ATP-binding cassette sub-family A member 1

Overview
NameATP-binding cassette sub-family A member 1
Smed IDSMED30010001
Length (bp)692
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette sub-family A member 1 (SMED30010001) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member 1 (SMED30010001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette sub-family A member 1 (SMED30010001) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member 1 (SMED30010001) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010001SMESG000065299.1 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010001SMESG000032891.1 SMESG000032861.1 SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010001SMESG000032896.1 SMESG000032891.1 SMESG000032861.1 SMESG000029537.1 SMESG000029534.1 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30010001SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010001SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010001SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30010001SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010001SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30010001SMESG000032891.1 SMESG000029537.1 Contig8654newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010001SMESG000032891.1 SMESG000029537.1 Contig8654uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30010001SMESG000032896.1 SMESG000032891.1 SMESG000032861.1 SMESG000029537.1 SMESG000029534.1 PL06020A1B11ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30010001SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 193.356 bits (490), Expect = 6.129e-56
Identity = 99/205 (48.29%), Postives = 135/205 (65.85%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R       T + + VK +++       +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2167 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVR-------TKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKK 2363          

HSP 2 Score: 100.138 bits (248), Expect = 1.566e-23
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY 396
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y
Sbjct: 1107 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1216          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 193.356 bits (490), Expect = 6.129e-56
Identity = 99/205 (48.29%), Postives = 135/205 (65.85%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R       T + + VK +++       +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2168 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVR-------TKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKK 2364          

HSP 2 Score: 100.138 bits (248), Expect = 1.551e-23
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY 396
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y
Sbjct: 1108 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1217          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 193.356 bits (490), Expect = 6.129e-56
Identity = 99/205 (48.29%), Postives = 135/205 (65.85%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R       T + + VK +++       +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2168 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVR-------TKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKK 2364          

HSP 2 Score: 100.138 bits (248), Expect = 1.581e-23
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY 396
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y
Sbjct: 1108 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1217          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 193.356 bits (490), Expect = 6.822e-56
Identity = 99/205 (48.29%), Postives = 135/205 (65.85%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R       T + + VK +++       +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2198 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVR-------TKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKK 2394          

HSP 2 Score: 100.138 bits (248), Expect = 1.741e-23
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY 396
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y
Sbjct: 1138 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1247          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA3 (ATP binding cassette subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:33])

HSP 1 Score: 191.43 bits (485), Expect = 3.602e-55
Identity = 98/198 (49.49%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR L L PHA KL +  SGGNKRKLST IALIG P VIFLDEP++GMD  ARR LW+ + +     K A+I+TSH+MEECEALC RL+IMV G+ KCLGS QHLKSKFG  Y ++ ++ S E +    E+ K  +   F   V L DE+   + Y    + +   K+F   E+ K    + DYS+SQ++LE VF++ A
Sbjct: 1441 LRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGK-AIIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLRAKVQS-EGQQEALEEFKAFVDLTFPGSV-LEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFA 1635          

HSP 2 Score: 107.071 bits (266), Expect = 6.052e-26
Identity = 64/183 (34.97%), Postives = 102/183 (55.74%), Query Frame = 1
Query:  109 LSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LSGG +RKLS  IALI   KV+ LDEPTSGMDA +RR +W+++Q+  ++  I  +LT+H M+E + L  R++IM  GE++C GS   LK K+G  Y++ +     +    N E + +++    + + +L     A L +     S  R   LF   E+ +    I  +  S  T+E+VF+ + 
Sbjct:  607 LSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSDRTI--VLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLV----KEPHCNPEDISQLVHH-HVPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTMEEVFLRVG 782          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 155.221 bits (391), Expect = 4.519e-43
Identity = 80/190 (42.11%), Postives = 121/190 (63.68%), Query Frame = 1
Query:   85 HATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +A++  +  SGGNKR+LS  IA++G P V+ LDEPTSG+D  ARR +WN++ ++ +    A++LTSH+M+ECEALC  L+IMV G+ +C GS QH+KS++G  Y + IRL +     N+ EK K  I++ F   V +++E+   L +        + +LFE  E +  +    DYS+SQ TLE VFI  +
Sbjct: 1573 YASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRLRDLGT-ALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLKN----RNDAEKTKSTIKQTFRGSV-IKEEHVLQLNFDIPRDGDSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFS 1756          

HSP 2 Score: 117.472 bits (293), Expect = 5.606e-30
Identity = 74/203 (36.45%), Postives = 112/203 (55.17%), Query Frame = 1
Query:   49 CRHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIR-IF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
             R  L  L +   A  +   LSGG KRKLS AIALIG  +V+ LDEPTSGMD GAR   W +IQ+   + +  ++LT+H MEE + L  R++IM +G+++C GS   LK ++GD Y++ I   +    T +  K   II+E ++ +  +         Y   +  R IF KLF+  E  +    I  + +S  T+E+VF+ + 
Sbjct:  709 AREILARLRIDFKADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWTLIQR--EKERRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVYDT--TSTPDVSKTTDIIRE-YIPEAHVFSYIGQEATYLLSATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVG 906          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 150.984 bits (380), Expect = 1.516e-41
Identity = 82/203 (40.39%), Postives = 126/203 (62.07%), Query Frame = 1
Query:   70 LSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF---------KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            L L P+A   T +LSGGN+RKLS A+AL+  P +IFLDEP++GMD G+++FLW VI+++    K AV+LTSH+MEECEALC R++IM  G ++CLG  QHLKSK+G    + +++   E    N +++  I++   L D S        ++   CS I I          ++ E   Q+K    + D++++Q TL++VF ++A
Sbjct: 1924 LHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDE----NAKEIAGIMRSK-LGDGS-------RVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIA 2113          

HSP 2 Score: 80.4925 bits (197), Expect = 3.534e-17
Identity = 37/90 (41.11%), Postives = 60/90 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIM 330
            L ++SLT  A KL   LSGG KR+L   IA IG  + + LDEPT+G+D  AR+ +W ++Q+  N+    ++L++H+M+E + L  R++I+
Sbjct: 1045 LASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQR--NKEGRTILLSTHHMDEADVLSDRIAIL 1132          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 150.984 bits (380), Expect = 1.620e-41
Identity = 81/203 (39.90%), Postives = 126/203 (62.07%), Query Frame = 1
Query:   70 LSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKI---------RIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            L L P+A   T +LSGGN+RKLS A+AL+  P +IFLDEP++GMD G+++FLW VI+++    K AV+LTSH+MEECEALC R++IM  G ++CLG  QHLKSK+G    + +++   E    N +++  I++   L D S        ++   CS I          + ++ E   Q+K    + D++++Q TL++VF ++A
Sbjct: 1887 LHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDE----NAKEIAGIMRSK-LGDGS-------RVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIA 2076          

HSP 2 Score: 80.4925 bits (197), Expect = 3.430e-17
Identity = 37/90 (41.11%), Postives = 60/90 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIM 330
            L ++SLT  A KL   LSGG KR+L   IA IG  + + LDEPT+G+D  AR+ +W ++Q+  N+    ++L++H+M+E + L  R++I+
Sbjct: 1008 LASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQR--NKEGRTILLSTHHMDEADVLSDRIAIL 1095          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-5 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9XW49])

HSP 1 Score: 129.798 bits (325), Expect = 3.543e-34
Identity = 82/226 (36.28%), Postives = 120/226 (53.10%), Query Frame = 1
Query:   43 ISCRHKLRNLS--------------------LTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKA---TKTILDYSISQMTLEDVFINL 648
            ISCR  LR ++                    ++    KL +N SGG KRK+S  IAL+     I LDEPT+G+D  ARR +W++I +M  + K +++LTSH+MEECEALC R+ I+  GEM  LG+ Q LKS++G+ Y + + L+S E    + E V  I+ E     V    E+  T    +   K +  K  E + Q++         DY ++Q +LED FI L
Sbjct: 1332 ISCRQTLRIMAKLQGYPNVKEVVELVLDCVGMSDFGYKLVKNCSGGQKRKISVGIALMSRATCIILDEPTAGIDPRARREIWDIIHEMREQAKCSIVLTSHSMEECEALCTRIGILRKGEMIALGTSQSLKSQYGNTYMMTLILNSLE----DLESVCVIVSEEMPDAVLKTPESSLTTSIVWELPKSKSDKWSEKYNQVEVLAKKANAKDYMLTQASLEDTFIRL 1553          

HSP 2 Score: 86.2705 bits (212), Expect = 3.328e-19
Identity = 46/109 (42.20%), Postives = 67/109 (61.47%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFG 387
            L+ + LT     L +NLSGG KRKL   +A+IG  +VI LDEPT+GMD  AR  + N++  +  +  I  +LT+H M+E E L   + +M +G+M   GS  +LK K+G
Sbjct:  568 LKQIELTDKRNTLAKNLSGGMKRKLCVCMAMIGGSRVILLDEPTAGMDPSARIDVQNMLALVKADRTI--LLTTHYMDEAEKLGDWIFVMSHGKMAASGSKHYLKQKYG 674          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-6 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:O01842])

HSP 1 Score: 117.857 bits (294), Expect = 4.068e-32
Identity = 60/133 (45.11%), Postives = 83/133 (62.41%), Query Frame = 1
Query:   43 ISCRHKLR-NLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETN 438
            ISCR  LR N               GG KRK+S  IAL+     I LDEPT+G+D  ARR +W++I +M  + K +++LTSH+MEECEALC R+ I+  GEM  LG+ Q LKS++G+ Y + + L+S E  T+
Sbjct:   70 ISCRQTLRVN--------------DGGQKRKISVGIALMSRASCIILDEPTAGIDPRARREIWDIIHEMREQGKCSIVLTSHSMEECEALCTRIGILHRGEMIALGTSQSLKSQYGNTYMMTLVLNSLEGLTS 188          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 162.925 bits (411), Expect = 1.290e-45
Identity = 89/221 (40.27%), Postives = 130/221 (58.82%), Query Frame = 1
Query:   64 RNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI------------RLHSGEAETNNHE------------KVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++     H  K T   SGGNKRKLSTAIA+IG+P VI+LDEPT+GMD  ARR LWN++ ++ +  K +++LTSH+MEECEALC RL+IMVNGE KC+GS QHLK+KF     +KI            RL  G A   + +             VK+ ++  + + + L++E    L +    + ++  ++F   E  +    + DYS+SQ TLE++F+  A
Sbjct: 1463 KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSI-LQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          

