINFKKEGVLYQLDQMLIYWKEKSCE
IVPSTHQSTSSYFPNETTNQAMTVSAPPGTLDQLSLDAINEITDKPEHYI
ERFTDNTSTSTTTNTTQRFTNWIMKRSSCIGRPVTTDVTVQNIAKNRKQR
AELEQALDMSIKPISDQQNHNSKRINQIMSMLNLNTSFAYLESKSGFNEK
INYENPNKENYCKQWIVKFGGQLNADWKEIGEESVKISSMGNSNGQHQKK
DVMYYLKEVVVGLKSENSTLIKKALILYSELLSNDCYISVFEMESSGINE
ALLDFFTNSSCIESKRDHFITFLDVYMHNHLDHKSSDNKPSFVKKPFVSL
VNHLLMCLHQQEQFHVRMFQFPSIQSTNAQNSSSRLTLQSRFNLTQALTE
AVLGKMSSRRIENNSRNLDSSIIEAKILPNILLEPSFSRSSNKLTDIECH
FAPYPYETHVSDVGNGVEQWNGGEVFVVNNSFNVIMDVLATVSNVEKIVM
REIARHRRLTKRFGIMTKESSINDSSDSDDDYDCDAINESLLSGDMDYPD
DMSDFADISFHGNSSKKHKTISDKLNAFNLFHINSGHSNTKATSSNKTRG
KQTNLTKSVTGTSSSCSKSNTNTLTKFRESGLKALASRRSTRQSQHDSES
HAVTPSTSSGCSSSLVTSTTSQGTTSKSTDSQSSKFMSETILKPISKMQI
LIGDIILPTEMTLYQAIRRYSSHVIQFLANHKEGKTDQELEEAINQVIWK
SHHNIHYRPVCATNPSVYTSRQNFKSTNSESISTFNFMASLMNSASQNNK
PHPHLISTDQFHFDSNISSSHLSFIPSSSSVNTRQRTFHKKIILPQLIQS
SLETADQSHYSQALRHKRRRKNNLETNILIGRNANNSHKILFSNLTKKLP
YPALIDYPTIFEAVPNNKSEQANKVMIQEESNTTRHSYDLTFTMSQKLET
TLALLRCLSAVNRHWHVLSFNLNCNTLISENEFRSQKLSSKANRQLQDTF
SVLARNLPFWCVQLFHACAFLFSVETRQNFFYLFNFDRARTLLYLEGASN
QDSDNFLDSTTSEVRRMRVQVNRSDRLLDESELLLKNQNDPRVILEISFN
NEAGFGLGPTNEFYTQVSTCLMKSDLMLWYVSSESHDDYVLPPPAGLYPR
PIYSKSKKLDNKMRNKFVFLGRLMARALLDCRKLDIPLNPVFYKWVLGQE
ECIHSADLYYIDPILANQLKSLHDLVEKKILIDNDKTISQVHKKEAYEEL
GVEDLLIVFVHPLYTQIELIKDGANRVVTVHDLSLYLDLVANVSLIEGVR
AQMECVIEGFDSLLPGARMHLSALFESHEIEEIFCGGRVEDNQAWDVKTL
TEVCTCDHGYTMNSRSIINLFEIMSDFTKEQRRHFVQFCTGTPRLPVGGF
RALRPPFKIVNKKEGGENPDNYLPSVMTCQNFLKLPDYSSKEVMRQRLLY
ALHEGQNAFFLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000209protein polyubiquitination
GO:0006281DNA repair
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006974cellular response to DNA damage stimulus
GO:0045995regulation of embryonic development
GO:1901315negative regulation of histone H2A K63-linked ubiquitination
GO:2000780negative regulation of double-strand break repair
GO:0016567protein ubiquitination
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0004842ubiquitin-protein transferase activity
GO:0005488binding
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035983Hect_E3_ubiquitin_ligase
IPR000569HECT_dom
IPR004170WWE-dom
IPR016024ARM-type_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000569HECT domainSMARTSM00119hect_3coord: 1829..2212
e-value: 2.7E-81
score: 286.1
IPR000569HECT domainPFAMPF00632HECTcoord: 1871..2211
e-value: 3.7E-70
score: 236.8
IPR000569HECT domainPROSITEPS50237HECTcoord: 1831..2212
score: 58.133
NoneNo IPR availableGENE3DG3DSA:3.30.2160.10coord: 1950..2048
e-value: 5.1E-29
score: 103.4
NoneNo IPR availableGENE3DG3DSA:3.30.2410.10coord: 2091..2211
e-value: 3.5E-31
score: 109.7
NoneNo IPR availableGENE3DG3DSA:3.90.1750.10coord: 1820..2082
e-value: 5.1E-29
score: 103.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 34..53
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 14..33
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 82..96
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 148..203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1385..1433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1338..1367
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..111
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1397..1433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 112..127
NoneNo IPR availablePANTHERPTHR45670:SF1E3 UBIQUITIN-PROTEIN LIGASE TRIP12coord: 243..2212
NoneNo IPR availablePANTHERPTHR45670FAMILY NOT NAMEDcoord: 243..2212
IPR004170WWE domainPROSITEPS50918WWEcoord: 568..648
score: 10.608
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 268..789
IPR035983HECT, E3 ligase catalytic domainSUPERFAMILYSSF56204Hect, E3 ligase catalytic domaincoord: 1814..2205