major facilitator superfamily domain-containing protein 10

Overview
Namemajor facilitator superfamily domain-containing protein 10
Smed IDSMED30010016
Length (bp)1476
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of major facilitator superfamily domain-containing protein 10 (SMED30010016) t-SNE clustered cells

Violin plots show distribution of expression levels for major facilitator superfamily domain-containing protein 10 (SMED30010016) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of major facilitator superfamily domain-containing protein 10 (SMED30010016) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for major facilitator superfamily domain-containing protein 10 (SMED30010016) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010016

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30010016SMESG000066785.1 dd_Smed_v4_10902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010016SMESG000066785.1 dd_Smed_v6_10902_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Human
Match: MFSD10 (major facilitator superfamily domain containing 10 [Source:HGNC Symbol;Acc:HGNC:16894])

HSP 1 Score: 218.009 bits (554), Expect = 9.422e-65
Identity = 149/386 (38.60%), Postives = 231/386 (59.84%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV----VAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSP-QQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYT 1362
            R +D LY       D F   I  P     ++N VLFGGL+GS+FS+ QFLC+P+ GA SD  GR+ +++L   G+  SY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSLGF +GP++G         +F +   ++     +L+FI  F  E+L   KR  +++    D   L++P+++  ++ +   +       L + R+LGLVYF YLF++SG+E+TL+FLTH RF +SS  QG+++  +GL M   QG   RR+  G E   +   +  L+P F+L+G+ +SL    +GL L++FA++ VV CL+S+V+      SP Q+G +MG LRS G LAR  GPL A+ ++W+ G Q  +T
Sbjct:   55 RAHDPLYGSWQGGVDWFATAIGMPVEK--RYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATS-RSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAAS-----DLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVA---GYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYWLAGAQACFT 429          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Human
Match: MFSD10 (major facilitator superfamily domain containing 10 [Source:HGNC Symbol;Acc:HGNC:16894])

HSP 1 Score: 218.009 bits (554), Expect = 9.422e-65
Identity = 149/386 (38.60%), Postives = 231/386 (59.84%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV----VAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSP-QQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYT 1362
            R +D LY       D F   I  P     ++N VLFGGL+GS+FS+ QFLC+P+ GA SD  GR+ +++L   G+  SY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSLGF +GP++G         +F +   ++     +L+FI  F  E+L   KR  +++    D   L++P+++  ++ +   +       L + R+LGLVYF YLF++SG+E+TL+FLTH RF +SS  QG+++  +GL M   QG   RR+  G E   +   +  L+P F+L+G+ +SL    +GL L++FA++ VV CL+S+V+      SP Q+G +MG LRS G LAR  GPL A+ ++W+ G Q  +T
Sbjct:   55 RAHDPLYGSWQGGVDWFATAIGMPVEK--RYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATS-RSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAAS-----DLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVA---GYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYWLAGAQACFT 429          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Human
Match: MFSD10 (major facilitator superfamily domain containing 10 [Source:HGNC Symbol;Acc:HGNC:16894])

HSP 1 Score: 205.297 bits (521), Expect = 1.182e-59
Identity = 143/372 (38.44%), Postives = 222/372 (59.68%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVV----AGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFAS 1323
            R +D LY       D F   I  P     ++N VLFGGL+GS+FS+ QFLC+P+ GA SD  GR+ +++L   G+  SY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSLGF +GP++G         +F +   ++     +L+FI  F  E+L   KR  +++    D   L++P+++  ++ +   +       L + R+LGLVYF YLF++SG+E+TL+FLTH RF +SS  QG+++  +GL M   QG   RR+  G E   +   +  L+P F+L+G+ +SL    +GL L++FA++ VV CL+S+V+   +    Q+G +MG LRS G LAR  GPL A+
Sbjct:   55 RAHDPLYGSWQGGVDWFATAIGMPVEK--RYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATS-RSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAAS-----DLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVAGYGSPG--QKGTVMGTLRSLGALARAAGPLVAA 416          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Human
Match: MFSD10 (major facilitator superfamily domain containing 10 [Source:HGNC Symbol;Acc:HGNC:16894])

HSP 1 Score: 172.17 bits (435), Expect = 1.567e-48
Identity = 110/289 (38.06%), Postives = 171/289 (59.17%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVG----VVAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGRE 1074
            R +D LY       D F   I  P     ++N VLFGGL+GS+FS+ QFLC+P+ GA SD  GR+ +++L   G+  SY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSLGF +GP++G    +    +F +   ++     +L+FI  F  E+L   KR  +++    D   L++P+++  ++ +   +       L + R+LGLVYF YLF++SG+E+TL+FLTH RF +SS  QG+++  +GL M   QG   RR+  G E
Sbjct:   55 RAHDPLYGSWQGGVDWFATAIGMPVEK--RYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATS-RSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAAS-----DLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGE 335          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Human
Match: MFSD10 (major facilitator superfamily domain containing 10 [Source:HGNC Symbol;Acc:HGNC:16894])

HSP 1 Score: 147.517 bits (371), Expect = 2.617e-39
Identity = 98/258 (37.98%), Postives = 153/258 (59.30%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVV----AGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYS 981
            R +D LY       D F   I  P     ++N VLFGGL+GS+FS+ QFLC+P+ GA SD  GR+ +++L   G+  SY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSLGF +GP++G         +F +   ++     +L+FI  F  E+L   KR  +++    D   L++P+++  ++ +   +       L + R+LGLVYF YLF++SG+E+TL+FLTH RF +S
Sbjct:   55 RAHDPLYGSWQGGVDWFATAIGMPVEK--RYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATS-RSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAAS-----DLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFS 304          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Celegans
Match: F10D7.2 (pep chromosome:WBcel235:X:17364646:17368642:-1 gene:WBGene00017339.1 transcript:F10D7.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10D7.2)

HSP 1 Score: 257.299 bits (656), Expect = 2.251e-80
Identity = 160/423 (37.83%), Postives = 255/423 (60.28%), Query Frame = 1
Query:  130 NKSILILFVYLLI-DLISFASILPILPSLVQSFSLRTN-DNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNV-------AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGA 1371
             K+++ L +  LI ++++F SILP+ P+++  +S   + D LY++       F+  I  P++   +++ V FGG LGS FS  QF+ SP +G+LSD++GR++++ L      ISY  W L  + F  F LSRI+GG+ K NI VA A++ D+Y   +   GMA+IGI++SLGF+IGP++G    T  ++       AM S  LT L   F+ FF  E+L+  K  +++        +L+ P  +F +T +   + R  Q  +++G +YF +LF+YSG+EFTL FLTH+RF++ +  QG++YLF GL+M+  Q   VR+    ++K +   GI+ +IP ++L+  +++    Y GLF +A AS+ VV  LTSLV     +   ++G L G+ RS GCLAR LGP+ +S  FW+ G    Y +GA
Sbjct:    9 KKAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQSFQEAIGVPHSE--RYDKVFFGGFLGSLFSALQFISSPTLGSLSDIYGRRAVISLCCIMTFISYVNW-LKADIFAYFVLSRILGGLSKGNINVATAIVSDVYSPEDHPKGMALIGISYSLGFLIGPMIGAYFSTIASIDSPFAYPAMFSIILTILEFGFL-FFLPETLDL-KEQKSLDDIKKTRKELVTPKDLFQFTAVNAPQERK-QEMQKVGWIYFLFLFLYSGLEFTLPFLTHIRFDFDNMQQGKVYLFTGLLMLPIQAKYVRKTPIEKQKAVAEFGIACIIPAYLLVAVAKTPLVLYAGLFFYAIASATVVTSLTSLVHVIYPQS--EKGVLAGIFRSLGCLARALGPVISSTFFWLLGATTCYIMGA 423          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Celegans
Match: T25D3.4 (pep chromosome:WBcel235:II:147241:152825:1 gene:WBGene00020798.1 transcript:T25D3.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T25D3.4)

HSP 1 Score: 59.3066 bits (142), Expect = 3.979e-9
Identity = 46/146 (31.51%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTT--TGMLI---SYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLS 801
            P+VGALSDV+GRK+ LILT   T M I     S W      F+LF LS    G+      V +A + D+  ++ R+S   ++   F+   +  P +G      +    V +++T ++  ++IFI  F  ESL  S+R+    S+++
Sbjct:  128 PLVGALSDVWGRKAFLILTVLCTCMPIPCLKISPWWY----FSLFSLS----GLFSVTFSVILAYVADITDKSERSSAYGLVSATFAASLVTSPALGAYISEVYGDSLVVLLATIVSVADVIFIVLFVPESL-PSRRNTGSVSQIT 264          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Celegans
Match: T25D3.4 (pep chromosome:WBcel235:II:148372:152582:1 gene:WBGene00020798.1 transcript:T25D3.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T25D3.4)

HSP 1 Score: 58.9214 bits (141), Expect = 4.308e-9
Identity = 84/332 (25.30%), Postives = 148/332 (44.58%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTT--TGMLISYSAWCLSENN---FTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLY---TPMKNLK-HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYS-SADQGRLYL-FLGLIMILFQGGIVRRLKSG-REKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P+VGALSDV+GRK+ LILT   T M I     CL  +    F+LF LS    G+      V +A + D+  ++ R+S   ++   F+   +  P +G      +    V +++T ++  ++IFI  F  ESL  S+R+    S+       I P  +F +    P  +L+   + +   QL  + F      SG +F+  F  +L+     S +   +Y+  +G++ ++ Q G +  L S    K  I +G+   +      G     +  +    L A  SS     +++ VS   +K   +QG + G++     L    GP     +F++
Sbjct:   18 PLVGALSDVWGRKAFLILTVLCTCMPIP----CLKISPWWYFSLFSLS----GLFSVTFSVILAYVADITDKSERSSAYGLVSATFAASLVTSPALGAYISEVYGDSLVVLLATIVSVADVIFIVLFVPESL-PSRRNTGSVSQ-------ITPNEVFNWQSADPFGSLRIVWEDKLVLQLATIVFLSYLPESG-QFS-CFFVYLKLVVGFSPEAVAMYIGLVGILSVVAQTGFLHCLTSRFGTKHTITLGLIFQLIQLTWYGLGTQYWMMWSAGVLAAM-SSITYPSISAFVSILSDKD--KQGTVQGVITGIRGLCTGFGPALFGTVFYL 328          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Celegans
Match: T25D3.4 (pep chromosome:WBcel235:II:147243:152582:1 gene:WBGene00020798.1 transcript:T25D3.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T25D3.4)

HSP 1 Score: 58.9214 bits (141), Expect = 5.103e-9
Identity = 46/146 (31.51%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTT--TGMLI---SYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLS 801
            P+VGALSDV+GRK+ LILT   T M I     S W      F+LF LS    G+      V +A + D+  ++ R+S   ++   F+   +  P +G      +    V +++T ++  ++IFI  F  ESL  S+R+    S+++
Sbjct:   86 PLVGALSDVWGRKAFLILTVLCTCMPIPCLKISPWWY----FSLFSLS----GLFSVTFSVILAYVADITDKSERSSAYGLVSATFAASLVTSPALGAYISEVYGDSLVVLLATIVSVADVIFIVLFVPESL-PSRRNTGSVSQIT 222          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Fly
Match: rtet (gene:FBgn0028468 transcript:FBtr0084009)