HSP 2 Score: 100.138 bits (248), Expect = 7.560e-24
Identity = 67/204 (32.84%), Postives = 111/204 (54.41%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIA--VILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTIL---DYSISQMTLEDVFINLASK 657
            L+ + L   A   +  LSGG KRKLS   AL G+ KV+  DEP+SGMD  ARR LW+++Q    + K+   ++LT+H M+E + L  R++IM +GE+KC G+   LK ++G  Y + I +   + ETN   +V  ++ + ++  +    +  A L YQ        K  E F Q++     L    Y +   ++E+VF+ + ++
Sbjct:  631 LKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRL-ICVKRDDCETN---EVTALLNK-YIPGLKPECDIGAELSYQLPDSASA-KFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE 824          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 162.925 bits (411), Expect = 1.301e-45
Identity = 89/221 (40.27%), Postives = 130/221 (58.82%), Query Frame = 1
Query:   64 RNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI------------RLHSGEAETNNHE------------KVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++     H  K T   SGGNKRKLSTAIA+IG+P VI+LDEPT+GMD  ARR LWN++ ++ +  K +++LTSH+MEECEALC RL+IMVNGE KC+GS QHLK+KF     +KI            RL  G A   + +             VK+ ++  + + + L++E    L +    + ++  ++F   E  +    + DYS+SQ TLE++F+  A
Sbjct: 1463 KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSI-LQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          

HSP 2 Score: 100.138 bits (248), Expect = 8.390e-24
Identity = 67/204 (32.84%), Postives = 111/204 (54.41%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIA--VILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTIL---DYSISQMTLEDVFINLASK 657
            L+ + L   A   +  LSGG KRKLS   AL G+ KV+  DEP+SGMD  ARR LW+++Q    + K+   ++LT+H M+E + L  R++IM +GE+KC G+   LK ++G  Y + I +   + ETN   +V  ++ + ++  +    +  A L YQ        K  E F Q++     L    Y +   ++E+VF+ + ++
Sbjct:  631 LKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRL-ICVKRDDCETN---EVTALLNK-YIPGLKPECDIGAELSYQLPDSASA-KFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE 824          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 162.925 bits (411), Expect = 1.328e-45
Identity = 89/221 (40.27%), Postives = 130/221 (58.82%), Query Frame = 1
Query:   64 RNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI------------RLHSGEAETNNHE------------KVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++     H  K T   SGGNKRKLSTAIA+IG+P VI+LDEPT+GMD  ARR LWN++ ++ +  K +++LTSH+MEECEALC RL+IMVNGE KC+GS QHLK+KF     +KI            RL  G A   + +             VK+ ++  + + + L++E    L +    + ++  ++F   E  +    + DYS+SQ TLE++F+  A
Sbjct: 1485 KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSI-LQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1703          

HSP 2 Score: 99.7525 bits (247), Expect = 9.069e-24
Identity = 67/204 (32.84%), Postives = 111/204 (54.41%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIA--VILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTIL---DYSISQMTLEDVFINLASK 657
            L+ + L   A   +  LSGG KRKLS   AL G+ KV+  DEP+SGMD  ARR LW+++Q    + K+   ++LT+H M+E + L  R++IM +GE+KC G+   LK ++G  Y + I +   + ETN   +V  ++ + ++  +    +  A L YQ        K  E F Q++     L    Y +   ++E+VF+ + ++
Sbjct:  653 LKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRL-ICVKRDDCETN---EVTALLNK-YIPGLKPECDIGAELSYQLPDSASA-KFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE 846          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 145.591 bits (366), Expect = 1.507e-39
Identity = 84/226 (37.17%), Postives = 123/226 (54.42%), Query Frame = 1
Query:   85 HATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFG-----------------------------------DDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            H  K T++ SGGN+RKLSTAI+++GNP V++LDEPTSGMD  ARR LW +I  +    K +++LTSH+M+ECEALC RL+IMV+GE KCLGSVQ LK++F                                    D  ++++      ++ +   KV + I +  + D  L++E    + Y       + K+F+  E       I DY I Q  LE++F++ ASK
Sbjct: 1457 HMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGK-SIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKE-IPDAELKEEYNGLITYYIPHSKTLSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFASK 1680          

HSP 2 Score: 104.76 bits (260), Expect = 1.760e-25
Identity = 62/180 (34.44%), Postives = 102/180 (56.67%), Query Frame = 1
Query:  103 QNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFI 642
            +NLSGG KRKLS   AL GN KV+  DEP+SG+DA  RR LW+++Q  + ++   ++LT+H M+E + L  R++I+  G+++C G+  +LK +FG  Y +   + SG       + ++K +       V L  E    L  ++  K    +L +  ++  A   ++ Y +S  TLEDVF+
Sbjct:  645 KNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLLQ--SEKDGRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGYLLVCIMQSGCDVGAVTQLIRKYVPPIKPERV-LGTELTYRLPTEYSKKFA--ELLQDLDEKCAQLQLVGYGLSGATLEDVFM 819          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: Eato (gene:FBgn0028539 transcript:FBtr0110941)

HSP 1 Score: 128.257 bits (321), Expect = 1.298e-33
Identity = 69/203 (33.99%), Postives = 120/203 (59.11%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSK------IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFI 642
            ++ L  + LT +     ++ SGG KRKL  A+A+IG P ++ LDEPT+G+D  +RRFLW  I+    +++  V+LTSH+M+ECE LC+RL+IM +G+ KCL ++  LK   G  + +K+++ +      N   +   ++  F   + LR+ +  TL Y   ++        +FK+ E +   + +  + DYS+++ TLED+F+
Sbjct: 1373 KYWLEKMHLTKYQKVQVRHYSGGTKRKLLAAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDR-TVVLTSHSMDECEELCNRLAIMAHGKFKCLNNICALKRLSG--FTIKLKMKADTETEMNVSTITGTLKSEF-PGLELRESHAGTLTYFVSTQESVVLWSSVFKIAEEYLGDRLSALVADYSVNECTLEDIFL 1571          

HSP 2 Score: 104.375 bits (259), Expect = 2.421e-25
Identity = 67/203 (33.00%), Postives = 111/203 (54.68%), Query Frame = 1
Query:   58 KLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEA-ETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF--CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            KL+ L L+    +  +NLSGG KR+LS  IA+ GN K++ LDEP+SG+D  +RR LW+++  +  E   AV++T+H MEE E L   + I+ NG+++ +GS   LK K G  Y +K+ ++   + E    E +   +  A + +V +    +  L Y +  C    +++L    E       I   S++  +LEDVF+  A +
Sbjct:  576 KLKKLGLSDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVILDEPSSGLDINSRRELWDILLNLRKEK--AVLVTTHYMEEAEVLGDTICILANGKLQSIGSPLELKRKSGIGYRLKLEINDFTSREVEIMEIIHHFVPTARVLNV-VNPTVYICLPYAYKNCFAQMLYRL----ETESKELGIHTISMTDTSLEDVFLRCAGE 771          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca3b (ATP-binding cassette, sub-family A (ABC1), member 3b [Source:ZFIN;Acc:ZDB-GENE-050517-2])

HSP 1 Score: 191.045 bits (484), Expect = 2.480e-55
Identity = 99/200 (49.50%), Postives = 135/200 (67.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYV--KIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR+L L PHA KL ++ SGGNKRKLS  +ALIG P VIFLDEP++GMD  ARR LW+ I + T E+  A+I+TSH+MEECEALC RL++MVNG+ KCLGS QHLKSKFG  Y +  K+R+ + E E ++ +  K  I+  F   + L+DE+   + Y    K   + ++F   E  K   +I DY +SQ++LE VF++ A
Sbjct:  919 LRSLLLEPHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWDAITR-TRESGKAIIITSHSMEECEALCTRLAVMVNGQFKCLGSPQHLKSKFGSGYTLLAKVRVET-ELEESDLQLFKDFIESTFPGSL-LKDEHQGMVHYHLTDKTLTWAQVFGVLETAKEKYSIEDYCVSQISLEQVFLSFA 1115          

HSP 2 Score: 87.4261 bits (215), Expect = 2.278e-19
Identity = 44/96 (45.83%), Postives = 63/96 (65.62%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMK 348
            +R L+L        + LSGG KRKLS  IALIG+ KV+ LDEPTSGMD  ARR  W+++Q    +    ++LT+H M+E + L  R++IM +GE++
Sbjct:  133 IRILNLEDKRNAKCKTLSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPSARRATWDLLQG--EKRGRTILLTTHFMDEADLLGDRIAIMASGELQ 226          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca3b (ATP-binding cassette, sub-family A (ABC1), member 3b [Source:ZFIN;Acc:ZDB-GENE-050517-2])

HSP 1 Score: 190.274 bits (482), Expect = 4.622e-55
Identity = 99/200 (49.50%), Postives = 135/200 (67.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYV--KIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR+L L PHA KL ++ SGGNKRKLS  +ALIG P VIFLDEP++GMD  ARR LW+ I + T E+  A+I+TSH+MEECEALC RL++MVNG+ KCLGS QHLKSKFG  Y +  K+R+ + E E ++ +  K  I+  F   + L+DE+   + Y    K   + ++F   E  K   +I DY +SQ++LE VF++ A
Sbjct: 1547 LRSLLLEPHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWDAITR-TRESGKAIIITSHSMEECEALCTRLAVMVNGQFKCLGSPQHLKSKFGSGYTLLAKVRVET-ELEESDLQLFKDFIESTFPGSL-LKDEHQGMVHYHLTDKTLTWAQVFGVLETAKEKYSIEDYCVSQISLEQVFLSFA 1743          

HSP 2 Score: 112.849 bits (281), Expect = 3.506e-28
Identity = 73/199 (36.68%), Postives = 107/199 (53.77%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L+L        + LSGG KRKLS  IALIG+ KV+ LDEPTSGMD  ARR  W+++Q    +    ++LT+H M+E + L  R++IM +GE++C GS   LK+K+G  Y++ I     +A  N  E  + +    ++ D +L     A L Y     S  R   LF   E  +    I  Y  S  T+E+VF+ + 
Sbjct:  698 IRILNLEDKRNAKCKTLSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPSARRATWDLLQG--EKRGRTILLTTHFMDEADLLGDRIAIMASGELQCCGSPLFLKNKYGAGYHMVI---VKDAFCNVSEITRLV--HMYVPDATLESSAGAELSYILPKESTSRFELLFAELEMNRDELGIASYGASVTTMEEVFLRVG 889          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca3b (ATP-binding cassette, sub-family A (ABC1), member 3b [Source:ZFIN;Acc:ZDB-GENE-050517-2])