HSP 1 Score: 281.567 bits (719), Expect = 3.594e-89
Identity = 175/431 (40.60%), Postives = 270/431 (62.65%), Query Frame = 1
Query:  124 KFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVA---------MISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIP 1389
            K +  I I+FV LL DL++F  ILP+LPSL++ +    +  LY V+++    F+ L+ AP+    ++  VLFGG LGS FS  QF+ SPIVG LSD +GRK +L+   +G+ +SY  W  S +NF LF L+R +GG+ K NI + ++VI D+     R  GMA++G+AFSLGFI+GP++G +   F + +         +++ GL   +L+ ++    E+L K KR + +SS LS   QL+N  +IF +  +KN+  +D+   R +GLVYF YLF+YSG+EFT+TFL + +F Y+S DQ +++L  G+IM L QG +VRRL   + K   I  +  ++P F+++G ++     Y G+ LFA +++  V CLT+LVS+  N    Q+G ++G+ RS G LAR LGP+   + FW  G ++TY  G  +L+ P
Sbjct:   45 KSDPMIYIIFVSLLFDLLAFTIILPLLPSLLEHYRQNDSSGLYAVLTDRVRWFQQLLGAPD----RYISVLFGGFLGSMFSFLQFVASPIVGGLSDYYGRKPVLLACASGIALSYLIWACS-SNFALFVLARFVGGISKGNISLCMSVITDVSSVKTRGRGMALVGVAFSLGFIVGPMIGALFAIFSDKSGSTWFVLPSLLAFGLAVGDLVVLACCLRETLPKEKRVKEISSALSYGLQLLNFSAIFRFAAIKNVPKKDIAALRSIGLVYFLYLFLYSGLEFTVTFLMYHKFGYTSMDQAKMFLTTGVIMTLLQGSVVRRLPEAKIKGYAIFSLYLIVPAFVVVGLAEGSRMLYAGMTLFAISTAFAVTCLTTLVSKYGNDD--QKGSVLGIFRSLGALARALGPVVGCIAFWCVGSRITYIAGGLLLIYP 468          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Fly
Match: CG5078 (gene:FBgn0037005 transcript:FBtr0078208)

HSP 1 Score: 58.9214 bits (141), Expect = 5.175e-9
Identity = 70/329 (21.28%), Postives = 145/329 (44.07%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFF---NVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQ-NARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQ---GGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQL 1353
            P++GALSD++GRK +L++T   +  S     ++ +N+  F +S  I GV   +  VA A + D+  +  R+    ++   F+   +I P +G +    +    V +++T ++  N++F+     E+L+++ R   +S K +D              P  +L+      N   L +V FT+L   +G   ++     L   +   +   L  F+ ++ I      G IV+ L +     + ++     +  F  +G+ +   +    +   A  SS     +++ VS   + ++  QG + G++     L   LGP    ++F++    L
Sbjct:   77 PLIGALSDIYGRKVLLLITV--IFTSLPIPMMTMDNWWFFVISS-ISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVIAPAMGNLIMDRYGINTVVLVATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQAD--------------PFLSLRRVGSDPNVLLLCVVMFTFLLPEAGEYSSVPAYLKLTMGFDFTELSTLVAFMAILGISINVTLGSIVKTLGAKNAIILGLLLELLQLILFA-IGYEKWQMWLAGNV---AALSSITFPAVSAYVSLYTDVET--QGAVQGMITGMSGLCSGLGPALFGIVFYLSDMDL 382          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Fly
Match: CG11537 (gene:FBgn0035400 transcript:FBtr0073115)

HSP 1 Score: 54.6842 bits (130), Expect = 1.402e-7
Identity = 73/326 (22.39%), Postives = 135/326 (41.41%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTT--TGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFL-THLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSD++GRK  L++T   T + I      L   N   FF    I G       V  A + D+     R+    +    F+   +I P +G      +    V  +ST +  L++ FI     ESL +  R  +  + +S  ++  +P           L  R +   + + ++  T L  Y     E++  F+   L+  ++  +       +G++ I  Q  +   ++    K+ II+G++  I   +  GF SQ    +  G  + A   S     +++ VS     +S  QG + G++     L   LGP    ++F++
Sbjct:   89 PLIGALSDIWGRKFFLLVTVFFTCLPIP-----LMSINTWWFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPIS--WEQADPF----------LALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAG--VVAALGSITYPAISAFVSLYAAPES--QGAVQGMITGMRGLCNGLGPAVFGVVFYL 393          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Fly
Match: CG11537 (gene:FBgn0035400 transcript:FBtr0309235)

HSP 1 Score: 51.6026 bits (122), Expect = 1.518e-6
Identity = 72/329 (21.88%), Postives = 135/329 (41.03%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTT-----TGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFL-THLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSD++GRK  L++T         L+S + W         FF    I G       V  A + D+     R+    +    F+   +I P +G      +    V  +ST +  L++ FI     ESL +  R  +  + +S  ++  +P           L  R +   + + ++  T L  Y     E++  F+   L+  ++  +       +G++ I  Q  +   ++    K+ II+G++  I   +  GF SQ    +  G  + A   S     +++ VS     +S  QG + G++     L   LGP    ++F++
Sbjct:  281 PLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTW--------WFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPIS--WEQADPF----------LALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAG--VVAALGSITYPAISAFVSLYAAPES--QGAVQGMITGMRGLCNGLGPAVFGVVFYL 585          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Fly
Match: CG11537 (gene:FBgn0035400 transcript:FBtr0333894)

HSP 1 Score: 51.2174 bits (121), Expect = 1.782e-6
Identity = 72/329 (21.88%), Postives = 135/329 (41.03%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTT-----TGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFL-THLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSD++GRK  L++T         L+S + W         FF    I G       V  A + D+     R+    +    F+   +I P +G      +    V  +ST +  L++ FI     ESL +  R  +  + +S  ++  +P           L  R +   + + ++  T L  Y     E++  F+   L+  ++  +       +G++ I  Q  +   ++    K+ II+G++  I   +  GF SQ    +  G  + A   S     +++ VS     +S  QG + G++     L   LGP    ++F++
Sbjct:  306 PLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTW--------WFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPIS--WEQADPF----------LALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAG--VVAALGSITYPAISAFVSLYAAPES--QGAVQGMITGMRGLCNGLGPAVFGVVFYL 610          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Zebrafish
Match: mfsd10 (major facilitator superfamily domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-050417-154])

HSP 1 Score: 298.901 bits (764), Expect = 4.016e-96
Identity = 171/402 (42.54%), Postives = 263/402 (65.42%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVV-------AGTFFN-VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLK----HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVI 1401
            +T DN+Y  + +  D FR  +  P     K+N VLFGGL+GS +SL QFL SPI GALSD +GRK +L+LTT G++ SY  W  S ++FT+F LSRI+GG+CK N+ +  A++ DL     RN GMA+IG+AFSLGF +GP++G         A  F+   AM++   +  +L+FI F   E+L+K   + +   + S    L++P+++F +T ++  +     + +QN + LGLVYFTYLF++SG+EFTL+FLTH RF +SS  QG+++ F+G+ M + QGG  RR++ G + Q + + I  LIP F+L+G + +L   Y GLFL++FA++ VV CL++ VS   +  + Q+G +MG+LRS G LAR LGP+ AS ++W+ G +L + I +   ++PL ++
Sbjct:   47 QTGDNVYQSLQSVVDWFRGAVGVPMET--KYNSVLFGGLIGSLYSLLQFLSSPITGALSDDYGRKPLLLLTTIGLMASYVLWAFS-HSFTVFLLSRIVGGICKGNVSLCTAIVADLPCPKARNKGMAMIGVAFSLGFTLGPLMGAYFALRLKDAEVFYQGPAMLAVLFSLADLLFIFFMLPETLQKGASESSGLQQQSG--DLLHPVALFNFTAVRRTENPPSEQKMQNLKVLGLVYFTYLFLFSGLEFTLSFLTHQRFQFSSMQQGKMFFFIGITMAVIQGGYARRIRPGHQIQTVSMAIITLIPAFLLVGIAWNLTLLYSGLFLYSFAAAIVVPCLSTQVS--GHGSASQKGTVMGILRSLGALARALGPIVASSVYWLAGAELCFIISSVFFIVPLILL 441          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Zebrafish
Match: hiat1a (hippocampus abundant transcript 1a [Source:ZFIN;Acc:ZDB-GENE-030131-834])

HSP 1 Score: 62.3882 bits (150), Expect = 5.301e-10
Identity = 82/333 (24.62%), Postives = 138/333 (41.44%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQG---GIVRRLKSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R++   ++   F+   +  P +G      +    V +++T +  L++ FI     ESL +  R  +  +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +LR    ++S         +G++ IL Q    GI+ R  S   K  I++G+   I      GF SQ    +  G    A  SS     ++++VS+  N    QQG + G++     L   LGP     +F++
Sbjct:   90 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW--------WYFAVISMSGVFAVTFSVIFAYVADITQEHERSTAYGLVSATFAASLVTSPAIGAYLSEVYGDTLVVILATAIALLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASL--RKVGQDSTVLLICITVFLSYLPEAGQYS-SFFLYLRQVIGFTSETVAAFIAVVGILSILAQTVVLGILMR--SIGNKNTILLGLGFQILQLAWYGFGSQPWMMWAAG--AVAAMSSITFPAISAIVSR--NADPDQQGVVQGMITGIRGLCNGLGPALYGFVFYL 395          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Zebrafish
Match: hiat1b (hippocampus abundant transcript 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2935])

HSP 1 Score: 61.6178 bits (148), Expect = 1.000e-9
Identity = 77/329 (23.40%), Postives = 131/329 (39.82%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY---SGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R+    ++   F+   +I P +G      +    V ++++ +  L++ FI     ESL +  R  +  +          PIS     P  +L  R +     + L+  T    Y   +G   +          +SS         LGL+ ++ Q  ++  L +S   K  I++G+   I      GF    +  +    + A  SS     +++L+S+  +    QQG   G++     L   LGP     IF+I
Sbjct:   88 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWW--------YFAMISVSGVFAVTFSVIFAYVADITQEHERSMAYGMVSATFAASLVISPAIGAYLSHVYGDTLVVVLASAIAMLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASL--RKVGQDSTVLLICITVFLSYLPEAGQNSSFFLYLQQIMGFSSESVAAFIAVLGLLSVVAQTVVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAM-SSITFPAVSALISRTADPD--QQGVGQGMVTGIRGLCNGLGPALYGFIFYI 393          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Zebrafish
Match: si:ch211-87m7.2 (si:ch211-87m7.2 [Source:ZFIN;Acc:ZDB-GENE-120215-153])

HSP 1 Score: 60.4622 bits (145), Expect = 2.716e-9
Identity = 76/320 (23.75%), Postives = 130/320 (40.62%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY---SGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGP 1311
            P+VGALSDV+GRKS L+LT         L+  S W         FF    + G+      V  A + D+  E  R++   ++   F+   +  P +G      +    V +++T +  L+++F+     ESL    R  +             PIS     P  +L  R +     + L+  T L  Y   +G   +         N+SSA        +G++ I  Q  ++  L K    K  +++G+   +      GF    +  +    + A  SS     +++LVS+C ++   QQG + G++     L   LGP
Sbjct:   88 PLVGALSDVWGRKSFLLLTVFFTCAPIPLMRISPW--------WFFALMSVSGLFSVTFSVIFAYVADITEEHERSTAYGLVSATFAASLVTSPAIGAFLSIHYGDSLVVLLATIIAVLDILFVLLVVPESLPDKMRLSSWG----------FPISWEQADPFASL--RKVGKDSTVLLICVTVLLSYLPEAGQYSSFFLYLGQVINFSSAAIAGFIAMVGILSIGAQTLLLSVLMKKIGNKSTVLLGLGFQLFQLAWYGFGSEPWMMWAAGAVAAL-SSITFPAISALVSRCTDRD--QQGAVQGIITGIRGLCNGLGP 384          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Zebrafish
Match: si:ch211-87m7.2 (si:ch211-87m7.2 [Source:ZFIN;Acc:ZDB-GENE-120215-153])

HSP 1 Score: 60.077 bits (144), Expect = 3.197e-9
Identity = 76/320 (23.75%), Postives = 130/320 (40.62%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY---SGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGP 1311
            P+VGALSDV+GRKS L+LT         L+  S W         FF    + G+      V  A + D+  E  R++   ++   F+   +  P +G      +    V +++T +  L+++F+     ESL    R  +             PIS     P  +L  R +     + L+  T L  Y   +G   +         N+SSA        +G++ I  Q  ++  L K    K  +++G+   +      GF    +  +    + A  SS     +++LVS+C ++   QQG + G++     L   LGP
Sbjct:   78 PLVGALSDVWGRKSFLLLTVFFTCAPIPLMRISPWW--------FFALMSVSGLFSVTFSVIFAYVADITEEHERSTAYGLVSATFAASLVTSPAIGAFLSIHYGDSLVVLLATIIAVLDILFVLLVVPESLPDKMRLSSWG----------FPISWEQADPFASL--RKVGKDSTVLLICVTVLLSYLPEAGQYSSFFLYLGQVINFSSAAIAGFIAMVGILSIGAQTLLLSVLMKKIGNKSTVLLGLGFQLFQLAWYGFGSEPWMMWAAGAVAAL-SSITFPAISALVSRCTDRD--QQGAVQGIITGIRGLCNGLGP 374          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Xenopus
Match: arhgef2 (Rho/Rac guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-5909320])

HSP 1 Score: 278.1 bits (710), Expect = 6.190e-88
Identity = 175/433 (40.42%), Postives = 283/433 (65.36%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV------VAGTFFNV--AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLK----HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL 1392
            ++ I ++FV LLIDL+ F  ILP+LPS+++ FS +++D+LY  + +  D F + I  P     K+N VLFGG +G+ FSL QF+CSP+ GA SD  GR+  +++T  G++ SY+ W +S + F +F LSR++GG+ K N+ +  A+I DL    NR++GMA+IG+AFSLGF IGP++G        +   F V  A+++      +LIFI  F  E+L K  R  ++++       L++P+++F ++ +   K      +++  R LG+VYF YLF++SG+E+TL+FLTH RF ++S  QG+++ F+GL M + QGG  RR++ G E + +   I  LIP F+L+G++ +L     GL L++FA++ VV CL+SLVS   +  + Q+G +MG+LRS G LAR LGP+ ++ ++W+ G Q+ +++ AF+ L+PL
Sbjct:   18 SRVISVVFVTLLIDLLGFTLILPLLPSILEHFS-KSDDSLYQTIQHSVDWFASAIGVPQER--KYNSVLFGGFIGTIFSLLQFICSPLTGAASDYLGRRRAMMITAVGLIFSYTLWAISRS-FGIFILSRVVGGLSKGNVSLCTAIIADLPLLKNRSTGMAMIGVAFSLGFTIGPMIGAYFAMNAASEEIFYVRPALLALFFAVADLIFIFLFLPETLPKENRVPSVTAGFKGASDLLSPVALFHFSAITRRKGSPSPENVEKLRLLGMVYFLYLFLFSGLEYTLSFLTHQRFQFNSMQQGKMFFFIGLTMAVIQGGYARRIRPGNEIKAVKRAIILLIPAFLLIGWATNLLVLGAGLLLYSFAAAIVVPCLSSLVSTYGS--ASQKGTVMGILRSLGALARALGPILSASLYWLAGAQICFSLSAFLFLVPL 444          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Xenopus
Match: arhgef2 (Rho/Rac guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-5909320])

HSP 1 Score: 258.07 bits (658), Expect = 2.256e-80
Identity = 167/433 (38.57%), Postives = 271/433 (62.59%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV------VAGTFFNV--AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLK----HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL 1392
            ++ I ++FV LLIDL+ F  ILP+LPS+++ FS +++D+LY  + +  D F + I  P     K+N VLFGG +G+ FSL QF+CSP+ GA SD  GR+  +++T  G++ SY+ W +S + F +F LSR++GG+ K N+ +  A+I DL    NR++GMA+IG+AFSLGF IGP++G        +   F V  A+++      +LIFI  F  E+L K  R  ++++       L++P+++F ++ +   K      +++  R LG+VYF YLF++SG+E+TL+FLTH RF ++S  QG+++ F+GL M + QGG  RR++ G E + +   I  LIP F+L+G++ +L     GL L++F S+                   Q+G +MG+LRS G LAR LGP+ ++ ++W+ G Q+ +++ AF+ L+PL
Sbjct:   17 SRVISVVFVTLLIDLLGFTLILPLLPSILEHFS-KSDDSLYQTIQHSVDWFASAIGVPQER--KYNSVLFGGFIGTIFSLLQFICSPLTGAASDYLGRRRAMMITAVGLIFSYTLWAISRS-FGIFILSRVVGGLSKGNVSLCTAIIADLPLLKNRSTGMAMIGVAFSLGFTIGPMIGAYFAMNAASEEIFYVRPALLALFFAVADLIFIFLFLPETLPKENRVPSVTAGFKGASDLLSPVALFHFSAITRRKGSPSPENVEKLRLLGMVYFLYLFLFSGLEYTLSFLTHQRFQFNSMQQGKMFFFIGLTMAVIQGGYARRIRPGNEIKAVKRAIILLIPAFLLIGWATNLLVLGAGLLLYSFGSAS------------------QKGTVMGILRSLGALARALGPILSASLYWLAGAQICFSLSAFLFLVPL 427          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Xenopus
Match: arhgef2 (Rho/Rac guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-5909320])

HSP 1 Score: 257.684 bits (657), Expect = 3.287e-80
Identity = 169/433 (39.03%), Postives = 273/433 (63.05%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV------VAGTFFNV--AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLK----HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL 1392
            ++ I ++FV LLIDL+ F  ILP+LPS+++ FS +++D+LY  + +  D F + I  P     K+N VLFGG +G+ FSL QF+CSP+ GA SD  GR+  +++T  G++ SY+ W +S + F +F LSR++GG+ K N+ +  A+I DL    NR++GMA+IG+AFSLGF IGP++G        +   F V  A+++      +LIFI  F  E+L K  R  ++++       L++P+++F ++ +   K      +++  R LG+VYF YLF++SG+E+TL+FLTH RF ++S  QG+++ F+GL M + QGG  RR++ G E + +   I  LIP F+L+G++ +L     GL L++F       CL    S+C       +G +MG+LRS G LAR LGP+ ++ ++W+ G Q+ +++ AF+ L+PL
Sbjct:   17 SRVISVVFVTLLIDLLGFTLILPLLPSILEHFS-KSDDSLYQTIQHSVDWFASAIGVPQER--KYNSVLFGGFIGTIFSLLQFICSPLTGAASDYLGRRRAMMITAVGLIFSYTLWAISRS-FGIFILSRVVGGLSKGNVSLCTAIIADLPLLKNRSTGMAMIGVAFSLGFTIGPMIGAYFAMNAASEEIFYVRPALLALFFAVADLIFIFLFLPETLPKENRVPSVTAGFKGASDLLSPVALFHFSAITRRKGSPSPENVEKLRLLGMVYFLYLFLFSGLEYTLSFLTHQRFQFNSMQQGKMFFFIGLTMAVIQGGYARRIRPGNEIKAVKRAIILLIPAFLLIGWATNLLVLGAGLLLYSFGK-----CL----SEC-------KGTVMGILRSLGALARALGPILSASLYWLAGAQICFSLSAFLFLVPL 429          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 68.5514 bits (166), Expect = 8.800e-12
Identity = 78/328 (23.78%), Postives = 136/328 (41.46%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R+    ++   F+   +  P +G   G  +    V +++T +  L++ FI     ESL +  R  +  +          PIS     P  +LK     +   L  +     ++    +++ +F  +LR   ++S          LG++ I+ Q  ++  L +S   K  I++G+   I      GF    +  +    + A  SS     +++LVS+  +    QQG + G++     L   LGP     IF+I
Sbjct:   82 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW--------WYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDNLVVLLATAIALLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYS-SFFLYLRQIMDFSPESVAAFIAVLGILSIIAQTVVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAM-SSITFPAVSALVSRTADAD--QQGVVQGMITGIRGLCNGLGPALYGFIFYI 387          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 67.781 bits (164), Expect = 1.515e-11
Identity = 78/328 (23.78%), Postives = 136/328 (41.46%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R+    ++   F+   +  P +G   G  +    V +++T +  L++ FI     ESL +  R  +  +          PIS     P  +LK     +   L  +     ++    +++ +F  +LR   ++S          LG++ I+ Q  ++  L +S   K  I++G+   I      GF    +  +    + A  SS     +++LVS+  +    QQG + G++     L   LGP     IF+I
Sbjct:   89 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW--------WYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDNLVVLLATAIALLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYS-SFFLYLRQIMDFSPESVAAFIAVLGILSIIAQTVVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAM-SSITFPAVSALVSRTADAD--QQGVVQGMITGIRGLCNGLGPALYGFIFYI 394          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Mouse
Match: Mfsd10 (major facilitator superfamily domain containing 10 [Source:MGI Symbol;Acc:MGI:1915544])

HSP 1 Score: 239.195 bits (609), Expect = 5.339e-73
Identity = 142/385 (36.88%), Postives = 230/385 (59.74%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAM---ISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGL----VYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTI 1365
            R  D LY       D F + I  P     ++N VLFGGL+GS+FSL QF  +P+ GA SD  GR+ +++L+ TG+ ISY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSL F +GP++G     F +V M   IS      +++FI  F  E+L + KR  +++        L++P+++  +  + + +    ++  +       VYF YLF++SG+E+TL+FL H RF +SS  QG+++ F+GL M   QG   RR+  G+E   +   +  L+P F+L+G++ SL    +GL L++FA++ VV  L+++VS   +    Q+G +MG+LRS G L R LGP+ A+ ++W+ G Q+ +T+
Sbjct:   56 REQDPLYGSWQRGVDWFASAIGMPAEK--RYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVWATS-RSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGA----FLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYFLYLFLFSGLEYTLSFLAHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRISPGKEAAAVTRAMLLLVPAFLLIGWAHSLPTLGLGLMLYSFAAAVVVPGLSTMVSSYGSPG--QKGTIMGILRSLGALGRALGPVVAASVYWLTGAQVCFTV 431          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Mouse
Match: Mfsd10 (major facilitator superfamily domain containing 10 [Source:MGI Symbol;Acc:MGI:1915544])

HSP 1 Score: 239.195 bits (609), Expect = 5.339e-73
Identity = 142/385 (36.88%), Postives = 230/385 (59.74%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAM---ISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGL----VYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTI 1365
            R  D LY       D F + I  P     ++N VLFGGL+GS+FSL QF  +P+ GA SD  GR+ +++L+ TG+ ISY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSL F +GP++G     F +V M   IS      +++FI  F  E+L + KR  +++        L++P+++  +  + + +    ++  +       VYF YLF++SG+E+TL+FL H RF +SS  QG+++ F+GL M   QG   RR+  G+E   +   +  L+P F+L+G++ SL    +GL L++FA++ VV  L+++VS   +    Q+G +MG+LRS G L R LGP+ A+ ++W+ G Q+ +T+
Sbjct:   56 REQDPLYGSWQRGVDWFASAIGMPAEK--RYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVWATS-RSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGA----FLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYFLYLFLFSGLEYTLSFLAHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRISPGKEAAAVTRAMLLLVPAFLLIGWAHSLPTLGLGLMLYSFAAAVVVPGLSTMVSSYGSPG--QKGTIMGILRSLGALGRALGPVVAASVYWLTGAQVCFTV 431          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Mouse
Match: Mfsd10 (major facilitator superfamily domain containing 10 [Source:MGI Symbol;Acc:MGI:1915544])