HSP 1 Score: 190.274 bits (482), Expect = 4.931e-55
Identity = 99/200 (49.50%), Postives = 135/200 (67.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYV--KIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR+L L PHA KL ++ SGGNKRKLS  +ALIG P VIFLDEP++GMD  ARR LW+ I + T E+  A+I+TSH+MEECEALC RL++MVNG+ KCLGS QHLKSKFG  Y +  K+R+ + E E ++ +  K  I+  F   + L+DE+   + Y    K   + ++F   E  K   +I DY +SQ++LE VF++ A
Sbjct: 1496 LRSLLLEPHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWDAITR-TRESGKAIIITSHSMEECEALCTRLAVMVNGQFKCLGSPQHLKSKFGSGYTLLAKVRVET-ELEESDLQLFKDFIESTFPGSL-LKDEHQGMVHYHLTDKTLTWAQVFGVLETAKEKYSIEDYCVSQISLEQVFLSFA 1692          

HSP 2 Score: 112.849 bits (281), Expect = 3.702e-28
Identity = 70/185 (37.84%), Postives = 102/185 (55.14%), Query Frame = 1
Query:  103 QNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            + LSGG KRKLS  IALIG+ KV+ LDEPTSGMD  ARR  W+++Q    +    ++LT+H M+E + L  R++IM +GE++C GS   LK+K+G  Y++ I     +A  N  E  + +    ++ D +L     A L Y     S  R   LF   E  +    I  Y  S  T+E+VF+ + 
Sbjct:  661 KTLSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPSARRATWDLLQG--EKRGRTILLTTHFMDEADLLGDRIAIMASGELQCCGSPLFLKNKYGAGYHMVI---VKDAFCNVSEITRLV--HMYVPDATLESSAGAELSYILPKESTSRFELLFAELEMNRDELGIASYGASVTTMEEVFLRVG 838          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca2 (ATP-binding cassette, sub-family A (ABC1), member 2 [Source:ZFIN;Acc:ZDB-GENE-050517-1])

HSP 1 Score: 189.889 bits (481), Expect = 6.723e-55
Identity = 100/202 (49.50%), Postives = 133/202 (65.84%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            L  L L+ +A K     SGGNKRKLSTAIALIG P +IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL IMVNG  KCLGS+QHLK++FGD Y + +R       T     VK++I+       +  L++ +   +QYQ  S+ I + ++F   EQ+    +I DYS+SQ TL++VF+N A K
Sbjct: 2152 LEKLELSKYADKPAGTYSGGNKRKLSTAIALIGYPSLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLGIMVNGRFKCLGSIQHLKNRFGDGYMITVR-------TKTTASVKEVIRFFNRNFPEAILKERHHTKIQYQLKSENISLAQVFSKMEQVVEVLSIEDYSVSQTTLDNVFVNFAKK 2345          

HSP 2 Score: 107.842 bits (268), Expect = 2.057e-26
Identity = 69/217 (31.80%), Postives = 115/217 (53.00%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNN--------------HEKVKKIIQEAFLSDVSLRDENFATLQYQFCS---KIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LKS +GD Y + +     ++ T +                +V + I++   S + + D N   L Y   S   K   F +LF+  EQ   +  +  + +   TLE+VF+ ++ +
Sbjct: 1073 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAVILDEPTAGVDPYARRAIWDLILKYKQGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKSTYGDGYKLTLVKKQSDSHTADQSSQSPSSSISPCSENRVTQFIRQYVASCLLVSDSN-TELSYVLPSEAVKKGCFERLFQALEQSLDSLALTSFGVMDTTLEEVFLKVSEE 1286          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 182.956 bits (463), Expect = 1.738e-52
Identity = 95/198 (47.98%), Postives = 129/198 (65.15%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKI-RIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  +  K   + SGGN RKLSTA+ALIG P V+FLDEPT+GMD  ARR LWN I  +  E + +V+LTSH+MEECEALC R++IMVNG  +CLGSVQHLK+KFGD Y + +R+   +      E V + I+   L   +L++++   LQYQ  S +  + ++F    + K    I DYS+SQ TL+ VF+N A
Sbjct: 2036 IRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVAGADPRL---EPVMEFIERE-LPGSTLKEKHRNMLQYQLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFA 2228          

HSP 2 Score: 95.1301 bits (235), Expect = 4.655e-22
Identity = 46/114 (40.35%), Postives = 74/114 (64.91%), Query Frame = 1
Query:   67 NLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            +L L    T  +  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  ARR +W+++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +
Sbjct: 1022 DLGLPHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTL 1133          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 191.43 bits (485), Expect = 3.287e-55
Identity = 98/198 (49.49%), Postives = 132/198 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  ++ K   N SGGNKRKLSTAIALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  KCLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++ + LQYQ   S+  + ++F    + K    I DYS+SQ TL+ VF+N A
Sbjct: 1948 IRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPDL---KPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2140          

HSP 2 Score: 93.9745 bits (232), Expect = 1.734e-21
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 1
Query:   82 PHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            PH  K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +
Sbjct:  963 PHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTL 1070          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 191.045 bits (484), Expect = 3.432e-55
Identity = 98/198 (49.49%), Postives = 132/198 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  ++ K   N SGGNKRKLSTAIALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  KCLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++ + LQYQ   S+  + ++F    + K    I DYS+SQ TL+ VF+N A
Sbjct: 2080 IRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPDL---KPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2272          

HSP 2 Score: 93.9745 bits (232), Expect = 1.809e-21
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 1
Query:   82 PHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            PH  K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +
Sbjct: 1026 PHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTL 1133          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 191.045 bits (484), Expect = 3.454e-55
Identity = 98/198 (49.49%), Postives = 132/198 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  ++ K   N SGGNKRKLSTAIALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  KCLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++ + LQYQ   S+  + ++F    + K    I DYS+SQ TL+ VF+N A
Sbjct: 1980 IRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPDL---KPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2172          

HSP 2 Score: 94.3597 bits (233), Expect = 1.608e-21
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 1
Query:   82 PHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            PH  K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +
Sbjct: 1013 PHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTL 1120          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 191.045 bits (484), Expect = 3.700e-55
Identity = 98/198 (49.49%), Postives = 132/198 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  ++ K   N SGGNKRKLSTAIALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  KCLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++ + LQYQ   S+  + ++F    + K    I DYS+SQ TL+ VF+N A
Sbjct: 2016 IRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPDL---KPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2208          

HSP 2 Score: 93.9745 bits (232), Expect = 1.641e-21
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 1
Query:   82 PHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            PH  K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +
Sbjct: 1022 PHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTL 1129          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 191.045 bits (484), Expect = 3.997e-55
Identity = 98/198 (49.49%), Postives = 132/198 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  ++ K   N SGGNKRKLSTAIALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  KCLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++ + LQYQ   S+  + ++F    + K    I DYS+SQ TL+ VF+N A
Sbjct: 2015 IRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPDL---KPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2207          

HSP 2 Score: 93.9745 bits (232), Expect = 1.788e-21
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 1
Query:   82 PHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            PH  K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +
Sbjct: 1024 PHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTL 1131          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca2 (ATP-binding cassette, sub-family A (ABC1), member 2 [Source:MGI Symbol;Acc:MGI:99606])

HSP 1 Score: 193.356 bits (490), Expect = 4.910e-56
Identity = 100/203 (49.26%), Postives = 134/203 (66.01%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R  S    + N + V +     F  +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2167 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKS----SQNVKDVVRFFNRNF-PEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVVGVLGIEDYSVSQTTLDNVFVNFAKK 2363          

HSP 2 Score: 102.834 bits (255), Expect = 1.388e-24
Identity = 68/221 (30.77%), Postives = 114/221 (51.58%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETN------------------NHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFE-FFEQMKATKTIL---DYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y + +     E  T+                  +  +V + I++   S + + D +   L Y   S+      FE  F+Q++ +   L    + +   TLE+VF+ ++ +
Sbjct: 1106 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGYRLTLVKQPAEPGTSQEPGLASSPSGCPRLSSCSEPQVSQFIRKHVASSLLVSDTS-TELSYILPSEAVKKGAFERLFQQLEHSLDALHLSSFGLMDTTLEEVFLKVSEE 1323          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 191.43 bits (485), Expect = 2.181e-55
Identity = 97/198 (48.99%), Postives = 130/198 (65.66%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKI-RIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  +  K   N SGGNKRKLSTA+ALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  +CLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++   LQYQ  S +  + ++F    Q K    I DYS+SQ TL+ VF+N A
Sbjct: 2029 IRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDL---KPVQEFFGLAFPGSV-LKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFA 2221          

HSP 2 Score: 93.2041 bits (230), Expect = 2.991e-21
Identity = 67/240 (27.92%), Postives = 114/240 (47.50%), Query Frame = 1
Query:   67 NLSLTPHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI-----------------------------RLHSGEAETNNHEK-------------VKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            ++ L P   K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +                             +  S     ++HE              ++K + EA L +  +  E    L Y+   +    +LF   +   +   I  Y IS+ TLE++F+ +A +
Sbjct: 1018 DVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVE-DIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE 1254          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca3 (ATP-binding cassette, sub-family A (ABC1), member 3 [Source:MGI Symbol;Acc:MGI:1351617])

HSP 1 Score: 186.808 bits (473), Expect = 8.024e-54
Identity = 96/198 (48.48%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR L L PHA KL +  SGGNKRKLST IALIG P VIFLDEP++GMD  ARR LW+ + +     K A+++TSH+MEECEALC RL+IMV G+ KCLGS QHLKSKFG  Y ++ ++ S E + +  E+ K  +   F   + L DE+   + Y      +   K+F   E+ K    + DYS+SQ++LE VF++ A
Sbjct: 1244 LRGLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGK-AIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRS-EGKQDALEEFKAFVDLTFPGSI-LEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFA 1438          

HSP 2 Score: 104.375 bits (259), Expect = 3.530e-25
Identity = 64/180 (35.56%), Postives = 100/180 (55.56%), Query Frame = 1
Query:  109 LSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFI 642
            LSGG KRKLS  IALI   KV+ LDEPTSGMDA +RR +W+++Q+  ++    V+LT+H M+E + L  R++I+  GE++C GS   LK K+G  Y++ +     +    N E + +++    + +  L     A L +     S  R   LF   E+ +    I  +  S  T+E+VF+
Sbjct:  665 LSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDR--TVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYGAGYHMTLV----KEPHCNPEGISQLVHHH-VPNAMLESHAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFL 837          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca3 (ATP-binding cassette, sub-family A (ABC1), member 3 [Source:MGI Symbol;Acc:MGI:1351617])

HSP 1 Score: 186.808 bits (473), Expect = 8.094e-54
Identity = 96/198 (48.48%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR L L PHA KL +  SGGNKRKLST IALIG P VIFLDEP++GMD  ARR LW+ + +     K A+++TSH+MEECEALC RL+IMV G+ KCLGS QHLKSKFG  Y ++ ++ S E + +  E+ K  +   F   + L DE+   + Y      +   K+F   E+ K    + DYS+SQ++LE VF++ A
Sbjct: 1499 LRGLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGK-AIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRS-EGKQDALEEFKAFVDLTFPGSI-LEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFA 1693          