HSP 1 Score: 239.195 bits (609), Expect = 5.339e-73
Identity = 142/385 (36.88%), Postives = 230/385 (59.74%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAM---ISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGL----VYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTI 1365
            R  D LY       D F + I  P     ++N VLFGGL+GS+FSL QF  +P+ GA SD  GR+ +++L+ TG+ ISY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSL F +GP++G     F +V M   IS      +++FI  F  E+L + KR  +++        L++P+++  +  + + +    ++  +       VYF YLF++SG+E+TL+FL H RF +SS  QG+++ F+GL M   QG   RR+  G+E   +   +  L+P F+L+G++ SL    +GL L++FA++ VV  L+++VS   +    Q+G +MG+LRS G L R LGP+ A+ ++W+ G Q+ +T+
Sbjct:   56 REQDPLYGSWQRGVDWFASAIGMPAEK--RYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVWATS-RSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGA----FLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYFLYLFLFSGLEYTLSFLAHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRISPGKEAAAVTRAMLLLVPAFLLIGWAHSLPTLGLGLMLYSFAAAVVVPGLSTMVSSYGSPG--QKGTIMGILRSLGALGRALGPVVAASVYWLTGAQVCFTV 431          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Mouse
Match: Mfsd10 (major facilitator superfamily domain containing 10 [Source:MGI Symbol;Acc:MGI:1915544])

HSP 1 Score: 112.079 bits (279), Expect = 1.871e-27
Identity = 77/220 (35.00%), Postives = 125/220 (56.82%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAM---ISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQN 882
            R  D LY       D F + I  P     ++N VLFGGL+GS+FSL QF  +P+ GA SD  GR+ +++L+ TG+ ISY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSL F +GP++G     F +V M   IS      +++FI  F  E+L + KR  +++        L++P+++  +  + + +    ++
Sbjct:   56 REQDPLYGSWQRGVDWFASAIGMPAEK--RYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVWATS-RSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGA----FLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEH 268          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Mouse
Match: Mfsd10 (major facilitator superfamily domain containing 10 [Source:MGI Symbol;Acc:MGI:1915544])

HSP 1 Score: 112.079 bits (279), Expect = 1.950e-27
Identity = 77/212 (36.32%), Postives = 122/212 (57.55%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAM---ISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKN 858
            R  D LY       D F + I  P     ++N VLFGGL+GS+FSL QF  +P+ GA SD  GR+ +++L+ TG+ ISY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSL F +GP++G     F +V M   IS      +++FI  F  E+L + KR  +++        L++P+++  +  + +
Sbjct:   56 REQDPLYGSWQRGVDWFASAIGMPAEK--RYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVWATS-RSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGA----FLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTH 260          
BLAST of major facilitator superfamily domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q0P5M9|MFS10_BOVIN (Major facilitator superfamily domain-containing protein 10 OS=Bos taurus OX=9913 GN=MFSD10 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 3.431e-72
Identity = 153/407 (37.59%), Postives = 239/407 (58.72%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVIVFI*LVNPCSTLK 1440
            R +D LY       D F   I  P     ++N VLFGGL+GS FSL QFL +P+ GALSD  GR+  ++L+  G+  SY+ W  S++ F  F  SR+IGG+ K N+ +  A++ DL   + R+ GMA+IG+AFSLGF +GP +G    +   V  ++      +L+FI  F  E+L   KR  +++        L++P+++  ++ +           L + R LGLVYF YLF++SG+EFTL+FL H RF +S  +QG+++ F+GL M   QG   RR++ GRE   +   I  LIP  + +G+  +L    +GL L+++A++ VV CL+S+V+   +    Q+G +MG LRS G LAR +GP+ A+  +W+ G ++ YT+ A + L+P +++    L  P  TLK
Sbjct:   56 RAHDPLYGSWQRGVDWFAAAIGMPAEK--RYNSVLFGGLIGSVFSLLQFLSAPLTGALSDCLGRRPGMLLSLAGVATSYAVWAASKS-FAAFLASRVIGGISKGNVSLCTAIVADLGSPSARSKGMAVIGVAFSLGFTLGPTLGAFLPSE-TVPWLALLFAVSDLLFIWCFLPETLPPEKRAPSVTLGFRAAADLLSPLALLRFSAVARGPDPPTGVRLGSLRGLGLVYFLYLFLFSGLEFTLSFLVHQRFRFSRVEQGKMFFFIGLTMATIQGAYARRIRPGREIAAVKQAILLLIPASLFVGWGHTLPILGLGLLLYSWAAAVVVPCLSSVVAGYGSPG--QKGTVMGTLRSLGALARAVGPVVAASAYWLAGARVCYTVCAALFLLPFSILRT--LSPPARTLK 454          
BLAST of major facilitator superfamily domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q9D2V8|MFS10_MOUSE (Major facilitator superfamily domain-containing protein 10 OS=Mus musculus OX=10090 GN=Mfsd10 PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 3.734e-72
Identity = 142/385 (36.88%), Postives = 230/385 (59.74%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAM---ISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGL----VYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTI 1365
            R  D LY       D F + I  P     ++N VLFGGL+GS+FSL QF  +P+ GA SD  GR+ +++L+ TG+ ISY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSL F +GP++G     F +V M   IS      +++FI  F  E+L + KR  +++        L++P+++  +  + + +    ++  +       VYF YLF++SG+E+TL+FL H RF +SS  QG+++ F+GL M   QG   RR+  G+E   +   +  L+P F+L+G++ SL    +GL L++FA++ VV  L+++VS   +    Q+G +MG+LRS G L R LGP+ A+ ++W+ G Q+ +T+
Sbjct:   56 REQDPLYGSWQRGVDWFASAIGMPAEK--RYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLAISYAVWATS-RSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGA----FLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYFLYLFLFSGLEYTLSFLAHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRISPGKEAAAVTRAMLLLVPAFLLIGWAHSLPTLGLGLMLYSFAAAVVVPGLSTMVSSYGSPG--QKGTIMGILRSLGALGRALGPVVAASVYWLTGAQVCFTV 431          
BLAST of major facilitator superfamily domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q14728|MFS10_HUMAN (Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens OX=9606 GN=MFSD10 PE=1 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 4.525e-64
Identity = 149/386 (38.60%), Postives = 231/386 (59.84%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV----VAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRD----LQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSP-QQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYT 1362
            R +D LY       D F   I  P     ++N VLFGGL+GS+FS+ QFLC+P+ GA SD  GR+ +++L   G+  SY+ W  S  +F  F  SR+IGG+ K N+ ++ A++ DL     R+ GMA+IG+AFSLGF +GP++G         +F +   ++     +L+FI  F  E+L   KR  +++    D   L++P+++  ++ +   +       L + R+LGLVYF YLF++SG+E+TL+FLTH RF +SS  QG+++  +GL M   QG   RR+  G E   +   +  L+P F+L+G+ +SL    +GL L++FA++ VV CL+S+V+      SP Q+G +MG LRS G LAR  GPL A+ ++W+ G Q  +T
Sbjct:   55 RAHDPLYGSWQGGVDWFATAIGMPVEK--RYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATS-RSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAAS-----DLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVA---GYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYWLAGAQACFT 429          
BLAST of major facilitator superfamily domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|P33733|TCR4_SALOR (Tetracycline resistance protein, class D OS=Salmonella ordonez OX=612 GN=tetA PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.875e-18
Identity = 107/411 (26.03%), Postives = 166/411 (40.39%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTN-DNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTF-----FNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQ----GGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIF 1332
            NK  +I  V  L+D +    I+P+LPSL++ +    +  N Y ++                               + +++ Q   +P++G  SD  GR+ +L+L+  G    Y+   LS N   + +L RII G+  A   VA +V+ D    + R +    +G AF  G I GP +G +AG       F +A I    TFL + FI     ++ EK   ++  S+ +S I                      L+    L  V+FT   +           T  RF + SA  G     LG +  LFQ    G + +RL    EK +I  G  A    F+L+    S +  Y  L L A      +  L  ++S      +  QG+L G+L S   L    GPL  + IF
Sbjct:    2 NKPAVIALVITLLDAMGIGLIMPVLPSLLREYLPEADVANHYGIL------------------------------LALYAVMQVCFAPLLGRWSDKLGRRPVLLLSLAGAAFDYTLLALS-NVLWMLYLGRIISGITGATGAVAASVVADSTAVSERTAWFGRLGAAFGAGLIAGPAIGGLAGDISPHLPFVIAAILNACTFLMVFFIFKPAVQTEEKPADEKQESAGISFI--------------------TLLKPLALLLFVFFTAQLIGQIPATVWVLFTESRFAWDSAAVGFSLAGLGAMHALFQAVVAGALAKRLS---EKTIIFAGFIADATAFLLMSAITSGWMVYPVLILLA-GGGIALPALQGIISA--GASAANQGKLQGVLVSLTNLTGVAGPLLFAFIF 355          
BLAST of major facilitator superfamily domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|P02980|TCR2_ECOLX (Tetracycline resistance protein, class B OS=Escherichia coli OX=562 GN=tetA PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.501e-16
Identity = 107/408 (26.23%), Postives = 176/408 (43.14%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGT------FFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGR-EKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIF 1332
            N S  I  V  L+D +    I+P+LP+L++ F + + D         ++ F  L++                     ++L Q + +P +G +SD FGR+ +L+L+  G  + Y     S   + L+ L R++ G+  A   VA +VI D    + R      +G +F LG I GPI+G  AG       FF  A+    L  +  + + F+F E+  K+ RD N  +++    Q  N + I L+  M  L            ++YF+   +           T  RF ++S   G     LGL+  +FQ  +  R+ +   EK  +++G  A    F  L F    +  +  L L A      +  L  ++S     KS QQG L GLL S       +GPL  ++I+
Sbjct:    2 NSSTKIALVITLLDAMGIGLIMPVLPTLLREF-IASED--------IANHFGVLLA--------------------LYALMQVIFAPWLGKMSDRFGRRPVLLLSLIGASLDYLLLAFSSALWMLY-LGRLLSGITGATGAVAASVIADTTSASQRVKWFGWLGASFGLGLIAGPIIGGFAGEISPHSPFFIAAL----LNIVTFLVVMFWFRET--KNTRD-NTDTEVGVETQ-SNSVYITLFKTMPILL-----------IIYFSAQLIGQIPATVWVLFTENRFGWNSMMVGFSLAGLGLLHSVFQAFVAGRIATKWGEKTAVLLGFIADSSAFAFLAFISEGWLVFPVLILLA-GGGIALPALQGVMS--IQTKSHQQGALQGLLVSLTNATGVIGPLLFAVIY 357          
BLAST of major facilitator superfamily domain-containing protein 10 vs. TrEMBL
Match: A0A1S3JJA4 (major facilitator superfamily domain-containing protein 10 OS=Lingula unguis OX=7574 GN=LOC106173799 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.263e-114
Identity = 192/435 (44.14%), Postives = 292/435 (67.13%), Query Frame = 1
Query:  124 KFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVV--------AGTFFNV-AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVI 1401
            K +K + ++F+ L+IDL++F  ILP+LPSL+  +       LY+V+  +    R+LI AP+    +WN VLFGGL+GS FSL QFL SP++GA SD +GRK +++L   G+ +SY+ W +S  NFT+F L+RI+GG+ K NI ++ A++ D+     R  GMA+IGIAFS+GF+IGP++G           G FF   A+ +  L  +N++F+   F E+L + KR  ++ SKL + Y LI P+S+F ++ + + K  DL   +++GLVYF+YLF+YSG+EFTLTFLTH RF Y S  QG+++ F+G+IM + QGG VRR+K G+EK++ ++GI  +IP F+++G + +    Y GL LF+FAS+ VV CLT+L+S     +  Q+G +MG+ RS G LAR LGP+ AS+++W  G    Y+IG  +L+ PL ++
Sbjct:   21 KSSKMVYVVFISLIIDLLAFTMILPLLPSLLDYYGHHDEGGLYHVLLQYVHSLRSLIGAPDTP--RWNSVLFGGLIGSLFSLLQFLASPMIGAASDYYGRKPLMLLNLIGIAVSYAIWAVS-TNFTIFVLARIVGGISKGNISLSTAIVTDISTPQTRGKGMALIGIAFSVGFLIGPLIGAYFAKQVREHEGMFFVAPALFALTLAVINVVFVYACFKETLPQEKRAHSVGSKLQEAYDLIQPVSLFKFSAVHHAKKSDLDQMQRIGLVYFSYLFLYSGLEFTLTFLTHNRFQYDSMKQGKMFFFIGIIMSIVQGGYVRRIKPGKEKKVALMGIGLVIPSFLVIGLASTTTVMYCGLALFSFASATVVPCLTTLMSSYG--QDDQKGTVMGIFRSLGALARALGPMAASIVYWSLGSTACYSIGGVLLVAPLLIL 450          
BLAST of major facilitator superfamily domain-containing protein 10 vs. TrEMBL
Match: A0A1S3IDZ8 (major facilitator superfamily domain-containing protein 10 OS=Lingula unguis OX=7574 GN=LOC106163111 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 8.453e-114
Identity = 192/435 (44.14%), Postives = 291/435 (66.90%), Query Frame = 1
Query:  124 KFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVV--------AGTFFNV-AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVI 1401
            K +K + ++F+ L+IDL++F  ILP+LPSL+  +       LY+V+  +    R+LI AP+    +WN VLFGGL+GS FSL QFL SP++GA SD +GRK +++L   G+ +SY+ W +S  NFT+F L+RI+GG+ K NI ++ A++ D+     R  GMA+IGIAFS+GF+IGP++G           G FF   A+ +  L  +N++F+   F E+L + KR  ++ SKL + Y LI P+S+F ++ + + K  DL   +++GLVYF YLF+YSG+EFTLTFLTH RF Y S  QG+++ F+G+IM + QGG VRR+K G+EK++ ++GI  +IP F+++G + +    Y GL LF+FAS+ VV CLT+L+S     +  Q+G +MG+ RS G LAR LGP+ AS+++W  G    Y+IG  +L+ PL ++
Sbjct:   21 KSSKMVYVVFISLIIDLLAFTMILPLLPSLLDYYGHHDEGGLYHVLLQYVHSLRSLIGAPDTP--RWNSVLFGGLIGSLFSLLQFLASPMIGAASDYYGRKPLMLLNLIGIAVSYAIWAVS-TNFTIFVLARIVGGISKGNISLSTAIVTDISTPQTRGKGMALIGIAFSVGFLIGPLIGAYFAKQVREHEGMFFVAPALFALTLAVINVVFVYACFKETLPQEKRAHSVGSKLQEAYDLIQPVSLFKFSAVHHAKKSDLDQMQRIGLVYFLYLFLYSGLEFTLTFLTHNRFQYDSMKQGKMFFFIGIIMSIVQGGYVRRIKPGKEKKVALMGIGLVIPSFLVIGLASTTTVMYCGLALFSFASATVVPCLTTLMSSYG--QDDQKGTVMGIFRSLGALARALGPMAASIVYWSLGSTACYSIGGVLLVAPLLIL 450          
BLAST of major facilitator superfamily domain-containing protein 10 vs. TrEMBL
Match: R7US77 (MFS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_171281 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 7.746e-108
Identity = 191/424 (45.05%), Postives = 284/424 (66.98%), Query Frame = 1
Query:  145 ILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTF------FN--VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL 1392
            ++F+ L++DL++F  ILP+LPSL+  +  +  D LY+++ +   GFR L+ AP+    +WN VLFGGL+GS FS  QFL SP++GA+SDV+GR+ +++L+T G+ ISY  W +S +NF+LF LSRIIGG+ K N+ ++ A++ D+     R  GMA+IGIAFS+GFIIGP++G            FN   A+ +  L  ++L++I  F  E+L   +R +++ S +   + LI+P+S+F +  ++N+  +DL+  +++G VYF YLF YSG+EFTLTFLTH RFNY S  QG+++ F+G+IM++ QGG VRRLKSGRE    +  +  LIP F+L+ F+Q     Y GL LFAFAS+ VV CLT+ +S     +  Q+G ++G+ RS G LAR LGP  A  ++W  G +  Y+IGA  L IPL
Sbjct:    4 VVFIALVLDLLAFTMILPLLPSLLDYYGNQDQDGLYSLLHSAVHGFRQLVGAPDTP--RWNSVLFGGLIGSMFSFLQFLASPLMGAMSDVYGRRPVVLLSTIGVGISYVIWAVS-HNFSLFVLSRIIGGISKGNVSISTAIVADISPPEKRGRGMAVIGIAFSVGFIIGPMIGAGFSVMNRNSVGFNSAPALFAIFLLSVDLLYIYCFLKETLPSERRMKSLGSGVKAAWPLISPLSLFKFEAVQNVPLQDLRRMQRVGGVYFLYLFFYSGLEFTLTFLTHNRFNYDSMKQGKMFFFIGIIMVIIQGGFVRRLKSGREISFSMKAMLTLIPAFLLVAFAQREIILYAGLSLFAFASAVVVPCLTTHISSYGTVE--QKGAVLGIFRSLGALARALGPAAACTLYWSVGAEACYSIGAVCLFIPL 422          
BLAST of major facilitator superfamily domain-containing protein 10 vs. TrEMBL
Match: A0A210PPI3 (Major facilitator superfamily domain-containing protein 10 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17277 PE=4 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 1.052e-107
Identity = 189/429 (44.06%), Postives = 280/429 (65.27%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV--------VAGTFFNV-AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIP 1389
            N+ + ILFV L+IDL++F  ILP+LPSL+  +  +  D LY  + N   GFR L+ AP+    +WN VLFGGL+GS FS+ QFL SP+VGA SD +GR+ +LI++  G+ ISY+ W +S +NF LF ++RIIGG+ K NI ++ AV+ D+  +  R  GMA+IG+AFS+GF+ GP++G           G F+   A+ +  L   ++IF+  FF E+L   KR ++++S   +   LINP+S+F ++ +  L   D Q  ++LG+VYF YLF+YSG+EFTLTFLTH R  Y S  QG+++ F+G +M L QG   RR      K M+  G+S L+P F+++ F+ S    Y+ L LFAFAS+ VV CLT+L+S+     S Q+G ++G+ RS G LAR LGP+ +S+++W CG ++ Y  G  +L+IP
Sbjct:   24 NRILAILFVSLVIDLLAFTVILPLLPSLLDFYGSQKEDQLYQSLMNSVRGFRELVGAPDTP--RWNSVLFGGLIGSLFSMLQFLASPVVGAASDAYGRRPILIVSMIGVAISYAVWAVS-HNFGLFVIARIIGGLSKGNISLSTAVVADILPQERRGKGMAMIGVAFSIGFVFGPLIGAGFSVWARQQDGAFYTPPALFALVLAVTDVIFVFLFFKETLPSDKRAKSVASGWQNTSHLINPVSLFKFSSVTKLSKTDSQTVQKLGVVYFIYLFLYSGLEFTLTFLTHNRLQYDSMQQGKMFFFIGTVMALVQGEWSRR------KGMLTQGMSLLMPAFVIMAFAHSAPMMYLALMLFAFASATVVPCLTTLISEYGG--SDQKGVVLGVFRSLGALARALGPVVSSVVYWSCGDKVCYLTGGVLLVIP 441          
BLAST of major facilitator superfamily domain-containing protein 10 vs. TrEMBL
Match: L7LXR9 (MFS domain-containing protein OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 2.408e-105
Identity = 188/440 (42.73%), Postives = 280/440 (63.64%), Query Frame = 1
Query:  124 KFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAMISTGLT--------------FLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVI 1401
            +  +++ I+F+YL+IDL+ F  ILP+LPS++  +S    D LY  +       +NLI AP++ N     VLFGG +G+ +S  QFL +P++G+LSDV+GRK ML LTT G+  SY+ W +S N+F LF LSRIIGG+ K NI ++ AVI D+     R  GMA+IG+AFS+GFI+GP++G         A+ S G T               L+++++S  FTESL + KR  +++S LS     +NP S+F + P++ L  +D Q  RQ GL YF+YL  YSG+E++L+FLTH RF+Y+   QG++Y  +GL+M   QGG V R+  G+E ++ ++GI  +IP FI++G S S +  Y GL L+AF+S  VV CLT+LVS+       Q+G ++G+ RS G LAR LGPL ++ ++W  GP + Y IG  + + PL ++
Sbjct:   10 RVPRTVYIIFIYLVIDLLGFTVILPLLPSILDYYSHHDKDGLYPWLEGCIKHLQNLIGAPSSLNK----VLFGGCIGALYSFLQFLTAPLIGSLSDVYGRKWMLTLTTCGVAFSYALWAVS-NSFALFVLSRIIGGISKGNISLSTAVIADVCNSKLRGKGMALIGVAFSIGFIVGPLIGA------QFAVASKGSTEFYVGPAVFALALALLDILYLSIMFTESLPREKRAHSVASSLSGALSYVNPASLFTFQPVQKLPLKDHQVLRQCGLAYFSYLLFYSGLEYSLSFLTHSRFHYTRMQQGKMYFAVGLVMAAVQGGYVHRVPPGKEIKVCLVGIMMIIPSFIIIGVSWSPYVLYCGLLLYAFSSGTVVPCLTTLVSKYGAPT--QKGTILGIFRSLGALARALGPLLSATVYWWAGPVVCYCIGGCLFIFPLLIL 436          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Cavefish
Match: mfsd10 (major facilitator superfamily domain containing 10 [Source:NCBI gene;Acc:103031219])