HSP 2 Score: 104.76 bits (260), Expect = 2.382e-25
Identity = 64/183 (34.97%), Postives = 101/183 (55.19%), Query Frame = 1
Query:  109 LSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LSGG KRKLS  IALI   KV+ LDEPTSGMDA +RR +W+++Q+  ++    V+LT+H M+E + L  R++I+  GE++C GS   LK K+G  Y++ +     +    N E + +++    + +  L     A L +     S  R   LF   E+ +    I  +  S  T+E+VF+ + 
Sbjct:  665 LSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDR--TVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYGAGYHMTLV----KEPHCNPEGISQLVHH-HVPNAMLESHAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVG 840          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca3 (ATP-binding cassette, sub-family A (ABC1), member 3 [Source:MGI Symbol;Acc:MGI:1351617])

HSP 1 Score: 186.808 bits (473), Expect = 8.094e-54
Identity = 96/198 (48.48%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR L L PHA KL +  SGGNKRKLST IALIG P VIFLDEP++GMD  ARR LW+ + +     K A+++TSH+MEECEALC RL+IMV G+ KCLGS QHLKSKFG  Y ++ ++ S E + +  E+ K  +   F   + L DE+   + Y      +   K+F   E+ K    + DYS+SQ++LE VF++ A
Sbjct: 1499 LRGLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGK-AIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRS-EGKQDALEEFKAFVDLTFPGSI-LEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFA 1693          

HSP 2 Score: 104.76 bits (260), Expect = 2.382e-25
Identity = 64/183 (34.97%), Postives = 101/183 (55.19%), Query Frame = 1
Query:  109 LSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LSGG KRKLS  IALI   KV+ LDEPTSGMDA +RR +W+++Q+  ++    V+LT+H M+E + L  R++I+  GE++C GS   LK K+G  Y++ +     +    N E + +++    + +  L     A L +     S  R   LF   E+ +    I  +  S  T+E+VF+ + 
Sbjct:  665 LSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDR--TVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYGAGYHMTLV----KEPHCNPEGISQLVHH-HVPNAMLESHAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVG 840          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q9BZC7|ABCA2_HUMAN (ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=4)

HSP 1 Score: 193.356 bits (490), Expect = 2.943e-55
Identity = 99/205 (48.29%), Postives = 135/205 (65.85%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R       T + + VK +++       +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2167 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVR-------TKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKK 2363          

HSP 2 Score: 100.138 bits (248), Expect = 7.518e-23
Identity = 49/112 (43.75%), Postives = 72/112 (64.29%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY 396
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y
Sbjct: 1107 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1216          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P41234|ABCA2_MOUSE (ATP-binding cassette sub-family A member 2 OS=Mus musculus OX=10090 GN=Abca2 PE=1 SV=4)

HSP 1 Score: 193.356 bits (490), Expect = 3.502e-55
Identity = 100/203 (49.26%), Postives = 134/203 (66.01%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +  L  L LT +A K     SGGNKRKLSTAIALIG P  IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG ++CLGS+QHLK++FGD Y + +R  S    + N + V +     F  +  L++ +   +QYQ  S+ I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2168 KWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKS----SQNVKDVVRFFNRNF-PEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVVGVLGIEDYSVSQTTLDNVFVNFAKK 2364          

HSP 2 Score: 102.834 bits (255), Expect = 9.712e-24
Identity = 68/221 (30.77%), Postives = 114/221 (51.58%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETN------------------NHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFE-FFEQMKATKTIL---DYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + I LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LK  +GD Y + +     E  T+                  +  +V + I++   S + + D +   L Y   S+      FE  F+Q++ +   L    + +   TLE+VF+ ++ +
Sbjct: 1107 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGYRLTLVKQPAEPGTSQEPGLASSPSGCPRLSSCSEPQVSQFIRKHVASSLLVSDTS-TELSYILPSEAVKKGAFERLFQQLEHSLDALHLSSFGLMDTTLEEVFLKVSEE 1324          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 191.43 bits (485), Expect = 1.526e-54
Identity = 97/198 (48.99%), Postives = 130/198 (65.66%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKI-RIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  +  K   N SGGNKRKLSTA+ALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  +CLGSVQHLK++FGD Y + +R+     +    + V++    AF   V L++++   LQYQ  S +  + ++F    Q K    I DYS+SQ TL+ VF+N A
Sbjct: 2029 IRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDL---KPVQEFFGLAFPGSV-LKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFA 2221          

HSP 2 Score: 93.2041 bits (230), Expect = 2.092e-20
Identity = 67/240 (27.92%), Postives = 114/240 (47.50%), Query Frame = 1
Query:   67 NLSLTPHATKL-TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI-----------------------------RLHSGEAETNNHEK-------------VKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            ++ L P   K  T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +                             +  S     ++HE              ++K + EA L +  +  E    L Y+   +    +LF   +   +   I  Y IS+ TLE++F+ +A +
Sbjct: 1018 DVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTI--ILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVE-DIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE 1254          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q99758|ABCA3_HUMAN (ATP-binding cassette sub-family A member 3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 2.026e-54
Identity = 98/198 (49.49%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR L L PHA KL +  SGGNKRKLST IALIG P VIFLDEP++GMD  ARR LW+ + +     K A+I+TSH+MEECEALC RL+IMV G+ KCLGS QHLKSKFG  Y ++ ++ S E +    E+ K  +   F   V L DE+   + Y    + +   K+F   E+ K    + DYS+SQ++LE VF++ A
Sbjct: 1499 LRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGK-AIIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLRAKVQS-EGQQEALEEFKAFVDLTFPGSV-LEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFA 1693          

HSP 2 Score: 107.071 bits (266), Expect = 3.400e-25
Identity = 64/183 (34.97%), Postives = 102/183 (55.74%), Query Frame = 1
Query:  109 LSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LSGG +RKLS  IALI   KV+ LDEPTSGMDA +RR +W+++Q+  ++  I  +LT+H M+E + L  R++IM  GE++C GS   LK K+G  Y++ +     +    N E + +++    + + +L     A L +     S  R   LF   E+ +    I  +  S  T+E+VF+ + 
Sbjct:  665 LSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSDRTI--VLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLV----KEPHCNPEDISQLVHH-HVPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTMEEVFLRVG 840          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 190.66 bits (483), Expect = 2.885e-54
Identity = 97/198 (48.99%), Postives = 129/198 (65.15%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKI-RIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  +  K   N SGGNKRKLSTA+ALIG P V+FLDEPT+GMD  ARRFLWN    +  E + +V+LTSH+MEECEALC R++IMVNG  +CLGSVQHLK++FGD Y + +R+     +    + V+     AF   V L++++   LQYQ  S +  + ++F    Q K    I DYS+SQ TL+ VF+N A
Sbjct: 2029 IRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDL---KPVQDFFGLAFPGSV-LKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFA 2221          

HSP 2 Score: 93.2041 bits (230), Expect = 1.729e-20
Identity = 64/228 (28.07%), Postives = 109/228 (47.81%), Query Frame = 1
Query:  100 TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI-----------------------------RLHSGEAETNNHEK-------------VKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            T  LSGG +RKLS A+A +G  KV+ LDEPT+G+D  +RR +W ++ K      I  IL++H+M+E + L  R++I+ +G++ C+GS   LK++ G  YY+ +                             +  S     ++HE              ++K + EA L +  +  E    L Y+   +    +LF   +   +   I  Y IS+ TLE++F+ +A +
Sbjct: 1030 TSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTI--ILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVE-DIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE 1254          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A087T022 (ATP-binding cassette sub-family A member 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_05296 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.817e-61
Identity = 98/197 (49.75%), Postives = 138/197 (70.05%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L PH  +     SGGNKRKLSTAIALIGNP V+FLDEPT+GMD  ARRFLWN I  +  E + +VILTSH+MEECEALC RL+IMVNG+ +CLGS+QHLK+K+G+ Y + +R+ +   E +  ++V+K I+  F +  SL++++   ++YQ    + +  +F+  E+ +    I DYS+SQ TL+ VFI+ A
Sbjct:  116 IRKLGLLPHGHRCAGTYSGGNKRKLSTAIALIGNPSVVFLDEPTTGMDPKARRFLWNCIIDIVKEGR-SVILTSHSMEECEALCTRLAIMVNGQFRCLGSIQHLKNKYGNGYTLTVRVAN---EPSAMQEVQKFIETTFGNAASLQEQHLNQMEYQLAPSLSLAVVFQELEKARQLLRIEDYSVSQTTLDQVFISFA 308          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A2L2YS93 (ATP-binding cassette sub-family A member 1 (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.235e-59
Identity = 95/197 (48.22%), Postives = 135/197 (68.53%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L  H  +     SGGNKRKLSTAIAL+GNP V+FLDEPT+GMD  ARRFLWN I  +  E + +VILTSH+MEECEALC RL+IMVNG+ +CLGS+QHLK+K+G  Y + +R+ +        E+V++ ++  F S  SL++++   ++YQ    + +  +F+  E+ +   +I DYS+SQ TL+ VFI+ A
Sbjct:  116 IRKLGLLAHGHRCAGTYSGGNKRKLSTAIALVGNPSVVFLDEPTTGMDPKARRFLWNCIIDIVKEGR-SVILTSHSMEECEALCTRLAIMVNGQFRCLGSIQHLKNKYGHGYTLTLRVTN---SLTAMEEVRRFMENTFGSAASLQEQHLNQMEYQLAPSLSLAMVFQELERARQMLSIEDYSVSQTTLDQVFISFA 308          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A0B6ZKX4 (ABC transporter domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF69697 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.622e-59
Identity = 102/200 (51.00%), Postives = 137/200 (68.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            ++ L L  H  K++ + SGGNKRKLSTAIALIGNP +IFLDEPT+GMD GARRFLW+ I  +      +VILTSH+MEECEALC+RL+IMVNG  +C+GS+QHLKS+FG+ Y + +R+ S   + N    V + I  +F S   L++++   LQYQ  S  + + KLF+  E+ K    + DYS SQ TL+ VFI+ A K
Sbjct:  119 IKRLGLAQHGDKISSSYSGGNKRKLSTAIALIGNPPIIFLDEPTTGMDPGARRFLWDCINSIVKAGH-SVILTSHSMEECEALCNRLAIMVNGTFQCIGSIQHLKSRFGNGYTIVLRVKSESLDIN---PVMEFISSSFPS-AKLKEKHHNMLQYQLGSVGLSLSKLFQAMEEAKRVYNVEDYSASQTTLDQVFISFAKK 313          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A210PGD8 (ATP-binding cassette sub-family A member 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08408 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.614e-58
Identity = 101/194 (52.06%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   70 LSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            L LT +A K +   SGGN+RKLSTAIALIGNP VIFLDEPT+GMD GARRFLWN I  +  + + +VILTSH+MEECEALC RL+IMVNG  + +GS+QHLK++FG+ Y V +R+     +  + + V   I E F S  +LR+ +   LQYQ  S++ +  +F   E ++ +  I DYS+SQ TL+ VFIN A
Sbjct:  181 LGLTQYADKPSGTYSGGNRRKLSTAIALIGNPSVIFLDEPTAGMDPGARRFLWNCINNIVKDGR-SVILTSHSMEECEALCSRLAIMVNGRFRGIGSIQHLKTRFGNGYIVIVRI---AGDRPDLDIVDSFITETFPS-ANLRERHHNMLQYQLGSEVPLSHIFSEIEAVRESFNIEDYSVSQTTLDQVFINFA 369          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A4Y2IF52 (ATP-binding cassette sub-family A member 1 OS=Araneus ventricosus OX=182803 GN=Abca1_0 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.904e-58
Identity = 102/197 (51.78%), Postives = 138/197 (70.05%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L L PH  +     SGGNKRKLSTAIALIGNP V+FLDEPT+GMD  ARRFLWN I  +  E + +VILTSH+MEECEALC RL+IMVNG+  CLGS+QHLK+K+G+ Y + +R+ +   ET   EKV++ I+  F S  SL++ +   ++YQ    + +  +F+  EQ + + +I DYS+SQ TL+ VFI+ A
Sbjct:  722 IRKLGLLPHGHRCAGTYSGGNKRKLSTAIALIGNPSVVFLDEPTTGMDPKARRFLWNCIIDIVKEGR-SVILTSHSMEECEALCTRLAIMVNGQFHCLGSIQHLKNKYGNGYTLTLRV-ANVPET--MEKVQRFIESTFGSSASLQEHHLNQMEYQLAPSLSLAYVFQELEQARDSLSIEDYSVSQTTLDQVFISFA 914          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 191.815 bits (486), Expect = 1.223e-55
Identity = 102/202 (50.50%), Postives = 134/202 (66.34%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF----CSKIRIFKLFE-FFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++ L LT +A +     SGGNKRKLSTAI+LIG P VIFLDEPT+GMD  A+RFLWN I  +  E + AVILTSH+MEECEALC R++IMVNG  +CLGSVQHLK++FGD Y + +RL    A   +   V   I+ +F + + L++ +   LQYQ     CS  R+F +    +E++  T    DYSISQ TL+ VF+N A
Sbjct: 1951 VKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGR-AVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRL---SAPPKDPCPVDAYIKNSF-TGIVLKERHHNVLQYQLPSNSCSLARVFDVLSNNYEELGVT----DYSISQTTLDQVFVNFA 2143          