HSP 1 Score: 288.886 bits (738), Expect = 2.493e-92
Identity = 162/399 (40.60%), Postives = 261/399 (65.41%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV-----VAGT---FFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKH----RDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL 1392
            +T D++Y  + +  D FR ++  P     K+N VLFGGL+GS +SL QFL SP++GA+SD  GR+ +L+LTT G++ SY  W +S ++F++F LSR++GG+CK N+ +  AV+ DL     R+ GMA+IG+AFSLGF +GPI+G      +A T   +   A+++   +  +L+FI     E+L K  R  + +S + ++  L++P+++F ++ +   K     + + N + LG VYF YLF++SG+EFTL+FLTH RF +SS  QG+++ F+G+ M LFQGG  RR++  R+ + + + I  LIP F+L+G + +L   Y GLFL++FA++ VV CL++ VS   +  + Q+G +MG+LRS G LAR LGP+ AS ++W+ G ++ + I +   + PL
Sbjct:   47 QTGDSVYQSLQSIVDWFREIVGVPMET--KYNSVLFGGLIGSLYSLLQFLSSPVIGAVSDKHGRRPLLLLTTVGLIFSYILWAVS-HSFSIFLLSRVVGGLCKGNVSLCTAVVADLPCSKARSKGMAMIGVAFSLGFTLGPIMGAYFVLKLANTELFYQGPAVLAVVFSTADLLFIFLMLPETLHKDSRGSSDASGVQEVGDLLSPVALFNFSAVTRTKEPPSKQSMNNLKVLGWVYFAYLFLFSGLEFTLSFLTHQRFQFSSMQQGKMFFFIGITMALFQGGYARRIQPSRQIKTVRVAIILLIPAFLLIGLAHNLTMLYGGLFLYSFAAAIVVPCLSAQVS--GHGTASQKGTVMGILRSLGALARALGPILASSVYWLAGAEICFLISSVCFVAPL 440          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Cavefish
Match: mfsd10 (major facilitator superfamily domain containing 10 [Source:NCBI gene;Acc:103031219])

HSP 1 Score: 246.514 bits (628), Expect = 1.904e-76
Identity = 144/361 (39.89%), Postives = 230/361 (63.71%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV-----VAGT---FFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKH----RDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLR 1278
            +T D++Y  + +  D FR ++  P     K+N VLFGGL+GS +SL QFL SP++GA+SD  GR+ +L+LTT G++ SY  W +S ++F++F LSR++GG+CK N+ +  AV+ DL     R+ GMA+IG+AFSLGF +GPI+G      +A T   +   A+++   +  +L+FI     E+L K  R  + +S + ++  L++P+++F ++ +   K     + + N + LG VYF YLF++SG+EFTL+FLTH RF +SS  QG+++ F+G+ M LFQGG  RR++  R+ + + + I  LIP F+L+G + +L   Y GLFL++FA++ VV CL+   +Q      P   +L G  R
Sbjct:   47 QTGDSVYQSLQSIVDWFREIVGVPMET--KYNSVLFGGLIGSLYSLLQFLSSPVIGAVSDKHGRRPLLLLTTVGLIFSYILWAVS-HSFSIFLLSRVVGGLCKGNVSLCTAVVADLPCSKARSKGMAMIGVAFSLGFTLGPIMGAYFVLKLANTELFYQGPAVLAVVFSTADLLFIFLMLPETLHKDSRGSSDASGVQEVGDLLSPVALFNFSAVTRTKEPPSKQSMNNLKVLGWVYFAYLFLFSGLEFTLSFLTHQRFQFSSMQQGKMFFFIGITMALFQGGYARRIQPSRQIKTVRVAIILLIPAFLLIGLAHNLTMLYGGLFLYSFAAAIVVPCLS---AQVSGHGEPLFSKLYGSFR 401          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Cavefish
Match: hiat1a (hippocampus abundant transcript 1 protein-like [Source:NCBI gene;Acc:103039749])

HSP 1 Score: 62.003 bits (149), Expect = 6.003e-10
Identity = 82/333 (24.62%), Postives = 138/333 (41.44%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQG---GIVRRLKSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R++   ++   F+   +  P +G      +    V +++T +  L++ FI     ESL +  R  +  +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +LR    ++S         +G++ IL Q    GI+ R  S   K  I++G+   I      GF SQ    +  G    A  SS     ++++VS+  N    QQG + G++     L   LGP     +F++
Sbjct:   90 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW--------WYFAVISMSGVFAVTFSVIFAYVADITQEHERSTAYGLVSATFAASLVTSPAIGAYLSQAYGDTLVVILATAIALLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASL--RKVGQDSTVLLICITVFLSYLPEAGQYS-SFFLYLRQVIRFTSETVAAFIAVVGILSILAQTVVLGILMR--SIGNKNTILLGLGFQILQLAWYGFGSQPWMMWAAG--AVAAMSSITFPAISAIVSR--NADPDQQGVVQGMITGIRGLCNGLGPALYGFVFYL 395          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Cavefish
Match: hiat1b (major facilitator superfamily domain containing 14A [Source:NCBI gene;Acc:103031759])

HSP 1 Score: 61.6178 bits (148), Expect = 9.112e-10
Identity = 79/330 (23.94%), Postives = 134/330 (40.61%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R+    ++   F+   +  P +G      +    V ++++ +  L++ FI     ESL +  R  +  +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +LR    +S          LGL+ I+ Q  ++  L +S   K  I++G+   I      GF    +  +    + A  SS     +++LVS+  +    QQG   G++     L   LGP     IF+I
Sbjct:   89 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWW--------YFAVISVSGVFAVTFSVVFAYVADITEEHERSMAYGLVSATFAASLVTSPAIGAYLSRAYGDSLVVVLASAIAMLDICFILLAVPESLPEKMRPASWGA----------PISWEQADPFASL--RKVGQDSTVLLICITVFLSYLPEAGQYS-SFFLYLRQIMGFSPESVAAFIAVLGLLSIVAQTVVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAM-SSITFPAVSALVSRTADPD--QQGVGQGMITGIRGLCNGLGPALYGFIFYI 394          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Cavefish
Match: si:ch211-87m7.2 (hippocampus abundant transcript 1 protein [Source:NCBI gene;Acc:103035659])

HSP 1 Score: 59.3066 bits (142), Expect = 4.360e-9
Identity = 77/330 (23.33%), Postives = 136/330 (41.21%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R++   ++   F+   +  P +G      +    V +I+T +   +++F+     ESL    R  +             PIS     P  +L  R +     + L+  T    Y     +++ +F  +LR   N+S A        +G++ I+ Q  ++  L K    K  +++G+   +      GF    +  +    + A  SS     +++LVS+C +    QQG + G++     L   LGP     IF++
Sbjct:   85 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMRISPW--------WYFALISVSGVFSVTFSVIFAYVADITEEHERSTAYGLVSATFAASLVTSPAIGAYISAKYGDSLVVLIATIVAVADILFVLLVVPESLPDKMRLTSWG----------FPISWEQADPFGSL--RKVGKDPTVLLICVTVFLSYLPEAGQYS-SFFLYLRQVINFSPAAIAAFIAMVGILSIIAQTLLLSLLMKKIGNKNTVLLGLVFQLFQLAWYGFGSEPWMMWAAGTVAAL-SSITFPAVSALVSRCTDHD--QQGAVQGMITGIRGLCNGLGPALFGFIFFL 390          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Sea Lamprey
Match: mfsd10 (major facilitator superfamily domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-050417-154])

HSP 1 Score: 265.774 bits (678), Expect = 6.870e-84
Identity = 174/444 (39.19%), Postives = 276/444 (62.16%), Query Frame = 1
Query:   94 CVIKFLDMKIKFN-------KSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV-VAGT------FFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPM----KNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGA 1371
            C+  +  +++K N       + I ++FV L+IDL+ F  ILP+LPSL+  +       L+ ++    D F + +  P +  +  N VLFGGL+GS FSL QF+ SP+ GA SD +GR+SM++L+   +L SY  W +S ++F LF +SR +GG  KANI ++ A+I DL     R+ GMA +G AFS+GF+ GP +G  +AGT      FF  A+++      +++F++    E+L  ++R  ++ S +     L NP+++F ++ +    +   H+D+ + R+LG++YF Y+F+YSG+E+ L FLTH RFN++   QG++   +G+ M++ QGG VRRL  GRE  ++   +  LIP FIL+G++ +L   Y+GL L+AFAS+ VV CLT+ V+   +    Q+G LMG+LRS G LAR LGP+ A+  FW  G ++ +T GA
Sbjct:   14 CLCVYPPVRMKGNVEDRWADRVITVVFVALIIDLLGFTLILPLLPSLLDHYGSVEQGGLHQMLQEGVDWFADTVGIPEHERH--NSVLFGGLIGSLFSLLQFVSSPLFGAASDRYGRRSMMLLSMVLILASYGIWAVS-HSFGLFLVSRALGGASKANISLSTAIIADLP-LHKRSKGMAFVGAAFSIGFMFGPPLGAALAGTGSHGALFFMPALLAAAFAASDIVFLALLLPETLPPARRVPSVLSGIKGSSHLFNPVALFRFSAVQETGREAPHKDVVSLRRLGVIYFLYIFLYSGLEYNLGFLTHTRFNFTRMQQGKMLFAVGVAMVIIQGGYVRRLSPGREMAVVQRALLLLIPAFILIGWAPTLPVLYVGLLLYAFASATVVPCLTTAVASYGSPS--QKGVLMGILRSLGSLARALGPVLAASAFWGTGARVCFTTGA 451          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Sea Lamprey
Match: hiat1b (hippocampus abundant transcript 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2935])

HSP 1 Score: 59.3066 bits (142), Expect = 6.283e-10
Identity = 41/156 (26.28%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPIS 831
            P++GALSDV+GRKS L+LT         L+  S W         +F    + G+      V  A + D+  E  R+S   ++   F+   +  P +G    T +    V  ++TG+  L++ FI     ESL +  R  +  + +S  ++  +P +
Sbjct:   89 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMRISPWW--------YFAIISVSGIFSVTFSVVFAYVADVTPEHERSSAYGLVSATFAASLVTSPAIGAYLSTAYGDGLVVALATGVALLDIAFILVAVPESLPEKMRPASWGAPIS--WEQADPFA 234          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Nematostella
Match: EDO49252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX9])

HSP 1 Score: 286.189 bits (731), Expect = 2.026e-91
Identity = 170/430 (39.53%), Postives = 280/430 (65.12%), Query Frame = 1
Query:  130 NKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVV--------AGTFFNV-AMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL 1392
            N+++  +F  L+IDL++F  ILP+LPSL++ +    +D+LYN +    + F+ ++  P+    ++N VLFGG++GS FSL QF+C P++GA SD+FGR+  L+L+  G+L SY  W +S+N FT+F ++R+IGG+CK N+ +  A + D+     R+ GMA++G+A+S+GFI+GP++G V        +  F+ + A+ +  L+ ++++ +  FF E+L   KR +++  +       INP+S+F ++ ++     +LQ  R +G VYF +LF +SG+EFTLTFLTH  F Y+S +QG ++ ++G +M   QGG VRRL +G EK+  + GI+ +IPG IL+G +++ F  Y GL LF++ S+ VV CLT+L+S+  ++   Q+GR+MG+ RS G LAR + P     ++W  G   +Y  GA   L+PL
Sbjct:   43 NRALFTIFASLVIDLLAFTVILPLLPSLLELYGRHNDDSLYNFLMEQVNSFKAMMGMPDVG--RFNAVLFGGVVGSLFSLLQFICCPLIGAASDLFGRRITLLLSMIGVLFSYVIWAVSKN-FTIFVIARVIGGLCKGNVTICTAAVTDVTSSKTRSKGMALVGVAYSIGFIVGPMIGAVFASKSSGSSEPFYQLPALFAIVLSAVDIVIVFLFFKETLPTEKRAKSLIHECQKSLLYINPVSLFKFSALEGSSDAELQTVRAIGRVYFLFLFFFSGLEFTLTFLTHKNFQYTSMNQGMMFFYVGSVMATVQGGYVRRLPAGAEKKTAVQGIAVIIPGMILVGLAKTTFILYAGLTLFSYGSAVVVPCLTALISRYGSED--QKGRVMGIFRSLGALARGIAPFVFCTVYWSVGAFWSYVCGASCFLLPL 467          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Nematostella
Match: EDO44323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVZ1])