HSP 2 Score: 99.3673 bits (246), Expect = 1.505e-23
Identity = 71/229 (31.00%), Postives = 110/229 (48.03%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYY---VKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDE-------NFATLQYQFCSKIRIFK-------------------LFEFFEQM---KATKTILDYSISQMTLEDVFINLA 651
            L ++ LT    + T+NLSGG +RKLS AIA IG  KV+ LDEPT+G+D  +RR +W+++ K   +  I  IL++H M+E + L  R++I+  G++ C GS   LKS  G  YY   VK  L S    + + + +          D  L  E           L   + S  R+ +                   L  F  ++   +A   I+ Y +S  TLE++F+ +A
Sbjct:  974 LEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLLLKYRKDRTI--ILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGKLLAADTDSTRSDDTGLGSEVNSSVISGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVA 1200          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 191.43 bits (485), Expect = 1.820e-55
Identity = 102/202 (50.50%), Postives = 134/202 (66.34%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF----CSKIRIFKLFE-FFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++ L LT +A +     SGGNKRKLSTAI+LIG P VIFLDEPT+GMD  A+RFLWN I  +  E + AVILTSH+MEECEALC R++IMVNG  +CLGSVQHLK++FGD Y + +RL    A   +   V   I+ +F + + L++ +   LQYQ     CS  R+F +    +E++  T    DYSISQ TL+ VF+N A
Sbjct: 1842 VKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGR-AVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRL---SAPPKDPCPVDAYIKNSF-TGIVLKERHHNVLQYQLPSNSCSLARVFDVLSNNYEELGVT----DYSISQTTLDQVFVNFA 2034          

HSP 2 Score: 98.9821 bits (245), Expect = 2.340e-23
Identity = 71/231 (30.74%), Postives = 111/231 (48.05%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYY---VKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDE-------NFATLQYQFCSKIRIFK-------------------LFEFFEQM---KATKTILDYSISQMTLEDVFINLASK 657
            L ++ LT    + T+NLSGG +RKLS AIA IG  KV+ LDEPT+G+D  +RR +W+++ K   +  I  IL++H M+E + L  R++I+  G++ C GS   LKS  G  YY   VK  L S    + + + +          D  L  E           L   + S  R+ +                   L  F  ++   +A   I+ Y +S  TLE++F+ +A +
Sbjct:  885 LEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLLLKYRKDRTI--ILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGKLLAADTDSTRSDDTGLGSEVNSSVISGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEE 1113          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca2 (ATP-binding cassette, sub-family A (ABC1), member 2 [Source:ZFIN;Acc:ZDB-GENE-050517-1])

HSP 1 Score: 190.66 bits (483), Expect = 2.852e-55
Identity = 100/202 (49.50%), Postives = 133/202 (65.84%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQ--EAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            L  L L+ +A K     SGGNKRKLSTAIALIG P +IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL IMVNG  KCLGS+QHLK++FGD Y + +R       T     VK++I+       +  L++ +   +QYQ  S +I + ++F   EQ+    +I DYS+SQ TL++VF+N A K
Sbjct: 1942 LEKLELSKYADKPAGTYSGGNKRKLSTAIALIGYPSLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLGIMVNGRFKCLGSIQHLKNRFGDGYMITVR-------TKTTASVKEVIRFFNRNFPEAILKERHHTKIQYQLKSERISLAQVFSKMEQVVEVLSIEDYSVSQTTLDNVFVNFAKK 2135          

HSP 2 Score: 108.997 bits (271), Expect = 6.516e-27
Identity = 71/206 (34.47%), Postives = 113/206 (54.85%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY---YVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS---KIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   LKS +GD Y    VK    S      +  +V + I++   S + + D N   L Y   S   K   F +LF+  EQ   +  +  + +   TLE+VF+ ++ +
Sbjct:  905 IEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAVILDEPTAGVDPYARRAIWDLILKYKQGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKSTYGDGYKLTLVKNVAPSSSMSPCSESRVTQFIRQYVASCLLVSDSN-TELSYVLPSEAVKKGCFERLFQALEQSLESLALTSFGVMDTTLEEVFLKVSEE 1107          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca3b (ATP binding cassette subfamily A member 3 [Source:NCBI gene;Acc:103033960])

HSP 1 Score: 189.889 bits (481), Expect = 6.090e-55
Identity = 96/199 (48.24%), Postives = 134/199 (67.34%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHS-GEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR+L L PHA KL ++ SGGNKRKLS  +ALIG P VIFLDEP++GMD  ARR LW+ + + T E+  A+++TSH+MEECEALC RL++MVNG+ KCLGS QHLKSKFG  Y +  ++H+  + E  + +  K  I+  F   V L+DE+   + Y    K+  + ++F   E  K   +I DY +SQ++LE VF++ A
Sbjct: 1498 LRSLLLEPHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWDAVTR-TRESGKAIVITSHSMEECEALCTRLAVMVNGQFKCLGSPQHLKSKFGSGYTLLAKVHTEPDLEEMDIQLFKDFIESTFPGSV-LKDEHQGMVHYHLTDKMLTWAQVFGTLEAAKEKYSIEDYCVSQISLEQVFLSFA 1694          

HSP 2 Score: 112.464 bits (280), Expect = 4.831e-28
Identity = 73/201 (36.32%), Postives = 109/201 (54.23%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQY----QFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L+L       ++ LSGG KRKLS  IALIG+ KV+ LDEPTSGMD  ARR  W+++Q    +    ++LT+H M+E + L  R++IM  GE++C GS   LK+K+G  Y++ I     +A  N  E  + +    ++ + SL     A L Y    +  SK  +  LF   E  +    I  Y  S  T+E+VF+ + 
Sbjct:  646 IRVLNLEDKRNSQSKTLSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPSARRATWDLLQG--EKRGRTILLTTHFMDEADLLGDRIAIMAGGELQCCGSPLFLKNKYGAGYHMVI---VKDALCNVSEITRLV--HMYVPNASLESSAGAELSYILPKESTSKFEL--LFAELEMNREELGIASYGASVTTMEEVFLRVG 837          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca3b (ATP binding cassette subfamily A member 3 [Source:NCBI gene;Acc:103033960])

HSP 1 Score: 189.504 bits (480), Expect = 8.134e-55
Identity = 96/199 (48.24%), Postives = 134/199 (67.34%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHS-GEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR+L L PHA KL ++ SGGNKRKLS  +ALIG P VIFLDEP++GMD  ARR LW+ + + T E+  A+++TSH+MEECEALC RL++MVNG+ KCLGS QHLKSKFG  Y +  ++H+  + E  + +  K  I+  F   V L+DE+   + Y    K+  + ++F   E  K   +I DY +SQ++LE VF++ A
Sbjct: 1230 LRSLLLEPHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWDAVTR-TRESGKAIVITSHSMEECEALCTRLAVMVNGQFKCLGSPQHLKSKFGSGYTLLAKVHTEPDLEEMDIQLFKDFIESTFPGSV-LKDEHQGMVHYHLTDKMLTWAQVFGTLEAAKEKYSIEDYCVSQISLEQVFLSFA 1426          

HSP 2 Score: 111.694 bits (278), Expect = 8.503e-28
Identity = 73/198 (36.87%), Postives = 108/198 (54.55%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQY----QFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFI 642
            +R L+L       ++ LSGG KRKLS  IALIG+ KV+ LDEPTSGMD  ARR  W+++Q    +    ++LT+H M+E + L  R++IM  GE++C GS   LK+K+G  Y++ I     +A  N  E  + +    ++ + SL     A L Y    +  SK  +  LF   E  +    I  Y  S  T+E+VF+
Sbjct:  640 IRVLNLEDKRNSQSKTLSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPSARRATWDLLQG--EKRGRTILLTTHFMDEADLLGDRIAIMAGGELQCCGSPLFLKNKYGAGYHMVI---VKDALCNVSEITRLV--HMYVPNASLESSAGAELSYILPKESTSKFEL--LFAELEMNREELGIASYGASVTTMEEVFL 828          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.193 bits (474), Expect = 9.369e-59
Identity = 101/203 (49.75%), Postives = 135/203 (66.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSK-IRIFKLFEFFEQMKATKTILDYSISQMTLED---VFINLASK 657
            L+ L LT +A K     SGGNKRKLSTAIALIG P +IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL+IMVNG  KCLGS+QHLK++FGD Y + IR  S    T + ++V +    +F  D  L++ +   +QYQ  S+ + +  +F   EQ+     + DYS+SQ TL++   VF+N A K
Sbjct:  108 LQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIRTRS----TLHVKEVLRFFSRSF-PDAVLKERHHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKK 304          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010397.1 (pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1 gene:ENSPMAG00000009413.1 transcript:ENSPMAT00000010397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.318 bits (425), Expect = 1.339e-51
Identity = 86/209 (41.15%), Postives = 131/209 (62.68%), Query Frame = 1
Query:   58 KLRNLS--LTPHATKL--------TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +LR +   L P AT+             SGG KRKLSTA+AL+G+P V+FLDEP++GMD  ARR LW+ + ++  E + A+++TSH+MEECEALC R++IMVNG+ +CLGS QHLKS++G  Y +  R+ + +A+T   +  K  ++  F   + L+D++   + Y      +   ++F   E+ K    + DYSISQ++LE VF+  A
Sbjct:   89 RLRGVPERLIPWATRTGRVPRVAPPHRRSGGTKRKLSTAVALMGSPPVVFLDEPSTGMDPVARRLLWDALSRVREEGR-ALVITSHSMEECEALCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAEQADT---QPFKHFVETTFPGSI-LKDQHQGLVHYHLTDMNMSWAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFA 292          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 176.792 bits (447), Expect = 4.090e-51
Identity = 91/197 (46.19%), Postives = 135/197 (68.53%), Query Frame = 1
Query:   70 LSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKI-RIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            L L+ HA KL +  SGG KRKLSTA+ALIG P+++ LDEP+SGMD  ++R+LW  I +       +VILTSH+MEECEALC +L+IMVNG+ KCLG++QHLK++FG+ + +K+RL SG ++     +V + I   F     L++++ + L++Q  S   ++ ++F   E+ K + +I  YSISQ TL+ VFIN A +
Sbjct: 1572 LHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWKTITREV-RGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKLRLSSGNSKVT---EVTEFITSHF-PGAYLKEQHISQLEFQVPSNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFARQ 1763          

HSP 2 Score: 100.908 bits (250), Expect = 9.309e-25
Identity = 49/109 (44.95%), Postives = 72/109 (66.06%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFG 387
            L +L L  H  KL   LSGG KRKLS AIA IG    + LDEPTSG+D  +RR +WN+I K  +     +IL++H+++E E L  R++++ +G+++C GS Q+LK  +G
Sbjct:  500 LNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLILK--HRAGRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYG 606          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 9.323e-26
Identity = 76/230 (33.04%), Postives = 123/230 (53.48%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI---------------RLHS------GEAETN------NH-EKVKKIIQEAFLSDVSLRDENFAT-LQYQFCS---KIRIFK-LFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++++ L    + ++++LSGG +RKLS  IA +G  KV+FLDEPT+G+D  ARR +WN++ K  +   I  IL++H+M+E + L  R++I+ +G ++C GS   LK+ FG  YY+ +                L S      G  E+N      NH   V +++Q+  + D  L  ENF   L Y   S   K   F  LF+  ++  A   +  Y +S  TLE++F+ +A
Sbjct:  480 IQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLLLKYRHGRTI--ILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQ-HVPDARLI-ENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVA 705          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 1.849e-24
Identity = 47/107 (43.93%), Postives = 72/107 (67.29%), Query Frame = 1
Query:   88 ATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            A K  Q+LSGG KRKLS A AL+G P+++ LDEPTSGMD  +RR +W+++  +  + +   +L++H+MEE +AL    +++  G +KC GS   LK+KFG  Y + +
Sbjct:  577 ADKQVQDLSGGQKRKLSLAAALLGKPRLLILDEPTSGMDPVSRRRVWSLL--LGGKRECVTLLSTHSMEEADALADWKAVLSQGRLKCAGSSLFLKTKFGVGYRLTL 681          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: YOL075C_mRNA (Putative ABC transporter [Source:SGD;Acc:S000005435])

HSP 1 Score: 56.6102 bits (135), Expect = 8.162e-10
Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = 1
Query:  103 QNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSH 285
            + LSGG KR+LS    +I NP ++FLDEPT+G+DA +   +   ++K+  E+    I++ H
Sbjct:  184 RGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIH 244          

HSP 2 Score: 53.5286 bits (127), Expect = 7.682e-9
Identity = 20/64 (31.25%), Postives = 40/64 (62.50%), Query Frame = 1
Query:   94 KLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSH 285
            +  + +SGG KR+++  + L+ +P ++ LDEPTSG+D+     +  +++K+  E    +I+T H
Sbjct:  834 EFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIH 897          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: NEW1 (ATP binding cassette protein; cosediments with polysomes and is required for biogenesis of the small ribosomal subunit; Asn/Gln-rich rich region supports [NU+] prion formation and susceptibility to [PSI+] prion induction [Source:SGD;Acc:S000006147])

HSP 1 Score: 55.0694 bits (131), Expect = 2.326e-9
Identity = 36/95 (37.89%), Postives = 51/95 (53.68%), Query Frame = 1
Query:  106 NLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGD 390
            +LSGG   K+  A A+  NP ++ LDEPT+ +D  +   L   I+  +      V++ SHN E   ALC    I+ NG+M   GS Q  +SKF D
Sbjct: 1032 SLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSG----GVVMISHNNEFVGALCPEQWIVENGKMVQKGSAQVDQSKFED 1122          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: ADP1 (Putative ATP-dependent permease of the ABC transporter family [Source:SGD;Acc:S000000604])

HSP 1 Score: 52.7582 bits (125), Expect = 1.325e-8
Identity = 29/106 (27.36%), Postives = 57/106 (53.77%), Query Frame = 1
Query:   88 ATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEE-CEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYV 402
              +  + +SGG KR++S A  L+ +P V+FLDEPTSG+DA     +   + +++++    ++L+ H        L  +L ++  GEM   G+ + +     ++ Y+
Sbjct:  523 GNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYI 628          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 193.741 bits (491), Expect = 1.018e-56
Identity = 98/198 (49.49%), Postives = 136/198 (68.69%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++ ++L  +        SGGNKRKLSTAIAL+GNP ++F+DEPT+GMD  ARRFLWN+I  +  E +  VILTSH+MEECEALC+R++IMVNG+MKCLGS QHLK+KFGD Y V +R+     +T   E+V + I + F + V L+D++   ++YQ  C  + + +LF   E  +    I DYS++Q TL+ VFIN A
Sbjct: 1442 IQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGR-TVILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDT---EQVCQFIIQCFPNAV-LKDKHHNMVEYQIPCQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFA 1634          

HSP 2 Score: 100.908 bits (250), Expect = 1.439e-24
Identity = 46/116 (39.66%), Postives = 79/116 (68.10%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            L+++ LT    +L+ NLSGG KRKLS A+A +   +V+ LDEPT+G+D  ARR +W+++ K   +    V+L++H+M+E + L  R++I+  G+++C G+   LKS +G+ YY+ +
Sbjct:  488 LKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLLLKYKKDR--TVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTL 601          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO28092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F9])

HSP 1 Score: 174.096 bits (440), Expect = 3.752e-55
Identity = 85/177 (48.02%), Postives = 121/177 (68.36%), Query Frame = 1
Query:  109 LSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDV 636
            +SGGNKRKLSTAIAL+GNP +IFLDEPT+GMD  ARRFLW+ +  +    + +++LTSH+MEECEALC RL+IMVNG+ KC+GS QHLKS+FG  Y + +++ +     +N E+ ++ +   F     L   N   L YQ  S ++   ++F   E+ +A+  I+DYS+SQ +LE V
Sbjct:    8 ISGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGR-SIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTEQAQQFVSSTFPGAQLLESHN-GMLTYQINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQV 182          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 180.259 bits (456), Expect = 5.375e-52
Identity = 94/198 (47.47%), Postives = 132/198 (66.67%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            + +L+L   A KL  + SGGNKRKLSTAIAL+GNP +IFLDEPT+GMD  ARRFLW+ +  +    + +++LTSH+MEECEALC RL+IMVNG+ KC+GS QHLKS+FG  Y + +++ +     +N E   + +   F     L   N   L YQ  S ++   ++F   E+ +A+  I+DYS+SQ +LE VF+NLA
Sbjct: 1528 IEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGR-SIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTE---QFVSSTFPGAQLLESHN-GMLTYQINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLA 1720          

HSP 2 Score: 102.449 bits (254), Expect = 5.565e-25
Identity = 66/189 (34.92%), Postives = 103/189 (54.50%), Query Frame = 1
Query:  100 TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEA-FLSDVSLRDENF----ATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +  LSGG KRKL+ AIAL+G  + +FLDEPTSGMD  ARR  W+++ K  ++    VILT+H M+E + L  R++IM +G+++C GS   LKS++G  Y++ +       +      V++ +  A  LS+V    E      A+  ++         LF   E  K    I  Y +S  T+E+VF+ + 
Sbjct:  631 SSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLLLK--HKAGKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLVKKEDCDDNAIINAVRETVPSAQVLSNVGAEIEFVLNGEASKDFE--------SLFVKLENNKEDYGIASYGVSCTTMEEVFMKVG 809          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 130.183 bits (326), Expect = 2.401e-36
Identity = 82/206 (39.81%), Postives = 119/206 (57.77%), Query Frame = 1
Query:   55 HKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRL----HSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKL---FEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            H +  + +T HA K  + LSGG KRKLS  +A++G+P ++ LDEP++GMD  ARRFL   +           ILT+H+MEE +ALC R+ IMV G++KCLGS QHLKSKFG  Y ++I+L     S + + +   ++   ++  F +  + R E+F         K  + KL   F   E+ K +  I +YS SQ TLE VF+  A
Sbjct:  102 HYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARRFLCKNVT-----GARGAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDVDMQTQLVAFVEGLFPN--AKRTESFGDRVIYKVPKSNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFA 300          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 93.5893 bits (231), Expect = 6.255e-22
Identity = 66/204 (32.35%), Postives = 105/204 (51.47%), Query Frame = 1
Query:  103 QNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY---YVKIRLHSG---------------EAETNNHEKVKKIIQEAFLSDVSLR---DENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINL 648
            + LSGG KRKLS A+A +   + + LDEPT+G+D  ARR +W+++ K      I  +L++H MEE + L  R++I+ +G+++C+GS  +LK +FG+ Y    VK  + S                EA   + EK+   I  + +S   L+   ++ F  +      K   F KLF   EQ      I  Y I+   LE+VF+ +
Sbjct:  734 ETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLLIKYKKGRTI--LLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFIT-SHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKV 934          