HSP 1 Score: 62.3882 bits (150), Expect = 2.083e-10
Identity = 76/324 (23.46%), Postives = 141/324 (43.52%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYL-FVYSGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGRE-KQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWI 1338
            P++GALSDV+GRKS L+LT   +  +     L + N   FF    + G+      +  A + D   +  R++   ++   F+   II P +G      +N   V  ++T +  L+++F+     ESL +  R  +  +          PIS     P  +L+    Q+   L L    +L ++    +++  FL +L+   ++S  D       LG++ ++ Q  ++  LK     K  ++IG+   +      G     +  +    L A  +      +++LVS C N +S QQG + G++     L   +GP     IF++
Sbjct:   94 PLLGALSDVWGRKSFLLLT---VFFTCCPLPLLKFNPWWFFAMISVSGIFSVTFSIVFAYVADCTEQNERSTAYGLVSATFAASLIISPALGAYLSKTYNDNLVVALATAIAALDILFVLVVVPESLPERMRPASWGA----------PISWEQADPFSSLRKVG-QDPTVLLLAMTVFLSYLPEAGQYSCMFL-YLKQVIHFSDEDVATFIAVLGILSVIAQTLVLACLKKSIGLKNSVLIGLIFQVLQLSWYGLGTQRWMMWAAGSL-ASVAMITYPSISALVS-C-NAESDQQGVVQGIITGIRGLCNGIGPALFGFIFYL 399          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Nematostella
Match: EDO46735 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPG8])

HSP 1 Score: 58.9214 bits (141), Expect = 1.976e-9
Identity = 80/327 (24.46%), Postives = 146/327 (44.65%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVG----VVAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSK----RDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQ-NARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYL--FLGLIMIL---FQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASL 1326
            P+VG  SDV GRK +L+++  G   +Y    LS +   +  L+RI  G+ K +  +  A + D+     R S         SLGF++GP++G    +    FF V ++  G+ F+ +   ++   E  ++ +    +D   +S+ S+     N       + ++    R LQ N +   L+   +L  +S + F   F T L F Y++  +   Y+  F G++  L   F G ++    +   K ++    S L      + FS  L+   + +   AF+S+   +C T+L       ++ ++G L+G+  S    AR L P    L
Sbjct:   66 PLVGKFSDVAGRKKVLLVSLLGTGAAYLLHGLSVS-LIMLALTRIPIGLFKQSQSLCKACLADITAPAQRISVFGKFNAFSSLGFVVGPLIGGHLAMTDNGFFRVFLLE-GILFVAMTIFTWLCIEHDDQQQSSPNKDVGTASESSEFDGARN-------SEIQTKSGRKLQENLKIANLLIVRFLMGFSMIIFRSNFSTVLEFRYNTTPKTNGYIMSFNGIVGGLSGYFVGNLLTFYNNDDAKALLHFS-SILAMSIFCVTFSPELWVLVVFIAPLAFSSAVSRVCSTNLT--LKRGRADEKGLLLGVGNSLMSFARMLSPTLGGL 380          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Medaka
Match: mfsd10 (major facilitator superfamily domain containing 10 [Source:NCBI gene;Acc:101168716])

HSP 1 Score: 287.73 bits (735), Expect = 6.693e-92
Identity = 174/403 (43.18%), Postives = 254/403 (63.03%), Query Frame = 1
Query:  232 RTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGV-------VAGTFF--NVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLK----HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVI 1401
            +T D  Y  + N    FR  +  P     K+N VLFGGL+GS FSL QFL SP+ G LSD  GR+ +LILTT G++ SY  W +S + F++F L R+IGG+ K N+ +  AV+ DL     RN GMA+IGIAFS+GF +GP++G          G+ F    A+I+   +  +L+ I     E+L  +K  +  SS   D   L++P+S+F +T +   K       +Q  + LGLVYF+YLF++SG+EFTL+FLTH RF ++S  QG+++ F+G+IM L QGG  RR+K G+  + +   I ALIP FIL+GFS ++   YIGL L++FA++ VV CL++LVS  D   + Q+G +MG+LRS GCLAR LGP+ +S ++WI G Q  + + +   +IPL ++
Sbjct:   46 QTGDATYQSLQNVVGWFRAAVGIPMEK--KYNTVLFGGLVGSLFSLLQFLSSPVTGVLSDRHGRRPLLILTTVGLISSYVVWAVSRS-FSMFLLFRVIGGIFKGNVSLCTAVVADLPCPKARNRGMAMIGIAFSVGFTVGPLMGAYFAIASRTTGSVFYQTPALIALAFSVADLLVIWLMLPETL--TKNVQAASSGTGDSRDLLSPLSLFHFTAITRTKDPPSRERMQKLQVLGLVYFSYLFLFSGLEFTLSFLTHQRFQFTSMQQGKMFFFIGIIMALIQGGYARRIKQGQHIRAVSTAIVALIPAFILIGFSWNMTMLYIGLALYSFAAAVVVPCLSTLVS--DYGSASQKGTVMGILRSLGCLARALGPVVSSSVYWIAGAQACFLLTSAAFVIPLALL 441          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Medaka
Match: hiat1a (major facilitator superfamily domain containing 14A [Source:NCBI gene;Acc:101168989])

HSP 1 Score: 61.2326 bits (147), Expect = 1.333e-9
Identity = 81/342 (23.68%), Postives = 143/342 (41.81%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQGGIVRRL-KSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGA 1371
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R++   ++   F+   +  P +G      +    V +++T +  L++ FI     ESL +  R  +  +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +L+    ++S         +G++ IL Q  ++  L +S   K  I++G+   I      GF SQ    +  G    A  SS     ++++VS+  +    QQG + G++     L   LGP     +F++   +L  T G+
Sbjct:   91 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW--------WYFAVISMSGVFAVTFSVIFAYVADITQEHERSTAYGLVSATFAASLVTSPAIGAYLSVAYGDTLVVILATAIALLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASL--RKVGQDSTVLLICITVFLSYLPEAGQYS-SFFLYLKQVIGFTSETVAAFIAVVGILSILAQTVVLGILMRSIGNKNTILLGLGFQILQLAWYGFGSQPWMMWAAG--AVAAMSSITFPAISAIVSRSADPD--QQGVVQGMITGIRGLCNGLGPALYGFVFYLFHVELNDTDGS 407          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Medaka
Match: hiat1a (major facilitator superfamily domain containing 14A [Source:NCBI gene;Acc:101168989])

HSP 1 Score: 60.4622 bits (145), Expect = 1.975e-9
Identity = 83/344 (24.13%), Postives = 143/344 (41.57%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQG---GIVRRLKSGREKQMIIIGISALIPGFILLGF-SQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGA 1371
            P++GALSDV+GRKS L+LT         L+  S W         +F    + GV      V  A + D+  E  R++   ++   F+   +  P +G      +    V +++T +  L++ FI     ESL +  R  +  +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +L+    ++S         +G++ IL Q    GI+ R  S   K  I++G+   I      GF SQ    +  G    A  SS     ++++VS+  +    QQG + G++     L   LGP     +F++   +L  T G+
Sbjct:   90 PLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW--------WYFAVISMSGVFAVTFSVIFAYVADITQEHERSTAYGLVSATFAASLVTSPAIGAYLSVAYGDTLVVILATAIALLDICFILVAVPESLPEKMRPASWGA----------PISWEQADPFASL--RKVGQDSTVLLICITVFLSYLPEAGQYS-SFFLYLKQVIGFTSETVAAFIAVVGILSILAQTVVLGILMR--SIGNKNTILLGLGFQILQLAWYGFGSQPWMMWAAG--AVAAMSSITFPAISAIVSRSADPD--QQGVVQGMITGIRGLCNGLGPALYGFVFYLFHVELNDTDGS 406          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Medaka
Match: ENSORLT00000019091.2 (hippocampus abundant transcript 1 protein [Source:NCBI gene;Acc:101163345])

HSP 1 Score: 53.5286 bits (127), Expect = 2.930e-7
Identity = 71/328 (21.65%), Postives = 131/328 (39.94%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQ-GGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIF 1332
            P++GALSDV+GR+S L++T         L+  S W         +F    + G       V  A + D+  E  R++   ++   F+   +  P +G     ++    V +++T +   ++ FI     ESL    R     +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +LR   N+SS         +G++ I+ Q   +   +++   K  +++G+   I      G     +  +    + A  SS     +++LVSQ  +    +QG + G++     L   LGP     IF
Sbjct:   87 PLIGALSDVWGRRSFLLITVFFTCAPIPLMRLSPW--------WYFAMISMSGAFSVTFSVIFAYVADVTDERERSTAYGLVSATFAASLVTSPAIGAYLSAWYGDNLVVLLATLIALADICFILLAVPESLPDKMRPNTWGA----------PISWEYADPFASL--RKVGQDPTVLLICITVFLSYLPEAGQYS-SFFLYLRQVINFSSTTIAVFIGVVGILSIIAQTLLLTLLMRTMGTKNTVLLGLGFQILQLAWYGLGSEPWMMWAAGAVAAM-SSITFPAVSALVSQSADAD--KQGVVQGMITGIRGLCNGLGPALYGFIF 390          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Medaka
Match: ENSORLT00000041316.1 (hippocampus abundant transcript 1 protein [Source:NCBI gene;Acc:101163345])

HSP 1 Score: 53.5286 bits (127), Expect = 3.102e-7
Identity = 71/328 (21.65%), Postives = 131/328 (39.94%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILT-----TTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVY--SGMEFTLTFLTHLR--FNYSSADQGRLYLFLGLIMILFQ-GGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIF 1332
            P++GALSDV+GR+S L++T         L+  S W         +F    + G       V  A + D+  E  R++   ++   F+   +  P +G     ++    V +++T +   ++ FI     ESL    R     +          PIS     P  +L  R +     + L+  T    Y     +++ +F  +LR   N+SS         +G++ I+ Q   +   +++   K  +++G+   I      G     +  +    + A  SS     +++LVSQ  +    +QG + G++     L   LGP     IF
Sbjct:  101 PLIGALSDVWGRRSFLLITVFFTCAPIPLMRLSPW--------WYFAMISMSGAFSVTFSVIFAYVADVTDERERSTAYGLVSATFAASLVTSPAIGAYLSAWYGDNLVVLLATLIALADICFILLAVPESLPDKMRPNTWGA----------PISWEYADPFASL--RKVGQDPTVLLICITVFLSYLPEAGQYS-SFFLYLRQVINFSSTTIAVFIGVVGILSIIAQTLLLTLLMRTMGTKNTVLLGLGFQILQLAWYGLGSEPWMMWAAGAVAAM-SSITFPAVSALVSQSADAD--KQGVVQGMITGIRGLCNGLGPALYGFIF 404          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000066785.1 (SMESG000066785.1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 429/432 (99.31%), Postives = 429/432 (99.31%), Query Frame = 1
Query:  115 MKIKFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVXXXXXXXXXXXXXXXXXXPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLTVIVFI 1410
            MKIKFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVLFGGLLGSSFSLCQFLCSPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAMISTGLT LNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQS FYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPL VIVFI
Sbjct:    1 MKIKFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMSNFSDGFRNLISAPNNNNNKWNIVLFGGLLGSSFSLCQFLCSPIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAMISTGLTLLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLKHRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFLGLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSRFYFYIGLFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPLFASLIFWICGPQLTYTIGAFILLIPLAVIVFI 432          
BLAST of major facilitator superfamily domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000009972.1 (SMESG000009972.1)