HSP 2 Score: 52.7582 bits (125), Expect = 3.044e-8
Identity = 24/43 (55.81%), Postives = 32/43 (74.42%), Query Frame = 1
Query:   52 RHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFL 180
            +  +R ++LT +A    +  SGGNKRKLSTAIALIG+P +IFL
Sbjct: 1745 KWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          

HSP 3 Score: 21.557 bits (44), Expect = 3.044e-8
Identity = 7/17 (41.18%), Postives = 11/17 (64.71%), Query Frame = 2
Query:    2 FYCRIRGIESNQIKSVV 52
             Y R+RG+   +IK V+
Sbjct: 1728 LYARLRGVPEKEIKQVM 1744          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca2 (ATP binding cassette subfamily A member 2 [Source:NCBI gene;Acc:101155855])

HSP 1 Score: 189.889 bits (481), Expect = 5.447e-55
Identity = 100/200 (50.00%), Postives = 133/200 (66.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            L  L L+ +A +     SGGNKRKLSTAIALIG P +IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL IMVNG  KCLGS+QHLK++FGD Y + +R  S    + N ++V +     F   V L++ +   +QYQ  S +I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2149 LEKLELSKYADRPAGTYSGGNKRKLSTAIALIGFPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLGIMVNGRFKCLGSIQHLKNRFGDGYMITVRTKS----SVNVKEVVRFFNRNFPEAV-LKERHHTKVQYQLKSERISLAQVFSKMEQVMEVLGIEDYSVSQTTLDNVFVNFAKK 2342          

HSP 2 Score: 106.301 bits (264), Expect = 6.620e-26
Identity = 71/223 (31.84%), Postives = 115/223 (51.57%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAE-TNNHE-------------------KVKKIIQEAFLSDVSLRDENFATLQYQFCS---KIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   L+S +GD Y + +     E     +H+                   +V K IQ+   S + + D N   L Y   S   K   F +LF+  EQ   +  +  + +   TLE+VF+ ++ +
Sbjct: 1097 IADLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAVILDEPTAGVDPYARRAIWDLILKYKQGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLRSTYGDGYKLTLVKKQPEGRGVQSHKLLTPPTQSPSSAQSPCSETRVTKFIQQFVASCLLVSDSN-TELSYVLPSEAVKKGCFERLFQALEQNLTSLALTSFGVMDTTLEEVFLKVSEE 1316          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca2 (ATP binding cassette subfamily A member 2 [Source:NCBI gene;Acc:101155855])

HSP 1 Score: 189.889 bits (481), Expect = 5.485e-55
Identity = 100/200 (50.00%), Postives = 133/200 (66.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            L  L L+ +A +     SGGNKRKLSTAIALIG P +IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL IMVNG  KCLGS+QHLK++FGD Y + +R  S    + N ++V +     F   V L++ +   +QYQ  S +I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2062 LEKLELSKYADRPAGTYSGGNKRKLSTAIALIGFPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLGIMVNGRFKCLGSIQHLKNRFGDGYMITVRTKS----SVNVKEVVRFFNRNFPEAV-LKERHHTKVQYQLKSERISLAQVFSKMEQVMEVLGIEDYSVSQTTLDNVFVNFAKK 2255          

HSP 2 Score: 107.457 bits (267), Expect = 2.583e-26
Identity = 70/222 (31.53%), Postives = 114/222 (51.35%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHE-------------------KVKKIIQEAFLSDVSLRDENFATLQYQFCS---KIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   L+S +GD Y + +     E    + +                   +V K IQ+   S + + D N   L Y   S   K   F +LF+  EQ   +  +  + +   TLE+VF+ ++ +
Sbjct:  977 IADLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAVILDEPTAGVDPYARRAIWDLILKYKQGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLRSTYGDGYKLTLVKKQPEGRGQSSQLLTPPTQSPSSAQSPCSETRVTKFIQQFVASCLLVSDSN-TELSYVLPSEAVKKGCFERLFQALEQNLTSLALTSFGVMDTTLEEVFLKVSEE 1195          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca2 (ATP binding cassette subfamily A member 2 [Source:NCBI gene;Acc:101155855])

HSP 1 Score: 189.889 bits (481), Expect = 5.485e-55
Identity = 100/200 (50.00%), Postives = 133/200 (66.50%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCS-KIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            L  L L+ +A +     SGGNKRKLSTAIALIG P +IFLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECEALC RL IMVNG  KCLGS+QHLK++FGD Y + +R  S    + N ++V +     F   V L++ +   +QYQ  S +I + ++F   EQ+     I DYS+SQ TL++VF+N A K
Sbjct: 2062 LEKLELSKYADRPAGTYSGGNKRKLSTAIALIGFPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLGIMVNGRFKCLGSIQHLKNRFGDGYMITVRTKS----SVNVKEVVRFFNRNFPEAV-LKERHHTKVQYQLKSERISLAQVFSKMEQVMEVLGIEDYSVSQTTLDNVFVNFAKK 2255          

HSP 2 Score: 107.457 bits (267), Expect = 2.583e-26
Identity = 70/222 (31.53%), Postives = 114/222 (51.35%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHE-------------------KVKKIIQEAFLSDVSLRDENFATLQYQFCS---KIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            + +L L+     L Q LSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I K      I  +L++H+M+E + L  R++I+ +G++KC GS   L+S +GD Y + +     E    + +                   +V K IQ+   S + + D N   L Y   S   K   F +LF+  EQ   +  +  + +   TLE+VF+ ++ +
Sbjct:  977 IADLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAVILDEPTAGVDPYARRAIWDLILKYKQGRTI--LLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLRSTYGDGYKLTLVKKQPEGRGQSSQLLTPPTQSPSSAQSPCSETRVTKFIQQFVASCLLVSDSN-TELSYVLPSEAVKKGCFERLFQALEQNLTSLALTSFGVMDTTLEEVFLKVSEE 1195          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca3b (ATP binding cassette subfamily A member 3 [Source:NCBI gene;Acc:101174998])

HSP 1 Score: 186.808 bits (473), Expect = 7.590e-54
Identity = 96/199 (48.24%), Postives = 128/199 (64.32%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLH-SGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            LR+L L PHA KL ++ SGGNKRKLS  +ALIG P VIFLDEP++GMD  ARR LW+ I  +    K A+++TSH+MEECEALC RL++MVNG+ KCLGS QHLKSKFG  Y +  ++H   E E ++    K  I+  F     L+DE+   + Y    K   + ++F   E  K    I DY +SQ++LE VF++ A
Sbjct: 1501 LRSLLLEPHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWDAITHIRESGK-AIVITSHSMEECEALCTRLAVMVNGQFKCLGSPQHLKSKFGSGYTLLAKVHVEAELEESDLRVFKDFIESTFPGS-QLKDEHQGMVHYHLTDKALTWAQVFGTLEAAKEKYQIEDYCVSQISLEQVFLSFA 1697          

HSP 2 Score: 111.694 bits (278), Expect = 7.982e-28
Identity = 72/199 (36.18%), Postives = 107/199 (53.77%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC--SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L+L       ++ LSGG KRKLS  IALIG+ KV+ LDEPTSGMD  ARR  W+++Q    +    ++LT+H M+E + L  R++IM  GE++C GS   LK+K+G  Y++ I     +A  N  E  + +    ++ + +L     A L Y     S  R   LF   E  +    I  Y  S  T+E+VF+ + 
Sbjct:  644 IRILNLEDKRRARSKTLSGGMKRKLSIGIALIGDSKVVMLDEPTSGMDPSARRATWDLLQG--EKRGRTILLTTHFMDEADLLGDRIAIMAGGELQCCGSPLFLKNKYGAGYHMVI---VKDAFCNVSEITRLV--HMYVPNATLESSAGAELSYILPKESTSRFELLFAELEMNRDELGIASYGASVTTMEEVFLRVG 835          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 186.037 bits (471), Expect = 1.341e-53
Identity = 101/202 (50.00%), Postives = 138/202 (68.32%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF----CSKIRIF-KLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +R L LT +A +     SGGNKRKLSTAI+LIG P VIFLDEPT+GMD  A+RFLWN I  +T E K AV+LTSH+MEECEALC R++IMVNG+ +CLGSVQHLK++FGD Y V +RL   +++T +   V + + ++F  ++ L++++   LQY      CS   IF  L    E++     + D+S+SQ TL+ VFI+ A
Sbjct: 2050 VRKLGLTQYAEQKAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVTKEGK-AVVLTSHSMEECEALCTRMAIMVNGQFQCLGSVQHLKNRFGDGYTVILRLADTKSDTESC-PVDEYMTKSF-PNIELKEQHQNVLQYHLPSHGCSLALIFDALANNCEELG----VADFSVSQTTLDQVFISFA 2244          

HSP 2 Score: 98.2117 bits (243), Expect = 3.380e-23
Identity = 47/103 (45.63%), Postives = 69/103 (66.99%), Query Frame = 1
Query:  100 TQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKI 408
            T+NLSGG +RKLS AIA +G  KV+ LDEPT+G+D  +RR +W+++ K      I  IL++H M+E E L  R++I+  G++ C GS   LKS+ G  YY+ +
Sbjct: 1059 TKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLLLKYRKGRTI--ILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTV 1159          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029537.1 (SMESG000029537.1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.206e-133
Identity = 203/212 (95.75%), Postives = 204/212 (96.23%), Query Frame = 1
Query:   28 VESN*IS--CRHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 657
            +ESN I       LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK
Sbjct: 1781 IESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLASK 1992          

HSP 2 Score: 128.642 bits (322), Expect = 8.786e-34
Identity = 71/205 (34.63%), Postives = 130/205 (63.41%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVK-IRLHSGEAETN-NHEKVKKIIQEAFLSDVSLRDENFATLQYQFC------SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+  ++  +  + +N N E + K ++  +++D  + +E  + LQ+         +  +  +LF+  +Q  A  +I+ Y +S  +LE+VF+ +A
Sbjct:  817 IKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVK-IYIADARMMEE--SRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 1017          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.735e-103
Identity = 156/199 (78.39%), Postives = 172/199 (86.43%), Query Frame = 1
Query:   55 HKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
              LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYV IR+  G+   N++EKVK II++ F S+VS  D +F TLQY+F S  ++  +F+FFE +K    ILDYS+SQ TL+DVFIN A
Sbjct: 1791 RSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFA 1989          