HSP 1 Score: 58.9214 bits (141), Expect = 5.033e-9
Identity = 41/139 (29.50%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  388 PIVGALSDVFGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIAVIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFN---VAMISTGLTFLNLIFISFFFTESLEKSKRDRNMSSK 795
            P++GA+SDVFGRK  L+LT T    + S   L + +   +F    I G+      V  A + D+  E  R+    ++   F+   +I P +G   G  ++   V  ++T +  L++ FI     ESL +S R  + S K
Sbjct:   78 PLIGAMSDVFGRKPFLLLTVT---FTCSPIPLMKLSHWWYFTMISISGIFAVTFSVIFAYVADVTKEEERSWAYGLVSATFAASLVISPTIGAYLGKIYSDNFVIALATAVALLDIFFILACVPESLPESCRVVSSSGK 213          
The following BLAST results are available for this feature:
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD109.422e-6538.60major facilitator superfamily domain containing 10... [more]
MFSD109.422e-6538.60major facilitator superfamily domain containing 10... [more]
MFSD101.182e-5938.44major facilitator superfamily domain containing 10... [more]
MFSD101.567e-4838.06major facilitator superfamily domain containing 10... [more]
MFSD102.617e-3937.98major facilitator superfamily domain containing 10... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F10D7.22.251e-8037.83pep chromosome:WBcel235:X:17364646:17368642:-1 gen... [more]
T25D3.43.979e-931.51pep chromosome:WBcel235:II:147241:152825:1 gene:WB... [more]
T25D3.44.308e-925.30pep chromosome:WBcel235:II:148372:152582:1 gene:WB... [more]
T25D3.45.103e-931.51pep chromosome:WBcel235:II:147243:152582:1 gene:WB... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtet3.594e-8940.60gene:FBgn0028468 transcript:FBtr0084009[more]
CG50785.175e-921.28gene:FBgn0037005 transcript:FBtr0078208[more]
CG115371.402e-722.39gene:FBgn0035400 transcript:FBtr0073115[more]
CG115371.518e-621.88gene:FBgn0035400 transcript:FBtr0309235[more]
CG115371.782e-621.88gene:FBgn0035400 transcript:FBtr0333894[more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd104.016e-9642.54major facilitator superfamily domain containing 10... [more]
hiat1a5.301e-1024.62hippocampus abundant transcript 1a [Source:ZFIN;Ac... [more]
hiat1b1.000e-923.40hippocampus abundant transcript 1b [Source:ZFIN;Ac... [more]
si:ch211-87m7.22.716e-923.75si:ch211-87m7.2 [Source:ZFIN;Acc:ZDB-GENE-120215-1... [more]
si:ch211-87m7.23.197e-923.75si:ch211-87m7.2 [Source:ZFIN;Acc:ZDB-GENE-120215-1... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef26.190e-8840.42Rho/Rac guanine nucleotide exchange factor 2 [Sour... [more]
arhgef22.256e-8038.57Rho/Rac guanine nucleotide exchange factor 2 [Sour... [more]
arhgef23.287e-8039.03Rho/Rac guanine nucleotide exchange factor 2 [Sour... [more]
mindy28.800e-1223.78to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
mindy21.515e-1123.78to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfsd105.339e-7336.88major facilitator superfamily domain containing 10... [more]
Mfsd105.339e-7336.88major facilitator superfamily domain containing 10... [more]
Mfsd105.339e-7336.88major facilitator superfamily domain containing 10... [more]
Mfsd101.871e-2735.00major facilitator superfamily domain containing 10... [more]
Mfsd101.950e-2736.32major facilitator superfamily domain containing 10... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0P5M9|MFS10_BOVIN3.431e-7237.59Major facilitator superfamily domain-containing pr... [more]
sp|Q9D2V8|MFS10_MOUSE3.734e-7236.88Major facilitator superfamily domain-containing pr... [more]
sp|Q14728|MFS10_HUMAN4.525e-6438.60Major facilitator superfamily domain-containing pr... [more]
sp|P33733|TCR4_SALOR4.875e-1826.03Tetracycline resistance protein, class D OS=Salmon... [more]
sp|P02980|TCR2_ECOLX7.501e-1626.23Tetracycline resistance protein, class B OS=Escher... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JJA43.263e-11444.14major facilitator superfamily domain-containing pr... [more]
A0A1S3IDZ88.453e-11444.14major facilitator superfamily domain-containing pr... [more]
R7US777.746e-10845.05MFS domain-containing protein OS=Capitella teleta ... [more]
A0A210PPI31.052e-10744.06Major facilitator superfamily domain-containing pr... [more]
L7LXR92.408e-10542.73MFS domain-containing protein OS=Rhipicephalus pul... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd102.493e-9240.60major facilitator superfamily domain containing 10... [more]
mfsd101.904e-7639.89major facilitator superfamily domain containing 10... [more]
hiat1a6.003e-1024.62hippocampus abundant transcript 1 protein-like [So... [more]
hiat1b9.112e-1023.94major facilitator superfamily domain containing 14... [more]
si:ch211-87m7.24.360e-923.33hippocampus abundant transcript 1 protein [Source:... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mfsd106.870e-8439.19major facilitator superfamily domain containing 10... [more]
hiat1b6.283e-1026.28hippocampus abundant transcript 1b [Source:ZFIN;Ac... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO492522.026e-9139.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443232.083e-1023.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467351.976e-924.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd106.693e-9243.18major facilitator superfamily domain containing 10... [more]
hiat1a1.333e-923.68major facilitator superfamily domain containing 14... [more]
hiat1a1.975e-924.13major facilitator superfamily domain containing 14... [more]
ENSORLT00000019091.22.930e-721.65hippocampus abundant transcript 1 protein [Source:... [more]
ENSORLT00000041316.13.102e-721.65hippocampus abundant transcript 1 protein [Source:... [more]
back to top
BLAST of major facilitator superfamily domain-containing protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000066785.10.000e+099.31SMESG000066785.1[more]
SMESG000009972.15.033e-929.50SMESG000009972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010016 ID=SMED30010016|Name=major facilitator superfamily domain-containing protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1476bp
TGTGAATTGTTTGATTAGAAACTTTATAAGTTGTTTGAATTTTTTTGCTC
ATATTAATTGTATTAATAGAAATAATAAAAATACTTCGTTTTTTGTGTTA
TTAAGTTTTTAGATATGAAAATTAAATTTAACAAATCAATCTTGATATTA
TTTGTTTATTTACTTATTGATCTGATTTCATTTGCTAGTATTTTACCCAT
TCTGCCATCATTAGTTCAATCATTTTCATTGAGAACAAATGATAATTTGT
ACAATGTAATGAGTAATTTCAGTGATGGGTTTCGAAACTTGATTAGTGCA
CCTAATAATAATAATAACAAATGGAATATAGTATTATTTGGAGGATTGTT
GGGATCAAGTTTTTCTCTGTGTCAATTTCTGTGTTCTCCTATTGTTGGTG
CATTATCAGATGTATTTGGCAGAAAGTCAATGCTAATTTTAACTACGACT
GGAATGTTGATTTCGTACTCTGCCTGGTGTTTATCGGAAAATAATTTCAC
GTTATTTTTCCTCAGTCGTATAATTGGAGGCGTGTGTAAAGCCAATATCG
GTGTCGCTATAGCTGTCATTGGAGATCTTTATGGGGAAACGAATCGCAAT
TCTGGAATGGCAATTATCGGAATAGCATTTAGTCTGGGATTTATAATCGG
TCCAATTGTCGGAGTTGTAGCTGGAACATTTTTCAATGTTGCTATGATTT
CCACCGGATTGACGTTTCTCAATTTGATTTTCATTTCGTTTTTCTTCACT
GAATCTCTCGAGAAATCGAAACGCGATCGCAACATGTCCAGCAAATTGTC
CGATATTTATCAATTAATAAACCCGATTTCTATATTTTTATATACTCCGA
TGAAAAATCTTAAACATCGAGATTTGCAAAATGCCCGTCAACTTGGACTT
GTTTATTTCACTTACCTGTTTGTTTACTCTGGCATGGAATTCACATTAAC
ATTTTTGACACATCTTAGATTTAACTATTCGAGTGCTGACCAGGGTCGCT
TATACCTTTTTTTGGGTCTCATCATGATTCTATTTCAAGGTGGAATTGTT
AGACGTTTAAAATCAGGTCGAGAGAAACAAATGATTATTATAGGAATATC
GGCATTGATACCCGGTTTTATTCTTTTGGGATTTTCTCAATCTCTCTTCT
ACTTCTATATCGGATTATTTCTATTTGCATTTGCTTCGAGTTGTGTTGTA
CTGTGTCTCACTTCATTAGTATCTCAATGTGACAATAAAAAATCTCCACA
ACAAGGACGTCTTATGGGTCTCCTTCGATCACAAGGTTGTTTGGCGCGAT
GTTTGGGCCCATTGTTTGCATCTTTGATCTTTTGGATATGTGGGCCCCAG
CTGACTTATACGATTGGTGCATTTATTTTGCTTATTCCCTTGACCGTTAT
TGTGTTTATATAATTGGTCAATCCATGTTCCACACTCAAGCTTTCAGTGA
TTTGTCTTTTTGATAGTATTTGCATG
back to top

protein sequence of SMED30010016-orf-1

>SMED30010016-orf-1 ID=SMED30010016-orf-1|Name=SMED30010016-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MKIKFNKSILILFVYLLIDLISFASILPILPSLVQSFSLRTNDNLYNVMS
NFSDGFRNLISAPNNNNNKWNIVLFGGLLGSSFSLCQFLCSPIVGALSDV
FGRKSMLILTTTGMLISYSAWCLSENNFTLFFLSRIIGGVCKANIGVAIA
VIGDLYGETNRNSGMAIIGIAFSLGFIIGPIVGVVAGTFFNVAMISTGLT
FLNLIFISFFFTESLEKSKRDRNMSSKLSDIYQLINPISIFLYTPMKNLK
HRDLQNARQLGLVYFTYLFVYSGMEFTLTFLTHLRFNYSSADQGRLYLFL
GLIMILFQGGIVRRLKSGREKQMIIIGISALIPGFILLGFSQSLFYFYIG
LFLFAFASSCVVLCLTSLVSQCDNKKSPQQGRLMGLLRSQGCLARCLGPL
FASLIFWICGPQLTYTIGAFILLIPLTVIVFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR005829Sugar_transporter_CS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 13..399
e-value: 2.1E-40
score: 138.7
NoneNo IPR availablePANTHERPTHR23504FAMILY NOT NAMEDcoord: 7..427
NoneNo IPR availablePANTHERPTHR23504:SF31MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN 10coord: 7..427
NoneNo IPR availableCDDcd17389MFS_MFSD10coord: 9..429
e-value: 2.75915E-132
score: 384.318
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 166..188
NoneNo IPR availableTMHMMTMhelixcoord: 72..94
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
NoneNo IPR availableTMHMMTMhelixcoord: 260..282
NoneNo IPR availableTMHMMTMhelixcoord: 412..431
NoneNo IPR availableTMHMMTMhelixcoord: 324..343
NoneNo IPR availableTMHMMTMhelixcoord: 295..312
NoneNo IPR availableTMHMMTMhelixcoord: 101..121
NoneNo IPR availableTMHMMTMhelixcoord: 193..215
NoneNo IPR availableTMHMMTMhelixcoord: 348..370
NoneNo IPR availableTMHMMTMhelixcoord: 391..408
IPR005829Sugar transporter, conserved sitePROSITEPS00216SUGAR_TRANSPORT_1coord: 94..111
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 8..432
score: 20.353
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 6..431