HSP 2 Score: 122.094 bits (305), Expect = 1.488e-31
Identity = 72/208 (34.62%), Postives = 122/208 (58.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAE-------TNNHEKVKKIIQEAFLSDVSL----RDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            + ++ LT      ++NLSGG KRKLS A+A IG+ KV+FLDEPT+G+D  ARR +W+++ K  N+ +  +ILT+H+M+E + L  R++I+  G+++C GS   LK +FGD YY+ +  +S   E       +++ EKV   I+ A ++D  +    R +    L     +  +   LF   ++  +   I+ Y +S  +LE+VF+ +A
Sbjct:  801 IEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDER-TIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIR-AHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVA 1006          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 326.635 bits (836), Expect = 9.420e-103
Identity = 159/210 (75.71%), Postives = 176/210 (83.81%), Query Frame = 1
Query:   28 VESN*IS--CRHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +ESN I       LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYV IR+  G+   N++ KVK II++ F S+VS  D +F TLQY+F S  ++  +F+FFE +K    ILDYS+SQ TL+DVFIN A
Sbjct: 1770 IESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHANDNGKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFA 1979          

HSP 2 Score: 123.25 bits (308), Expect = 5.479e-32
Identity = 73/208 (35.10%), Postives = 122/208 (58.65%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAE-------TNNHEKVKKIIQEAFLSDVSL----RDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            + ++ LT      ++NLSGG KRKLS A+A IG+ KV+FLDEPT+G+D  ARR +WN++ K  N+ +  +ILT+H+M+E + L  R++I+  G+++C GS   LK +FGD YY+ +  +S   E       +++ EKV   I+ A ++D  +    R +    L     +  +   LF   ++  +   I+ Y +S  +LE+VF+ +A
Sbjct:  791 IEDVGLTKKMKSFSKNLSGGMKRKLSIAMAFIGDSKVVFLDEPTAGVDPFARRGIWNLLIKYRNDER-TIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIR-AHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVA 996          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029534.1 (SMESG000029534.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.042e-91
Identity = 146/207 (70.53%), Postives = 171/207 (82.61%), Query Frame = 1
Query:   28 VESN*IS--CRHKLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQF-CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVF 639
            +ESN I       L+NLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGD+YYVKI L+S + + ++  +VK  I+  F S +S++DENF TL Y F  S I++  +F FF +MK    I+D+++ Q +L+++F
Sbjct: 1863 IESNQIKSVVDTSLKNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDNYYVKIHLYSRKCQISHRLEVKLAIENNFRSGISIKDENFLTLLYTFDLSFIKLSDIFTFFHKMKVDGLIIDFTVYQTSLDEIF 2069          

HSP 2 Score: 119.398 bits (298), Expect = 1.358e-30
Identity = 70/210 (33.33%), Postives = 121/210 (57.62%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDY-YVKIRLHSGEAE------TNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFC------SKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            ++++ LT     L++ LSGG KRKLS A+A IG+P ++FLDEPT+G+D  ARR +W+++ K  N+ +  +ILT+H M+E + L  R++I+  G+++C GS   LK KFGD Y  + ++  + + E      +N+ +K+ + I+ + + D  +  E     Q+ F       +  +   LF   ++       L Y +S  +LE+VFI +A
Sbjct:  865 IKDVGLTAKVNTLSKKLSGGMKRKLSLALAFIGDPSIVFLDEPTAGVDPFARRGIWDLLIKYRNDER-TIILTTHQMDEADYLSDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIK-SHIPDAKMETETMT--QWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 1070          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 290.812 bits (743), Expect = 2.604e-90
Identity = 138/197 (70.05%), Postives = 162/197 (82.23%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            L+NLSL PH  KLTQ LSGGNKRKLSTAIA+IG PK++FLDEPTSGMDAGARRFLWNVIQ MT ENK AVILTSHNMEECE LCHRLSIMVNGEMKCLG+VQHLKSKFGDDY+VKIR++  E E+   +K+K I++  F   VSL+DENF TLQY+F   +++  +F FFE +KA   I DYS+SQ +L++VFIN A
Sbjct: 1819 LKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENES---DKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFA 2012          

HSP 2 Score: 120.168 bits (300), Expect = 8.075e-31
Identity = 73/210 (34.76%), Postives = 121/210 (57.62%), Query Frame = 1
Query:   61 LRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYY-VKIRLHSGEAETNNHEK------VKKIIQEAFLSDVSLRDENFATLQYQF------CSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 651
            +  + LT   + LT+NLSGG KRKLS A+A +G+ +V+FLDEPT+G+D  ARR +W+++ K   E++ A+ILT+H+M+E + L  R++I+  G+++C GS   LK +FG+ YY + ++  S + E   +E         K IQ   + D  + +E  +            CSK     LF+  ++      I+ Y +S  +LE+VF+ +A
Sbjct:  827 IEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDR-AIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNH-VPDAKMMEETRSQWTIALPQSENNCSKFP--DLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVA 1032          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA26.129e-5648.29ATP binding cassette subfamily A member 2 [Source:... [more]
ABCA26.129e-5648.29ATP binding cassette subfamily A member 2 [Source:... [more]
ABCA26.129e-5648.29ATP binding cassette subfamily A member 2 [Source:... [more]
ABCA26.822e-5648.29ATP binding cassette subfamily A member 2 [Source:... [more]
ABCA33.602e-5549.49ATP binding cassette subfamily A member 3 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-44.519e-4342.11ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-21.516e-4140.39ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-21.620e-4139.90ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-53.543e-3436.28ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-64.068e-3245.11ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA1.290e-4540.27gene:FBgn0031170 transcript:FBtr0332488[more]
ABCA1.301e-4540.27gene:FBgn0031170 transcript:FBtr0332489[more]
ABCA1.328e-4540.27gene:FBgn0031170 transcript:FBtr0306679[more]
CG60521.507e-3937.17gene:FBgn0036747 transcript:FBtr0075195[more]
Eato1.298e-3333.99gene:FBgn0028539 transcript:FBtr0110941[more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca3b2.480e-5549.50ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca3b4.622e-5549.50ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca3b4.931e-5549.50ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca26.723e-5549.50ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a1.738e-5247.98ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA13.287e-5549.49ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA13.432e-5549.49ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA13.454e-5549.49ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA13.700e-5549.49ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA13.997e-5549.49ATP binding cassette subfamily A member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca24.910e-5649.26ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca12.181e-5548.99ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca38.024e-5448.48ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca38.094e-5448.48ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca38.094e-5448.48ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZC7|ABCA2_HUMAN2.943e-5548.29ATP-binding cassette sub-family A member 2 OS=Homo... [more]
sp|P41234|ABCA2_MOUSE3.502e-5549.26ATP-binding cassette sub-family A member 2 OS=Mus ... [more]
sp|P41233|ABCA1_MOUSE1.526e-5448.99Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|Q99758|ABCA3_HUMAN2.026e-5449.49ATP-binding cassette sub-family A member 3 OS=Homo... [more]
sp|O95477|ABCA1_HUMAN2.885e-5448.99Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087T0221.817e-6149.75ATP-binding cassette sub-family A member 1 (Fragme... [more]
A0A2L2YS931.235e-5948.22ATP-binding cassette sub-family A member 1 (Fragme... [more]
A0A0B6ZKX41.622e-5951.00ABC transporter domain-containing protein (Fragmen... [more]
A0A210PGD82.614e-5852.06ATP-binding cassette sub-family A member 1 OS=Mizu... [more]
A0A4Y2IF524.904e-5851.78ATP-binding cassette sub-family A member 1 OS=Aran... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1723021.223e-5550.50zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
zgc:1723021.820e-5550.50zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
abca22.852e-5549.50ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca3b6.090e-5548.24ATP binding cassette subfamily A member 3 [Source:... [more]
abca3b8.134e-5548.24ATP binding cassette subfamily A member 3 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006855.19.369e-5949.75pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
ENSPMAT00000010397.11.339e-5141.15pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1... [more]
abca124.090e-5146.19ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000002495.19.323e-2633.04pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
ENSPMAT00000006988.11.849e-2443.93pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YOL075C_mRNA8.162e-1039.34Putative ABC transporter [Source:SGD;Acc:S00000543... [more]
NEW12.326e-937.89ATP binding cassette protein; cosediments with pol... [more]
ADP11.325e-827.36Putative ATP-dependent permease of the ABC transpo... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468781.018e-5649.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280923.752e-5548.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489515.375e-5247.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320712.401e-3639.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388796.255e-2232.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca25.447e-5550.00ATP binding cassette subfamily A member 2 [Source:... [more]
abca25.485e-5550.00ATP binding cassette subfamily A member 2 [Source:... [more]
abca25.485e-5550.00ATP binding cassette subfamily A member 2 [Source:... [more]
abca3b7.590e-5448.24ATP binding cassette subfamily A member 3 [Source:... [more]
zgc:1723021.341e-5350.00ATP-binding cassette sub-family A member 1 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029537.11.206e-13395.75SMESG000029537.1[more]
SMESG000032861.11.735e-10378.39SMESG000032861.1[more]
SMESG000032891.19.420e-10375.71SMESG000032891.1[more]
SMESG000029534.11.042e-9170.53SMESG000029534.1[more]
SMESG000068605.12.604e-9070.05SMESG000068605.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010001 ID=SMED30010001|Name=ATP-binding cassette sub-family A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=692bp
TTTTTATTGTCGAATTCGCGGAATTGAGTCGAATCAAATTAAATCAGTTG
TCGACACAAGTTGAGAAATCTTAGTCTTACTCCTCATGCAACTAAATTGA
CTCAAAATCTGTCGGGAGGAAATAAACGGAAACTGTCAACTGCAATCGCT
TTAATTGGAAATCCGAAAGTGATATTTCTAGACGAACCAACAAGCGGCAT
GGATGCAGGAGCTCGGCGGTTTCTATGGAATGTGATACAGAAAATGACAA
ATGAAAATAAAATCGCAGTAATTTTGACTTCTCATAACATGGAAGAATGT
GAAGCTCTCTGTCACAGGCTGTCAATAATGGTGAATGGAGAAATGAAATG
CCTGGGCAGCGTGCAGCATTTGAAATCGAAATTCGGTGATGATTATTACG
TCAAAATACGATTGCATTCTGGTGAAGCTGAAACAAATAATCACGAAAAG
GTCAAAAAAATTATACAGGAAGCGTTTCTATCTGATGTTTCTCTTAGAGA
TGAAAACTTTGCCACGCTTCAATACCAATTTTGTTCAAAAATTAGGATAT
TCAAACTGTTTGAATTTTTCGAACAGATGAAAGCGACAAAAACTATTCTT
GATTATTCTATTTCTCAAATGACTCTTGAAGATGTTTTCATTAACCTAGC
AAGTAAATAATTGTTATGTAAAATATATTGAAACTATTTTCG
back to top

protein sequence of SMED30010001-orf-1

>SMED30010001-orf-1 ID=SMED30010001-orf-1|Name=SMED30010001-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMK
CLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEKVKKIIQEAFLSDVSLR
DENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINL
ASK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR007921CHAP_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane