Rho-GAP domain-containing protein

Overview
NameRho-GAP domain-containing protein
Smed IDSMED30009975
Length (bp)3875
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho-GAP domain-containing protein (SMED30009975) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho-GAP domain-containing protein (SMED30009975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho-GAP domain-containing protein (SMED30009975) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho-GAP domain-containing protein (SMED30009975) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30009975SMESG000078332.1 dd_Smed_v4_5208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009975SMESG000078332.1 dd_Smed_v4_5208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009975SMESG000078332.1 dd_Smed_v4_5208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009975SMESG000078332.1 dd_Smed_v4_5208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009975SMESG000078332.1 dd_Smed_v4_5208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009975SMESG000078332.1 dd_Smed_v4_5208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009975SMESG000078332.1 dd_Smed_v4_7670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009975SMESG000078332.1 dd_Smed_v4_7670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009975SMESG000078332.1 dd_Smed_v4_7670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009975SMESG000078332.1 dd_Smed_v4_7670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009975SMESG000032689.1 Contig5660GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009975SMESG000078332.1 Contig5660GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: GMIP (GEM interacting protein [Source:HGNC Symbol;Acc:HGNC:24852])

HSP 1 Score: 109.383 bits (272), Expect = 2.194e-23
Identity = 64/195 (32.82%), Postives = 107/195 (54.87%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK--EAESGE-------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSK--PRFRMA-DIKEYMDNKSQAKIVQIIIENVETLFG 2203
            V  +V KC   IE   L   GIYRVS S+++V  + ++  +  A  +L    P  +++V+K  L  L+EP++P+HLY+ F+ L K   A+ G+         +++  L+ L+ QLP SN      +  HL ++A    EN+M + NLG +F PTL++    PR   A  +   +D+  QA++V+ +I + E +FG
Sbjct:  538 VPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHLYDAFISLAKTLHADPGDDPGTPSPSPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLRPPDGPRAASAIPVTCLLDSGHQAQLVEFLIVHYEQIFG 732          

HSP 2 Score: 63.929 bits (154), Expect = 1.962e-9
Identity = 49/195 (25.13%), Postives = 88/195 (45.13%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITEASLDLSPG-------ITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-LDVINRQ-----------RTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            +PL+S D + +   +A    EAS    P          E+  L   + K  VD +L YAK W ++ KEL+   EK+A+ E+E  +S  K  ++ + ++                 S + +     + ++++  LG L ++ + +Q           RTE  K RK +KE+W  + K+M +A   + + +  Y QR
Sbjct:   43 DPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRASYELEFAKSTMKIAEAGKVSIQQQ--------------SHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQPLAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQR 223          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: GMIP (GEM interacting protein [Source:HGNC Symbol;Acc:HGNC:24852])

HSP 1 Score: 109.383 bits (272), Expect = 2.293e-23
Identity = 64/195 (32.82%), Postives = 107/195 (54.87%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK--EAESGE-------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSK--PRFRMA-DIKEYMDNKSQAKIVQIIIENVETLFG 2203
            V  +V KC   IE   L   GIYRVS S+++V  + ++  +  A  +L    P  +++V+K  L  L+EP++P+HLY+ F+ L K   A+ G+         +++  L+ L+ QLP SN      +  HL ++A    EN+M + NLG +F PTL++    PR   A  +   +D+  QA++V+ +I + E +FG
Sbjct:  564 VPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHLYDAFISLAKTLHADPGDDPGTPSPSPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLRPPDGPRAASAIPVTCLLDSGHQAQLVEFLIVHYEQIFG 758          

HSP 2 Score: 63.929 bits (154), Expect = 1.949e-9
Identity = 49/195 (25.13%), Postives = 88/195 (45.13%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITEASLDLSPG-------ITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-LDVINRQ-----------RTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            +PL+S D + +   +A    EAS    P          E+  L   + K  VD +L YAK W ++ KEL+   EK+A+ E+E  +S  K  ++ + ++                 S + +     + ++++  LG L ++ + +Q           RTE  K RK +KE+W  + K+M +A   + + +  Y QR
Sbjct:   43 DPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRASYELEFAKSTMKIAEAGKVSIQQQ--------------SHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQPLAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQR 223          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP10 (Rho GTPase activating protein 10 [Source:HGNC Symbol;Acc:HGNC:26099])

HSP 1 Score: 98.5969 bits (244), Expect = 6.772e-21
Identity = 61/188 (32.45%), Postives = 100/188 (53.19%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPV---------TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            I+ KCI  +E  G++  G+YRV    + V S ++ L S   D    NE  +         T+ + +K  L SL EPL+ Y L+ +F+     A+SG     V  +  LV++LP  N+++  ++  HL  ++N+S++N M   NLG +F PTL++ +       +   MD K Q  +V+I+IEN E +F
Sbjct:   76 IIRKCISAVETRGINDQGLYRV----VGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFI---VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEE----TVAALMDLKFQNIVVEILIENHEKIF 252          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP29 (Rho GTPase activating protein 29 [Source:HGNC Symbol;Acc:HGNC:30207])

HSP 1 Score: 101.293 bits (251), Expect = 8.088e-21
Identity = 61/209 (29.19%), Postives = 104/209 (49.76%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG---------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +KE D +  I+  C   IE   L   GIYRV  +K+K   + ++L +     D+       + +V+K  L  L EP + + LY EF+DL KE +                       E++ ++ K + L+ QLP+SN      +  HLK++ +++EEN+M S NLG +F P+LI+ +P      I    +  +QA++V+ +I   + +F
Sbjct:  678 KKEPDGIPFILKICASEIENRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSKNLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIF 886          

HSP 2 Score: 58.151 bits (139), Expect = 1.323e-7
Identity = 49/151 (32.45%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  188 DDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIID-------QCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            D+ LL  K+ ++++ +L+YAK W K+ K +V   EKK  LE+E  R+  K  ++  T +         M  +SL  + L+ D       Q     +Q NK +  LL     ++ E  K RK  KE WK +  KM++AEN + K K    QR
Sbjct:  195 DNVLL--KNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEF----MPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLG----RKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQR 335          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP29 (Rho GTPase activating protein 29 [Source:HGNC Symbol;Acc:HGNC:30207])

HSP 1 Score: 100.908 bits (250), Expect = 9.628e-21
Identity = 61/209 (29.19%), Postives = 104/209 (49.76%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG---------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +KE D +  I+  C   IE   L   GIYRV  +K+K   + ++L +     D+       + +V+K  L  L EP + + LY EF+DL KE +                       E++ ++ K + L+ QLP+SN      +  HLK++ +++EEN+M S NLG +F P+LI+ +P      I    +  +QA++V+ +I   + +F
Sbjct:  678 KKEPDGIPFILKICASEIENRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSKNLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIF 886          

HSP 2 Score: 59.3066 bits (142), Expect = 5.441e-8
Identity = 49/151 (32.45%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  188 DDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIID-------QCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            D+ LL  K+ ++++ +L+YAK W K+ K +V   EKK  LE+E  R+  K  ++  T +         M  +SL  + L+ D       Q     +Q NK +  LL     ++ E  K RK  KE WK +  KM++AEN + K K    QR
Sbjct:  195 DNVLL--KNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEF----MPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLG----RKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQR 335          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 100.523 bits (249), Expect = 1.452e-21
Identity = 62/192 (32.29%), Postives = 99/192 (51.56%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLI--NEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVS------DLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQ 2215
            I+ K I+ ++  GL   GIYR    K K+  +  +     +D ++   NE P+ LA+VVK  L  L EPL+ + LY++FV LG E  S + S      + V +L+ L  +LP  N +    I  HL +++   E N M + NL T+ AP+LI   P+ R+      M  +   K ++++I N   +FG + Q
Sbjct:  157 IIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSDDEVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPK-RIDHTSAIMHTQYTNKAIEVMIRNSYHIFGMDRQ 347          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 101.679 bits (252), Expect = 1.565e-21
Identity = 63/192 (32.81%), Postives = 99/192 (51.56%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADAD--LINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVS------DLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQ 2215
            I+ K I+ ++  GL   GIYR    K K+  +  +     +D +  L NE P+ LA+VVK  L  L EPL+ + LY++FV LG E  S + S      + V +L+ L  +LP  N +    I  HL +++   E N M + NL T+ AP+LI   P+ R+      M  +   K ++++I N   +FG + Q
Sbjct:  500 IIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSDDEVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPK-RIDHTSAIMHTQYTNKAIEVMIRNSYHIFGMDRQ 690          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 100.523 bits (249), Expect = 1.811e-21
Identity = 62/192 (32.29%), Postives = 99/192 (51.56%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLI--NEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVS------DLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQ 2215
            I+ K I+ ++  GL   GIYR    K K+  +  +     +D ++   NE P+ LA+VVK  L  L EPL+ + LY++FV LG E  S + S      + V +L+ L  +LP  N +    I  HL +++   E N M + NL T+ AP+LI   P+ R+      M  +   K ++++I N   +FG + Q
Sbjct:  195 IIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSDDEVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPK-RIDHTSAIMHTQYTNKAIEVMIRNSYHIFGMDRQ 385          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 101.293 bits (251), Expect = 2.376e-21
Identity = 63/192 (32.81%), Postives = 99/192 (51.56%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADAD--LINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVS------DLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQ 2215
            I+ K I+ ++  GL   GIYR    K K+  +  +     +D +  L NE P+ LA+VVK  L  L EPL+ + LY++FV LG E  S + S      + V +L+ L  +LP  N +    I  HL +++   E N M + NL T+ AP+LI   P+ R+      M  +   K ++++I N   +FG + Q
Sbjct:  551 IIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSDDEVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPK-RIDHTSAIMHTQYTNKAIEVMIRNSYHIFGMDRQ 741          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 100.908 bits (250), Expect = 3.288e-21
Identity = 63/192 (32.81%), Postives = 99/192 (51.56%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADAD--LINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVS------DLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQ 2215
            I+ K I+ ++  GL   GIYR    K K+  +  +     +D +  L NE P+ LA+VVK  L  L EPL+ + LY++FV LG E  S + S      + V +L+ L  +LP  N +    I  HL +++   E N M + NL T+ AP+LI   P+ R+      M  +   K ++++I N   +FG + Q
Sbjct:  615 IIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSDDEVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPK-RIDHTSAIMHTQYTNKAIEVMIRNSYHIFGMDRQ 805          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: Graf (gene:FBgn0030685 transcript:FBtr0074194)

HSP 1 Score: 92.4337 bits (228), Expect = 1.592e-18
Identity = 54/186 (29.03%), Postives = 101/186 (54.30%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVME-SLNSQGADADLINE------QPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             + +CI+V+EI GL   GIYR S    K+  ++   LN + +D   +++      +  T+A+ +K  L +L+EPL+ Y  +++F++  K+     ++  V ++  LV +LP  N ++  ++  HL  ++   E+N+M   NLG +F PTL+    R R   +   +D K    ++ I+I+N E +F
Sbjct:  402 FIRRCIQVLEIRGLEDEGIYRKSGVGTKISKLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEAAKQET---LNQRVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLL----RPREESVAAILDIKFNNIVINILIDNYERIF 580          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: Graf (gene:FBgn0030685 transcript:FBtr0345133)

HSP 1 Score: 92.4337 bits (228), Expect = 1.592e-18
Identity = 54/186 (29.03%), Postives = 101/186 (54.30%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVME-SLNSQGADADLINE------QPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             + +CI+V+EI GL   GIYR S    K+  ++   LN + +D   +++      +  T+A+ +K  L +L+EPL+ Y  +++F++  K+     ++  V ++  LV +LP  N ++  ++  HL  ++   E+N+M   NLG +F PTL+    R R   +   +D K    ++ I+I+N E +F
Sbjct:  402 FIRRCIQVLEIRGLEDEGIYRKSGVGTKISKLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEAAKQET---LNQRVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLL----RPREESVAAILDIKFNNIVINILIDNYERIF 580          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: Graf (gene:FBgn0030685 transcript:FBtr0074197)

HSP 1 Score: 92.4337 bits (228), Expect = 1.592e-18
Identity = 54/186 (29.03%), Postives = 101/186 (54.30%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVME-SLNSQGADADLINE------QPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             + +CI+V+EI GL   GIYR S    K+  ++   LN + +D   +++      +  T+A+ +K  L +L+EPL+ Y  +++F++  K+     ++  V ++  LV +LP  N ++  ++  HL  ++   E+N+M   NLG +F PTL+    R R   +   +D K    ++ I+I+N E +F
Sbjct:  402 FIRRCIQVLEIRGLEDEGIYRKSGVGTKISKLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEAAKQET---LNQRVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLL----RPREESVAAILDIKFNNIVINILIDNYERIF 580          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: Graf (gene:FBgn0030685 transcript:FBtr0074198)

HSP 1 Score: 92.4337 bits (228), Expect = 1.592e-18
Identity = 54/186 (29.03%), Postives = 101/186 (54.30%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVME-SLNSQGADADLINE------QPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             + +CI+V+EI GL   GIYR S    K+  ++   LN + +D   +++      +  T+A+ +K  L +L+EPL+ Y  +++F++  K+     ++  V ++  LV +LP  N ++  ++  HL  ++   E+N+M   NLG +F PTL+    R R   +   +D K    ++ I+I+N E +F
Sbjct:  402 FIRRCIQVLEIRGLEDEGIYRKSGVGTKISKLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEAAKQET---LNQRVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLL----RPREESVAAILDIKFNNIVINILIDNYERIF 580          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: Graf (gene:FBgn0030685 transcript:FBtr0340306)

HSP 1 Score: 92.4337 bits (228), Expect = 1.699e-18
Identity = 54/186 (29.03%), Postives = 101/186 (54.30%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVME-SLNSQGADADLINE------QPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             + +CI+V+EI GL   GIYR S    K+  ++   LN + +D   +++      +  T+A+ +K  L +L+EPL+ Y  +++F++  K+     ++  V ++  LV +LP  N ++  ++  HL  ++   E+N+M   NLG +F PTL+    R R   +   +D K    ++ I+I+N E +F
Sbjct:  411 FIRRCIQVLEIRGLEDEGIYRKSGVGTKISKLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEAAKQET---LNQRVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLL----RPREESVAAILDIKFNNIVINILIDNYERIF 589          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: gmip (GEM interacting protein [Source:ZFIN;Acc:ZDB-GENE-130530-823])

HSP 1 Score: 111.694 bits (278), Expect = 2.114e-24
Identity = 65/196 (33.16%), Postives = 106/196 (54.08%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKE----------AES-GEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFG 2203
            D+V  +VL+C E IE   L   G+YR+S SK +V  + ++   Q    DL +  P  + +V+K     L EPL+ + LYN+F+ +GKE          AES G V ++V +L+ L+ +LP  N      +  HL ++A   E+N+M   NLG +F PTL++      ++ I   ++   QA +V+ +I N + +FG
Sbjct:  562 DSVPFVVLRCTEEIENRALGVQGVYRISGSKPRVLKLCQAFEIQKDQVDLSDLSPHDITSVLKHFFKELPEPLLTFDLYNDFIAVGKEIQRLSEKDHAAESPGIVENIVRRLRELIGRLPVCNNITVQHMMAHLNRVAEQFEDNKMSPGNLGIVFGPTLLRPLVSGDVSMIA-LLETSYQALLVEFMISNYDQVFG 756          

HSP 2 Score: 65.855 bits (159), Expect = 3.022e-10
Identity = 43/172 (25.00%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  179 ITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLG--------KLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQAL 670
            I +D  L     ++ V+ +L YAK+WC++ K+L+   +K+ +LE E  +S  +   + ++ V+   M   P+++        I  Q  E +++ +            +    ++ +R E  K R+ +KE+W  + K+M DA + + + +  Y QRC       EEL  A+A+
Sbjct:  100 IAQDADLSLCHCEDGVELALQYAKMWCRYAKDLLTWMDKRISLEQEFAKSIMRAADAAKSCVAQQDMM--PLQN--------IYTQALEHDLKTSASAKQSAENIQQRCYQALSAKRNEIDKWRREFKEQWSKEQKRMHDAVSALKRARQQYMQRC-------EELEKAKAM 254          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: gmip (GEM interacting protein [Source:ZFIN;Acc:ZDB-GENE-130530-823])

HSP 1 Score: 110.923 bits (276), Expect = 3.974e-24
Identity = 65/196 (33.16%), Postives = 106/196 (54.08%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKE----------AES-GEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFG 2203
            D+V  +VL+C E IE   L   G+YR+S SK +V  + ++   Q    DL +  P  + +V+K     L EPL+ + LYN+F+ +GKE          AES G V ++V +L+ L+ +LP  N      +  HL ++A   E+N+M   NLG +F PTL++      ++ I   ++   QA +V+ +I N + +FG
Sbjct:  439 DSVPFVVLRCTEEIENRALGVQGVYRISGSKPRVLKLCQAFEIQKDQVDLSDLSPHDITSVLKHFFKELPEPLLTFDLYNDFIAVGKEIQRLSEKDHAAESPGIVENIVRRLRELIGRLPVCNNITVQHMMAHLNRVAEQFEDNKMSPGNLGIVFGPTLLRPLVSGDVSMIA-LLETSYQALLVEFMISNYDQVFG 633          

HSP 2 Score: 53.9138 bits (128), Expect = 1.438e-6
Identity = 35/148 (23.65%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  251 LWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLG--------KLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQAL 670
            +WC++ K+L+   +K+ +LE E  +S  +   + ++ V+   M   P+++        I  Q  E +++ +            +    ++ +R E  K R+ +KE+W  + K+M DA + + + +  Y QRC       EEL  A+A+
Sbjct:    1 MWCRYAKDLLTWMDKRISLEQEFAKSIMRAADAAKSCVAQQDMM--PLQN--------IYTQALEHDLKTSASAKQSAENIQQRCYQALSAKRNEIDKWRREFKEQWSKEQKRMHDAVSALKRARQQYMQRC-------EELEKAKAM 131          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: arhgap45a (Rho GTPase activating protein 45a [Source:ZFIN;Acc:ZDB-GENE-140106-47])

HSP 1 Score: 110.153 bits (274), Expect = 9.275e-24
Identity = 64/207 (30.92%), Postives = 105/207 (50.72%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEA-----------------------ESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            DAV  I+ KCI  IE   L   GIYRV+  K +V  + ++  +     +L    P  ++NV+K  L  L EP++P+ +YNE + L KE+                          EV  LV KL+ ++ +LP++N      I  HL++++   +EN+M + NLG +F PTL++ KP      +   +D   QA+IV+ +I   +++F
Sbjct:  785 DAVPFIIKKCITEIERRALKMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPEPIMPFRMYNELMGLAKESLNSDASESTDGVKSPELVDRGPETEAEVLTLVDKLREVLKRLPNANIATLKYIIQHLRRVSELEQENKMSASNLGIVFGPTLMRPKPTGATVSLSSLVDYPHQARIVEALIVFQQSIF 991          

HSP 2 Score: 63.929 bits (154), Expect = 1.272e-9
Identity = 40/154 (25.97%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  197 LLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQ-----CKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLR 643
            +L ++ +  VD +L+Y+K   K+ K+++   +K+  LE E  +   + +QS +  +    M   P+    LS+  L ++Q     C   +  NN      L  + ++R E  K R+  KE+W+   +K+ DAE+ + K +  Y  RC++  + R
Sbjct:  288 ILLQRSEGGVDSALSYSKSIAKYMKDIISYVDKRIALENEFSKGLQRLYQSCKQNIIQDHM---PL----LSIFSLALEQDSEQSCGLQQTTNNIYTHSFLQPMTQRRQEHEKKRRDIKEQWQRAKRKLADAESNLRKARQLYMSRCEEYERAR 434          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: arhgap29a (Rho GTPase activating protein 29a [Source:ZFIN;Acc:ZDB-GENE-030131-9510])

HSP 1 Score: 105.531 bits (262), Expect = 2.268e-22
Identity = 61/205 (29.76%), Postives = 107/205 (52.20%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAES---------------------GEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KC   IE   L+  GIYRV+ +K +V  + ++  +     +L +  P  ++NV+K  L  L EPL+ +  YN+F+ L KE++S                      E++ ++ K++ L+ QLP ++ K    +  HL +++  ++EN+M S NLG +F PTLIK +       +   +D   QA IV+++I + E +F
Sbjct:  550 DGIPFIIKKCTSEIENRALNIKGIYRVNGAKSRVEKLCQAFENGKDLVELSDLYPHDISNVLKLYLRQLPEPLILFRYYNDFIGLAKESQSIIVDEVEASRGCPTSDTPQISVELNRVLFKIKDLLRQLPPAHYKTLQFLIQHLHRVSERADENKMTSSNLGIIFGPTLIKPRQADAEVSLSSLVDYPYQALIVELLIRHYEMIF 754          

HSP 2 Score: 60.4622 bits (145), Expect = 1.510e-8
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 2
Query:  191 DKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKL--GKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLR 643
            D  L R D + V+ +L YAK W K+ KEL+   +K+  ++IE  +S++K  +S +   S       P R   +S  +  I+  + I +Q    L   K +  +  +++E  K RK  KE+W+ + KKM +A++ + K +    QR ++  K R
Sbjct:   39 DGALLRSD-SGVESALLYAKAWSKYTKELLAWVDKRLNMDIECAKSYAKMAESAKALASQQEHM--PFRDIYISAFRNDIEYSQLI-MQTTAALQANKFMQPLQARKSELDKLRKEVKEQWQREQKKMHEADSALRKARLLQAQRQEEYEKAR 187          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: arhgap42b (Rho GTPase activating protein 42b [Source:ZFIN;Acc:ZDB-GENE-120217-5])

HSP 1 Score: 104.76 bits (260), Expect = 3.565e-22
Identity = 64/184 (34.78%), Postives = 107/184 (58.15%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANV-----VKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             V KCI+++E+ GL+T G+YRV     KV  +M ++ S  A +DL +  P T  N      +K+ L  LSEPL+ Y L+++F+      +S + +  V  +  LV++LP  NR++  ++  HL  ++++SE N M   NLG +F PTL++S+       +   M+ K Q  +V+I+IEN+E +F
Sbjct:  399 FVRKCIQLVEVRGLNTMGLYRVGGINSKVQKLMTTVFSPKAASDL-DLDPDTWDNKTITSGLKNYLRCLSEPLMTYKLHSDFL---MAVKSDDQNYRVCAVHALVHKLPDKNREMLEILIKHLLNVSSHSESNMMTVSNLGVIFGPTLMRSQEE----TVAAMMNIKFQNIVVEILIENLEKIF 574          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: arhgap45 (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:100125789])

HSP 1 Score: 103.605 bits (257), Expect = 1.247e-21
Identity = 60/202 (29.70%), Postives = 98/202 (48.51%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  ++ KC+  IE   L+  GIYRV+  K +V  + ++  +     +L    P  L+NV+K  L  L EPL+P+ LYN  + L KE+  G                  EV  +V +L+ L+  LP  NR     +  HL +++   + N+M   NLG +F P L++ +P      +   +D   QA+IV+ +I    T+F
Sbjct:  613 DHIPFLIRKCVSEIEERALTMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFRLYNGLMGLAKESLRGTETGKGSRLQDKGPNTEPEVLSMVVQLKELLQDLPVDNRTTLQYLVKHLCRVSEQEQLNKMSPSNLGIVFGPALMRPRPTDATVSLSSLVDYPHQARIVETLIIFYSTIF 814          

HSP 2 Score: 60.4622 bits (145), Expect = 1.955e-8
Identity = 41/157 (26.11%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  161 LDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS-ESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQ 628
            L+    + ED  ++ ++    V  +L YAK   K+ K+L    EK+  LE+E  +   K   +++  ++       P +S  S++L + +      +      +    L  IN +R E  K RK  KE+W+   +K+M+AE+ + K + AY QR ++
Sbjct:  126 LEAGSALAEDVDVILQRSDGGVQAALLYAKNMAKYLKDLSNYIEKRTILEMEYAKGLQKLVNAYKGALNQETHM--PFQSIYSVALEQDLEHGNGVLHTALTLQHQTFLQPINMRRQEHEKRRKEVKEQWQRAQRKLMEAESNLRKARQAYMQRSEE 280          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: arhgap45 (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:100125789])

HSP 1 Score: 103.605 bits (257), Expect = 1.350e-21
Identity = 60/202 (29.70%), Postives = 98/202 (48.51%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  ++ KC+  IE   L+  GIYRV+  K +V  + ++  +     +L    P  L+NV+K  L  L EPL+P+ LYN  + L KE+  G                  EV  +V +L+ L+  LP  NR     +  HL +++   + N+M   NLG +F P L++ +P      +   +D   QA+IV+ +I    T+F
Sbjct:  637 DHIPFLIRKCVSEIEERALTMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFRLYNGLMGLAKESLRGTETGKGSRLQDKGPNTEPEVLSMVVQLKELLQDLPVDNRTTLQYLVKHLCRVSEQEQLNKMSPSNLGIVFGPALMRPRPTDATVSLSSLVDYPHQARIVETLIIFYSTIF 838          

HSP 2 Score: 60.077 bits (144), Expect = 2.606e-8
Identity = 41/157 (26.11%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  161 LDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS-ESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQ 628
            L+    + ED  ++ ++    V  +L YAK   K+ K+L    EK+  LE+E  +   K   +++  ++       P +S  S++L + +      +      +    L  IN +R E  K RK  KE+W+   +K+M+AE+ + K + AY QR ++
Sbjct:  150 LEAGSALAEDVDVILQRSDGGVQAALLYAKNMAKYLKDLSNYIEKRTILEMEYAKGLQKLVNAYKGALNQETHM--PFQSIYSVALEQDLEHGNGVLHTALTLQHQTFLQPINMRRQEHEKRRKEVKEQWQRAQRKLMEAESNLRKARQAYMQRSEE 304          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: arhgap45 (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:100125789])

HSP 1 Score: 103.219 bits (256), Expect = 1.374e-21
Identity = 60/202 (29.70%), Postives = 98/202 (48.51%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  ++ KC+  IE   L+  GIYRV+  K +V  + ++  +     +L    P  L+NV+K  L  L EPL+P+ LYN  + L KE+  G                  EV  +V +L+ L+  LP  NR     +  HL +++   + N+M   NLG +F P L++ +P      +   +D   QA+IV+ +I    T+F
Sbjct:  585 DHIPFLIRKCVSEIEERALTMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFRLYNGLMGLAKESLRGTETGKGSRLQDKGPNTEPEVLSMVVQLKELLQDLPVDNRTTLQYLVKHLCRVSEQEQLNKMSPSNLGIVFGPALMRPRPTDATVSLSSLVDYPHQARIVETLIIFYSTIF 786          

HSP 2 Score: 60.077 bits (144), Expect = 2.544e-8
Identity = 41/157 (26.11%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  161 LDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS-ESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQ 628
            L+    + ED  ++ ++    V  +L YAK   K+ K+L    EK+  LE+E  +   K   +++  ++       P +S  S++L + +      +      +    L  IN +R E  K RK  KE+W+   +K+M+AE+ + K + AY QR ++
Sbjct:  125 LEAGSALAEDVDVILQRSDGGVQAALLYAKNMAKYLKDLSNYIEKRTILEMEYAKGLQKLVNAYKGALNQETHM--PFQSIYSVALEQDLEHGNGVLHTALTLQHQTFLQPINMRRQEHEKRRKEVKEQWQRAQRKLMEAESNLRKARQAYMQRSEE 279          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: arhgap45 (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:100125789])

HSP 1 Score: 103.605 bits (257), Expect = 1.421e-21
Identity = 60/202 (29.70%), Postives = 98/202 (48.51%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  ++ KC+  IE   L+  GIYRV+  K +V  + ++  +     +L    P  L+NV+K  L  L EPL+P+ LYN  + L KE+  G                  EV  +V +L+ L+  LP  NR     +  HL +++   + N+M   NLG +F P L++ +P      +   +D   QA+IV+ +I    T+F
Sbjct:  664 DHIPFLIRKCVSEIEERALTMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFRLYNGLMGLAKESLRGTETGKGSRLQDKGPNTEPEVLSMVVQLKELLQDLPVDNRTTLQYLVKHLCRVSEQEQLNKMSPSNLGIVFGPALMRPRPTDATVSLSSLVDYPHQARIVETLIIFYSTIF 865          

HSP 2 Score: 58.5362 bits (140), Expect = 8.159e-8
Identity = 43/163 (26.38%), Postives = 72/163 (44.17%), Query Frame = 2
Query:  161 LDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSK------QFQS-FETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQ 628
            L+    + ED  ++ ++    V  +L YAK   K+ K+L    EK+  LE+E  +   K       FQS +   +   +  G  +   +L+L                      L  IN +R E  K RK  KE+W+   +K+M+AE+ + K + AY QR ++
Sbjct:  244 LEAGSALAEDVDVILQRSDGGVQAALLYAKNMAKYLKDLSNYIEKRTILEMEYAKGLQKLVNTHMPFQSIYSVALEQDLEHGNGVLHTALTLQHQT-----------------FLQPINMRRQEHEKRRKEVKEQWQRAQRKLMEAESNLRKARQAYMQRSEE 389          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: arhgap45 (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:100125789])

HSP 1 Score: 103.605 bits (257), Expect = 1.450e-21
Identity = 60/202 (29.70%), Postives = 98/202 (48.51%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESG------------------EVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  ++ KC+  IE   L+  GIYRV+  K +V  + ++  +     +L    P  L+NV+K  L  L EPL+P+ LYN  + L KE+  G                  EV  +V +L+ L+  LP  NR     +  HL +++   + N+M   NLG +F P L++ +P      +   +D   QA+IV+ +I    T+F
Sbjct:  712 DHIPFLIRKCVSEIEERALTMKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFRLYNGLMGLAKESLRGTETGKGSRLQDKGPNTEPEVLSMVVQLKELLQDLPVDNRTTLQYLVKHLCRVSEQEQLNKMSPSNLGIVFGPALMRPRPTDATVSLSSLVDYPHQARIVETLIIFYSTIF 913          

HSP 2 Score: 60.8474 bits (146), Expect = 1.460e-8
Identity = 41/157 (26.11%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  161 LDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS-ESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQ 628
            L+    + ED  ++ ++    V  +L YAK   K+ K+L    EK+  LE+E  +   K   +++  ++       P +S  S++L + +      +      +    L  IN +R E  K RK  KE+W+   +K+M+AE+ + K + AY QR ++
Sbjct:  253 LEAGSALAEDVDVILQRSDGGVQAALLYAKNMAKYLKDLSNYIEKRTILEMEYAKGLQKLVNAYKGALNQETHM--PFQSIYSVALEQDLEHGNGVLHTALTLQHQTFLQPINMRRQEHEKRRKEVKEQWQRAQRKLMEAESNLRKARQAYMQRSEE 407          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Gmip (Gem-interacting protein [Source:MGI Symbol;Acc:MGI:1926066])

HSP 1 Score: 110.538 bits (275), Expect = 7.437e-24
Identity = 63/195 (32.31%), Postives = 107/195 (54.87%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK--EAESGE-------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSK--PRFRMAD-IKEYMDNKSQAKIVQIIIENVETLFG 2203
            V  ++ +C   IE   L   GIYRVS S+++V  + ++  +  A  +L    P  + +V+K  L  L++P+VP+HLY+ F+ L K   A+ G+         +++  L+ L+ QLP SN      +  HL ++A   EEN+M + NLG +F PTL++    PR   A  +   +D+  QA++V+ +I + E +FG
Sbjct:  563 VPFVITRCTAEIEHRALGLQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGDDPGTPNPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENKMSANNLGIVFGPTLLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFG 757          

HSP 2 Score: 58.5362 bits (140), Expect = 6.346e-8
Identity = 50/199 (25.13%), Postives = 94/199 (47.24%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITEAS------LDLSP----GITEDD-KLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-LDVINRQ-----------RTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            +P+   D + +   +A  +TE +       DLSP     +TE++  L   + K  VD +L YAK W ++ KEL+   +K+A  E+E  +S  K  ++ + ++              L  S++ +     + ++++  LG L L+ + +Q           R E  K RK +KE+W  + K+M +A   + +++  Y QR
Sbjct:   43 DPVRREDLEPDKADTATVVTEENSEASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAKELLAWTDKRANYELEFAKSIMKLAEAGKVSI--------------LQQSQMPLQYIYTLFLEHDLSLGALALETVAQQKRDYYQPLAAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQR 227          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Gmip (Gem-interacting protein [Source:MGI Symbol;Acc:MGI:1926066])

HSP 1 Score: 110.153 bits (274), Expect = 8.062e-24
Identity = 63/195 (32.31%), Postives = 107/195 (54.87%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK--EAESGE-------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSK--PRFRMAD-IKEYMDNKSQAKIVQIIIENVETLFG 2203
            V  ++ +C   IE   L   GIYRVS S+++V  + ++  +  A  +L    P  + +V+K  L  L++P+VP+HLY+ F+ L K   A+ G+         +++  L+ L+ QLP SN      +  HL ++A   EEN+M + NLG +F PTL++    PR   A  +   +D+  QA++V+ +I + E +FG
Sbjct:  563 VPFVITRCTAEIEHRALGLQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGDDPGTPNPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENKMSANNLGIVFGPTLLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFG 757          

HSP 2 Score: 58.151 bits (139), Expect = 7.979e-8
Identity = 50/199 (25.13%), Postives = 94/199 (47.24%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITE------ASLDLSP----GITEDD-KLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-LDVINRQ-----------RTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            +P+   D + +   +A  +TE      +  DLSP     +TE++  L   + K  VD +L YAK W ++ KEL+   +K+A  E+E  +S  K  ++ + ++              L  S++ +     + ++++  LG L L+ + +Q           R E  K RK +KE+W  + K+M +A   + +++  Y QR
Sbjct:   43 DPVRREDLEPDKADTATVVTEENSEASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAKELLAWTDKRANYELEFAKSIMKLAEAGKVSI--------------LQQSQMPLQYIYTLFLEHDLSLGALALETVAQQKRDYYQPLAAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQR 227          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Arhgap29 (Rho GTPase activating protein 29 [Source:MGI Symbol;Acc:MGI:2443818])

HSP 1 Score: 102.449 bits (254), Expect = 1.706e-21
Identity = 61/209 (29.19%), Postives = 105/209 (50.24%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE---------------------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +KE D +  ++  C   IE   L   GIYRV  +K+K   + ++L +     D+       + +V+K  L  L EP + + LY EF+DL KE +                     S EV+ ++ K + L+ QLP+S+      +  HL+++ +++EEN+M S NLG +F PTLI+ +P      I    +  +QA++V+ +I   + +F
Sbjct:  273 KKEPDGIPFVLKICASEIENRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQEAKKDSPEDKKHPHVSIEVNRILLKSKDLLRQLPASHFNSLHYLIAHLRRVVDHAEENKMNSKNLGVIFGPTLIRPRPTTAPVTISSLAEYSNQARLVEFLITYSQKIF 481          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Arhgap29 (Rho GTPase activating protein 29 [Source:MGI Symbol;Acc:MGI:2443818])

HSP 1 Score: 101.679 bits (252), Expect = 3.982e-21
Identity = 61/209 (29.19%), Postives = 105/209 (50.24%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE---------------------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +KE D +  ++  C   IE   L   GIYRV  +K+K   + ++L +     D+       + +V+K  L  L EP + + LY EF+DL KE +                     S EV+ ++ K + L+ QLP+S+      +  HL+++ +++EEN+M S NLG +F PTLI+ +P      I    +  +QA++V+ +I   + +F
Sbjct:  680 KKEPDGIPFVLKICASEIENRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQEAKKDSPEDKKHPHVSIEVNRILLKSKDLLRQLPASHFNSLHYLIAHLRRVVDHAEENKMNSKNLGVIFGPTLIRPRPTTAPVTISSLAEYSNQARLVEFLITYSQKIF 888          

HSP 2 Score: 53.1434 bits (126), Expect = 3.220e-6
Identity = 47/152 (30.92%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  185 EDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIID-------QCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            E D LL  K+ ++++ +L+YAK W K+ K +V   EKK  LE+E  R+  K          SS+     M  +SL  + L+ D       Q     +Q NK +  LL     ++ E  K RK  K+ WK    K+++ E  + K K    QR
Sbjct:  193 ELDNLLL-KNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNIVK----LAEATRSSIGIQEFMPLQSLFTNALLSDIHSSHLLQQTIAALQANKFVQPLLG----RKNEMEKQRKEIKDLWKQQQNKLLETETALKKAKLLCMQR 335          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Arhgap45 (Rho GTPase activating protein 45 [Source:MGI Symbol;Acc:MGI:1917969])

HSP 1 Score: 100.908 bits (250), Expect = 7.110e-21
Identity = 59/204 (28.92%), Postives = 101/204 (49.51%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDL--------------------GKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D V  IV KC+  IE   L T GIYRV+  K +V  + ++  +     +L    P  ++NV+K  L  L EPL+ +  Y+E V L                    G E+E+  ++ +V +L+ L+  LP+ NR     +  HL++I    ++N+M   NLG +F PTL++ +P      +   +D   QA++++ +I +   +F
Sbjct:  769 DGVPFIVKKCVCEIERRALHTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPEPLISFRFYHELVGLAKDSLKAEAEAKAASRGRQGGSESEAATLA-MVGRLRELMQDLPAENRATLLYLLKHLRRIVEMEQDNKMTPGNLGIVFGPTLLRPRPTDATVSLSSLVDYPHQARVIETLIVHYGLVF 971          

HSP 2 Score: 58.9214 bits (141), Expect = 4.790e-8
Identity = 78/354 (22.03%), Postives = 136/354 (38.42%), Query Frame = 2
Query:  185 EDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-----LDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEK-QLSNKPDIYSEKFQVELY 1228
            E+  +L ++ +  VD +L YAK   ++ K+L+   EK+ TLE+E  +   K   +   +V+       P+    LS+  L ++Q  E      +  G L     +  +  +R E  + RK  KE W    +K+ +AE  + K K  Y QRC+   K R ++  A        +   Q TG    TA                                         SK    +DK  +   +   K  E M +Y+  V +A  +  E E  K+  L  I+    +SD+ +K     Y +++      +   + +L    + Y P   Y   + + Q   +PD+   ++  E Y
Sbjct:  268 EEVDMLLQRCEGGVDAALQYAKDMARYMKDLISYLEKRTTLEMEFAKGLQKVVHNCRQSVTHEPHM--PL----LSIYSLALEQDLEFGHGMVQAAGTLQTQTFMQPLTLRRLEHERRRKEIKESWHRAQRKLQEAEANLRKAKQGYKQRCEDHDKARLQVAKA--------EEEQQGTGPGAGTA----------------------------------------ASK---ALDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYYQLMHMQTAPLPVNFQMLCESSKLYDPGQQYASHVRQLQRGEEPDV---RYDFEPY 561          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PGG2|GMIP_MOUSE (GEM-interacting protein OS=Mus musculus OX=10090 GN=Gmip PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 5.202e-23
Identity = 63/195 (32.31%), Postives = 107/195 (54.87%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK--EAESGE-------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSK--PRFRMAD-IKEYMDNKSQAKIVQIIIENVETLFG 2203
            V  ++ +C   IE   L   GIYRVS S+++V  + ++  +  A  +L    P  + +V+K  L  L++P+VP+HLY+ F+ L K   A+ G+         +++  L+ L+ QLP SN      +  HL ++A   EEN+M + NLG +F PTL++    PR   A  +   +D+  QA++V+ +I + E +FG
Sbjct:  563 VPFVITRCTAEIEHRALGLQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGDDPGTPNPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENKMSANNLGIVFGPTLLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFG 757          

HSP 2 Score: 58.5362 bits (140), Expect = 4.439e-7
Identity = 50/199 (25.13%), Postives = 94/199 (47.24%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITEAS------LDLSP----GITEDD-KLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-LDVINRQ-----------RTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            +P+   D + +   +A  +TE +       DLSP     +TE++  L   + K  VD +L YAK W ++ KEL+   +K+A  E+E  +S  K  ++ + ++              L  S++ +     + ++++  LG L L+ + +Q           R E  K RK +KE+W  + K+M +A   + +++  Y QR
Sbjct:   43 DPVRREDLEPDKADTATVVTEENSEASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAKELLAWTDKRANYELEFAKSIMKLAEAGKVSI--------------LQQSQMPLQYIYTLFLEHDLSLGALALETVAQQKRDYYQPLAAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQR 227          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P107|GMIP_HUMAN (GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 1.101e-22
Identity = 64/195 (32.82%), Postives = 107/195 (54.87%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK--EAESGE-------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSK--PRFRMA-DIKEYMDNKSQAKIVQIIIENVETLFG 2203
            V  +V KC   IE   L   GIYRVS S+++V  + ++  +  A  +L    P  +++V+K  L  L+EP++P+HLY+ F+ L K   A+ G+         +++  L+ L+ QLP SN      +  HL ++A    EN+M + NLG +F PTL++    PR   A  +   +D+  QA++V+ +I + E +FG
Sbjct:  564 VPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHLYDAFISLAKTLHADPGDDPGTPSPSPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLRPPDGPRAASAIPVTCLLDSGHQAQLVEFLIVHYEQIFG 758          

HSP 2 Score: 63.929 bits (154), Expect = 9.360e-9
Identity = 49/195 (25.13%), Postives = 88/195 (45.13%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITEASLDLSPG-------ITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKL-LDVINRQ-----------RTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            +PL+S D + +   +A    EAS    P          E+  L   + K  VD +L YAK W ++ KEL+   EK+A+ E+E  +S  K  ++ + ++                 S + +     + ++++  LG L ++ + +Q           RTE  K RK +KE+W  + K+M +A   + + +  Y QR
Sbjct:   43 DPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRASYELEFAKSTMKIAEAGKVSIQQQ--------------SHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQPLAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQR 223          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5PQJ5|RHG29_RAT (Rho GTPase-activating protein 29 OS=Rattus norvegicus OX=10116 GN=Arhgap29 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 2.094e-21
Identity = 62/209 (29.67%), Postives = 105/209 (50.24%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE---------------------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +KE D +  ++  C   IE   L   GIYRV  +K+K   + ++L +     D+       + +V+K  L  L EP + + LY EF+DL KE +                     S E++ ++ + + L+ QLP+SN      +  HLK++ +++EEN+M S NLG +F PTLI+ +P      I    +  SQA++V+ +I   + +F
Sbjct:  675 KKEPDGIPFVLKICASEIESRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQEAKKDSPEDKKHPHVSIEINRILLRSKDLLRQLPASNFNSLHYLIVHLKRVVDHAEENKMNSKNLGVIFGPTLIRPRPTTAPVTISSLAEYSSQARVVEFLITYAQKIF 883          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|A7YY57|RHG29_BOVIN (Rho GTPase-activating protein 29 OS=Bos taurus OX=9913 GN=ARHGAP29 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.110e-21
Identity = 63/209 (30.14%), Postives = 105/209 (50.24%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE---------------------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +KE D +  ++  C   IE   LS  GIYRV  +K+K   + ++L +     D+       + +V+K  L  L EP + + LY EF+DL  E +                     S E+S ++ K + L+ QLP+SN      +  HLK++ ++SEEN+M S NLG +F P+L++ +P      I    D  +QA++V+ +I   + +F
Sbjct:  678 KKEPDGIPFVLKMCASEIENRALSLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAVEIQHVNEEQEMKKDNPEDKKWPSSSIEISRILLKSKDLLRQLPASNFNSLHYLIVHLKRVVDHSEENKMNSRNLGVIFGPSLLRPRPTTAPITISSLADYSNQARLVEFLITYSQKIF 886          

HSP 2 Score: 57.3806 bits (137), Expect = 9.148e-7
Identity = 49/152 (32.24%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  185 EDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIID-------QCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            E D +L  K+ N+V+ +L+YAK W K+ K +V   EKK  LE+E  R+  K  ++  T +         M  +SL  + L+ D       Q     +Q NK +  LL     ++ E  K RK  KE WK +  KM++ E  + K K    QR
Sbjct:  193 ELDSMLL-KNTNSVELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNIVKLAEATRTNIGLQEF----MPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLG----RKNEMEKQRKEIKELWKQEQNKMLETETALKKAKLLCMQR 335          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PCS4|RHG29_DANRE (Rho GTPase-activating protein 29 OS=Danio rerio OX=7955 GN=arhgap29 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.761e-21
Identity = 62/205 (30.24%), Postives = 109/205 (53.17%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE-------------------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADI--KEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KC   IE   L+  GIYRV+ +K +V  + ++  +     +L +  P  ++NV+K  L  L EPL+ Y  YN+ + L KE +                   S E+  ++ K++ L+ QLP+ + K    +  HL +++  +EEN+M + NLG +F PTLI  KPR   A++     +D   QA++V+++I++ + +F
Sbjct:  748 DGIPFIIKKCTSEIESRALTIKGIYRVNGAKSRVEKLCQAFENGKDLVELSDLHPHDISNVLKLYLRQLPEPLILYRYYNDVIGLAKETQNMDKTDSAKEKSAGEQLGLSTELKRVLFKVRDLLRQLPAPHYKTLQFLITHLHRVSEQAEENKMTASNLGIIFGPTLI--KPRHLEAEVSLSSLVDYPHQARMVELLIKHHQMIF 950          

HSP 2 Score: 56.6102 bits (135), Expect = 1.657e-6
Identity = 48/170 (28.24%), Postives = 85/170 (50.00%), Query Frame = 2
Query:  155 ASLDLSPGIT--EDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEI-----EIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLR 643
            A   LSP ++  E   LL  K+ + V+ +L YAK W K+ K+++   EK+ +L++E  +S++K  +S +   S       P R   +S  K  I+    +      +Q NK    LL     ++ +  K RK  KE+W+ + KKM ++E+ + K +    Q+ ++  K R
Sbjct:  213 ADHSLSPELSTVEQVDLLLLKNDSGVESALLYAKAWSKYTKDVLAWVEKRLSLDMECAKSFAKMAESAKAVASQQDFM--PFRDIYVSAFKNEIEYNHVLLQTAAALQTNKFTQPLLA----RKNDLDKQRKEIKEQWQRELKKMNESESALKKARLLKMQKREEYEKAR 376          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A4E0R5Y1 (RhoGAP OS=Fasciola hepatica OX=6192 GN=D915_005491 PE=4 SV=1)

HSP 1 Score: 539.265 bits (1388), Expect = 5.034e-168
Identity = 311/737 (42.20%), Postives = 445/737 (60.38%), Query Frame = 2
Query:  125 NKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGS--------------TNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXX------XXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPAS----SNRTGVLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLE-WQKEVDAVTEIVLKCIEVIE--INGLSTHGIYRVSASKLKVGSVMESLNS-------QGAD--ADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK---EAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQY 2218
            +K S   I E  ++   G++E+DKLL RKDKNA+DF+ NY+KLWCK CK+LV+  EK+A  E E CR+  K FQ+FET ++S  + GAPM+++ LSL++++ID CKE E  N K+  +LL+V+ RQRT F KTRK  K+KWKSD K+M+DAEN+++KTKSAYYQRCQ GVKLREEL  AQ  L  M       TGS              +    Q      S         +GSTA+++   + ++      + S +++Q++KQ+ KV++LEKQL+DNDKKEIEQMY+Y+E+VE AN++L E EK KME LCD RLT  +SDEVVKD+LAE    L  TR  M+ +Y  ++  FQ+Y PC +YR LIE+ +    D Y EK+Q   +H+ +++  K         DS T R   R  IGS ++         T  +               G   S    S  + VL+++VEFGSNLFR        S  S   +R Q +    + +  + S T  +       L   +KE  A    + +C+  IE    GL THGIYRV ASK KV S++ES+ S       + +D  A L  E P+TLA ++K++LI+L EPL+ Y+LY  FV+LGK    +++  + +LV +LQLL+N L   N++LAGL+FHHL ++A    ENQM S NLGT+F PT+++ KP+F++A++ E+MDNK Q ++V+++I+ V  +FGP + Y
Sbjct:   54 SKSSVPVIKEFEIEFGHGVSEEDKLLSRKDKNAIDFAFNYSKLWCKSCKDLVLGLEKRAYAENEACRAIVKHFQAFETNLNS--LVGAPMKTQRLSLARMLIDHCKETETHNTKRCRELLEVLTRQRTLFEKTRKFLKDKWKSDVKRMLDAENSLIKTKSAYYQRCQTGVKLREELAMAQNQLNEMNAGMPVVTGSGPGIPSGSISPGPTSPGQGQSAPITNSPMGANQGQTVGSTASLTQDIADSAPDSAATSTSSTSNQVAKQRAKVERLEKQLSDNDKKEIEQMYAYREAVEQANHRLCELEKSKMEILCDTRLTIRKSDEVVKDSLAELFNHLYTTRINMVKQYETIAAAFQDYVPCSEYRALIEEHIQKGVDTYPEKYQFAGFHEASSSGGKL--------DSLTGRFSGR-SIGSARDASDNDPLAGTRSALCIHSDSDSEGEDEPGPSKSGGLVSTSSNVLSSLVEFGSNLFR------PDSKKSVRGKRGQGSAGSTNQAVMSGSATTESLDTLTAQLANLEKEYVAACYPIARCVAAIEKQPGGLETHGIYRVPASKAKVASLLESIQSSQPMTPEKASDDIAMLSQEHPLTLAGLIKTRLIALPEPLLTYNLYPNFVELGKIFDASDANILKELVKRLQLLINHLSPGNKRLAGLLFHHLYRVAACQSENQMSSANLGTMFGPTVLRQKPKFQVANMMEFMDNKGQTRVVEVLIDQVVEIFGPAEHY 773          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A5J4NSN3 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007433 PE=4 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 4.312e-162
Identity = 303/756 (40.08%), Postives = 451/756 (59.66%), Query Frame = 2
Query:  152 EASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDH-------------GIQET--GSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXX-------XXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEK------HKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPASSNRTGVLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLEWQ-----KEVDAVTEIVLKCIEVIE--INGLSTHGIYRVSASKLKVGSVMESLNS-------QGAD--ADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK---EAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQ 2278
            E  ++   G++E+DK L R+DKNA++F+ NY+KLWCK CK++V+  EK+A  E E CR+  KQFQ+ E +V++  + GAPM+ ++L     ++D CKE+E  N K+  +LL+V+ RQRT F KTRK+ K+KWK++ K+M+DAEN ++KTKS YYQRCQ GVKLREEL  AQ LL  +                GI  T  G++N ++ + T+  S+ ++      GS  ++    +  S       A + +++Q++KQK KV++LEKQL+DNDKKEIEQMY+Y+ESVE AN++L + EK KME LCDIRLT  +SDEVVKD+LAE    L  TR  M+++Y  +++ FQ+Y PC DY+ L+E  +    D + EK+Q   +H+ A +  K         G    + S+         I S  E+D E +  N                    + + S  + VL+++VEFGS+LFR     +            ++ +   +T+  ++ +       A  +L  Q     +E  +    V +C+  IE    GL THGIYRV ASK KV S++E+L S       Q AD  A L  E P+TLA ++K++LI+L EPL+ Y LY  FV+LGK    A+ G V +LV +L+LL+N L   N KLAGL+FHHL ++A    ENQM   NLGT+F PT+++ KP+F++A++ E+MDNK Q ++V+++IE V  +FGP DQ Y+P  T   LA+  +T +++
Sbjct:   57 EFEIEFGHGVSEEDKSLSRRDKNAIEFAFNYSKLWCKSCKDIVLGLEKRAYAENEACRAIVKQFQALEASVAT--VNGAPMKQQTLMFLFQMVDHCKEMETHNTKRCRELLEVLTRQRTLFEKTRKYLKDKWKAEVKRMLDAENVLIKTKSGYYQRCQTGVKLREELAAAQNLLNELSASMSNIPSNAGTLQPGISSTLSGASNMSSTLPTTAVSSNNSGVSQTAGSAVSLVQEGADVSTDVNPTLAGTATSTQVAKQKAKVERLEKQLSDNDKKEIEQMYAYRESVETANSRLYDLEKTKMEILCDIRLTIMKSDEVVKDSLAELFNHLHTTRMAMISQYQTVASAFQDYVPCSDYKSLLEDHIQKGVDYFPEKYQFAGFHEAAASGLKLDALPGRFLGRTAATCSKEAGESDPLCIHSDSESDGEPQVENN-----------------TNLSSKSTGSTVLSSLVEFGSSLFRPDSKKSI----------RKRGQGSTTTAVVSTGIPVSATSDALDNLSTQLANLEREYISACYPVARCVSAIEKQPGGLETHGIYRVPASKAKVASLLETLQSSQPSSPEQIADDIAVLSQEHPLTLAGLIKTRLIALPEPLLTYSLYPNFVELGKVYDSADPGVVKELVKRLRLLINHLSPGNLKLAGLLFHHLHRVAACQSENQMSPANLGTMFGPTVLRQKPKFQVANMMEFMDNKGQTRVVEVLIECVTEIFGPADQ-YDPIRTLISLANSNDTPLER 782          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A3R7C423 (Minor histocompatibility protein HA-1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=HMHA1 PE=4 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 8.099e-159
Identity = 297/742 (40.03%), Postives = 451/742 (60.78%), Query Frame = 2
Query:  176 GITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNAT--------AQIXXXXXXXXXXXXXDGIGXXXX---------XXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHK------FGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPASSNRTG--VLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAE-------KDLEWQKEVDAVTEIVLKCIEVIE--INGLSTHGIYRVSASKLKVGSVME-------SLNSQGAD--ADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK---EAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEE 2263
            G++E+DK L R+ +NAV+F+ +Y+KLWCK CK++V+  EK+A  E E  RS +KQFQ+ E +VS+  + GAPM+ E++ L+ ++++  KE+E+ N K+  +LL+V+ RQRT F +TRK+ K+KWK+D K+++DAEN++ KTK+AYYQRCQ GVKLREEL  AQ  + Y +   +  T +T A+        A + +SN +++SN N    GS             +  S T+ A   +++Q++KQ+ KV++LEKQL+DNDKKEIE MY+Y+E+V+ ANN+L + EK KME LCD RLT  +SDEVVKD+LAE    L  TR  M+ +Y  ++  FQEY PC DYR L+ +Q+    D Y EK+Q   +H+   +  K +       G    S  + + G    GI S  +++ E    +++P                G P     TG  VL++IVEFGS+LFR              ++++ + K  + ++ ++          AE       +    +KE +A    + +CI  IE    GL THGIYR+ ASK KV S++E       S   Q AD  A L  E P+TLA ++K++LI+L EPL+ Y+LY  FV+LGK    A+   V +LV +LQLL+  L   NR+LAGL+FHHL ++A +  ENQM S NLGT+FAPT+++ +P+F++A++ E++DN+ Q ++V+++I+ V  +FGP  + Y+P+     LA+ EE
Sbjct:    2 GVSEEDKALSRRHRNAVEFAFDYSKLWCKSCKDIVLGLEKRAYAENEAVRSIAKQFQALEASVSA--VNGAPMKQETIRLAHMMVEHSKEVELHNTKRCRELLEVLTRQRTNFERTRKYLKDKWKTDFKRLVDAENSLFKTKAAYYQRCQTGVKLREELAAAQ--IMYDEISTLSATSATPASTTSAAQNAAGVASSNAASSSNSNTQTAGSAPNLAQESEIPITTDVSLTSGAGGSTSTQLAKQRAKVERLEKQLSDNDKKEIELMYAYREAVDVANNRLYDLEKSKMEILCDTRLTILKSDEVVKDSLAELFNHLYTTRIAMVKQYETIAATFQEYVPCSDYRALVAEQIQKGVDSYPEKYQFAGFHEATASGLKLESTSGRLGGRISASSREASDGDPLSGIHSDSDSETEQPTDSSMP--------------PGGKPTGIVSTGSNVLSSIVEFGSSLFR------------PDSKKSIRGKRSQPSAPTSQVGIVPGPATAESLDNLTNQTNNLEKEYNAACIPLARCIAAIEKQPGGLETHGIYRIPASKAKVASLLEMIQTSHPSTAGQLADDIAVLSQENPLTLAGLIKTRLIALPEPLLTYNLYPNFVELGKVFDTADEKGVKELVKRLQLLITHLTPGNRRLAGLLFHHLNRVAASQAENQMNSANLGTMFAPTVLRQRPKFQVANMMEFVDNRGQTRVVEVLIDRVTDIFGPAAE-YDPRKIILVLANPEE 712          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A4S2MGP8 (Rho-GAP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001012 PE=4 SV=1)

HSP 1 Score: 512.686 bits (1319), Expect = 1.082e-158
Identity = 305/761 (40.08%), Postives = 457/761 (60.05%), Query Frame = 2
Query:   92 NPLMSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQAL------LTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXX---------XXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPASSNRTG-------VLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLEWQKEVDAVTEIVLKCIEVIE--INGLSTHGIYRVSASKLKVGSVME-------SLNSQGAD--ADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGK---EAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEET 2266
            NPL  GD  T+ K  A+   E +++   G++E+DK L R+ ++ V+F+ +Y+KLWCK CK++V+  EK+A  E E  RS +KQF + E +VS+  + GAPM+ E++ L+ ++++  KE+E+ N K+  +LL+V+ RQRT F +TRK+ K+KWK+D K+++DAEN++ KTK+AYYQRCQ GVKLREEL  AQ +      L+         T +   T  + +SN +++SN N    GS             +  SST+ A   +++Q++KQ+ KV++LEKQL+DNDKKEIE MY+Y+E+V+ ANN+L + EK KME LCD RLT  +SDEVVKD+LAE    L  TR  M+ +Y  ++  FQEY PC DYR L+ +Q+    D Y EK+Q   +H+   +  K           ++T G  R G G I  +  E+ + + L             PT   +P  S  TG       VL++IVEFGS+LFR          S    R        ++ +   S+ T   +    +    +KE +A    + +CI  IE    GL THGIYR+ ASK KV S++E       S   Q AD  A L  E P+TLA ++K++LI+L EPL+ Y+LY  FV+LGK    A+   V +LV +LQLL+  L   NR+LAGL+FHHL ++A +  ENQM S NLGT+FAPT+++ +P+F++A++ E++DN+ Q ++V+++I+ V  +FGP  + Y+P+     LA+ EE+
Sbjct:   32 NPL--GDSVTQEK--ANAPKEFAIEFGHGVSEEDKALSRRHRHPVEFAFDYSKLWCKSCKDIVLGLEKRAYAENEAVRSIAKQFLALEASVSA--VNGAPMKQETIRLAHMMVEHSKEVELHNTKRCRELLEVLTRQRTNFERTRKYLKDKWKTDFKRLVDAENSLFKTKAAYYQRCQTGVKLREELAAAQIMYDEINTLSATSAAPTSNTSAAQNTTGVASSNPASSSNSNTQTAGSAPNLAPESEVPITADVSSTSGAGGSTSTQLAKQRAKVERLEKQLSDNDKKEIELMYAYREAVDVANNRLYDLEKSKMEILCDTRLTILKSDEVVKDSLAELFNHLYTTRIAMVKQYETIAAAFQEYVPCSDYRALVAEQIQKGVDSYPEKYQFAGFHEATASGLKL----------ESTSG--RLG-GRISASSREASDGDPLSGIHSDSDSETEQPTDSSMPPGSKPTGIVSTGSNVLSSIVEFGSSLFR-----PDSKKSIRGKRSQPSAPTSQAGTVPGSATTESLDNLTNQTNNLEKEYNAACIPLARCIAAIEKQPGGLETHGIYRIPASKAKVASLLEVIQTSHPSTAGQLADDIAVLSQENPLTLAGLIKTRLIALPEPLLTYNLYPNFVELGKVFDTADEKGVKELVKRLQLLITHLTPGNRRLAGLLFHHLNRVAASQAENQMSSANLGTMFAPTVLRQRPKFQVANMMEFVDNRGQTRVVEVLIDRVTDIFGPAAE-YDPRKIILALANPEES 767          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A183A9L6 (Rho-GAP domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3651 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 1.380e-140
Identity = 297/770 (38.57%), Postives = 440/770 (57.14%), Query Frame = 2
Query:  176 GITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQ-------------------DHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKET---DHESRNRNTLPXXXXXXXXXXXX-XXXXGVPASSNRTGVLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLE-WQKEVDAVTEIVLKCIEVIE--INGLSTHGIYRVSASKLKVGSVMESLNS-------QGAD--ADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNP--KLTKGDLADFEETKIQQEKDSLNVLKVCSEPAVDSKVKQQRPHSSIIES 2374
            G++E+DKLL RKDKNA+DF+ NY+KLWCK CK+LV+  EK+A  E E CR+  K FQ+FET ++S  + GAPM++++LSL+++++D CKE E+ N K+  +LL+V+ RQRT F KTRK  K+KWK+D K+M+DAEN+++KTKSAYYQRCQ GVKLREEL  AQ  L  M                      G   +G T +    ++    + +  +   +    T SA  ST ++ S +++Q++KQ+ KV++LEKQL+DNDKKEIEQMY+Y+E+VE AN++L E EK KME LCD RLT  +SDEVVKD+LAE    L  TR +M+ +Y  ++  FQ+Y PC +YR LI++ +    + Y EK+Q   +H+ + +  K         D+ T R + R   GS K+    D  +  R+ L  HSDSDS+ E       G    S  + VL+++VEFGSNLFR        S  S   +RNQ +    + +  + S T  +       L   +KE  A    + +C+  IE    GL THGIYRV ASK KV S++ES+ S       + +D  A L  E P+TLA ++K++LI++ +                 +++  + +LV +LQLL+N L   N++LAGL+FHHL                              RF++A++ E+MDNK Q ++V+++I+ V  +FGP +Q Y+P   LT    A  +E  +++    L      SE + D+K     P ++  +S
Sbjct:   16 GVSEEDKLLSRKDKNAIDFAFNYSKLWCKSCKDLVLGLEKRAYAENEACRAIVKHFQAFETNLNS--VNGAPMKTQTLSLARMMVDHCKETEMHNTKRCRELLEVLTRQRTLFEKTRKFLKDKWKADVKRMLDAENSLIKTKSAYYQRCQTGVKLREELAMAQNQLNEMNAGLVASGLGSGSTSGPVSPGPGSVASGQTTSLVNTSSGTTQSQTVGSTASLTQDITDSAPDSTATSSSSTSNQVAKQRAKVERLEKQLSDNDKKEIEQMYAYREAVEQANHRLCELEKSKMEILCDTRLTIRKSDEVVKDSLAELFNHLYATRISMIKQYESMATAFQDYVPCSEYRALIDEHIQKGVETYPEKYQFAGFHEASASGGKL--------DAVTGRFMGR-SAGSAKDASDNDPLAGTRSALCIHSDSDSEGEEDPGPSRGGGLVSTSSNVLSSLVEFGSNLFR------PDSKKSVRGKRNQGSGGSGNQTAMSGSATTESLDTLTAQLANLEKEYIAACYPIARCVAAIEKQPGGLETHGIYRVPASKAKVASLLESVQSSQPMTPEKASDDIAMLSQEHPLTLAGLIKTRLIAVFDA----------------SDANILKELVKRLQLLINHLSPGNKRLAGLLFHHLY-----------------------------RFQVANMMEFMDNKGQTRVVEVLIDQVVEIFGPAEQ-YDPILILTSAPPAAEDELDLRRGSGPLARRNTASEKSTDTKPTLLHPQAARAQS 722          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: arhgap29a (Rho GTPase activating protein 29a [Source:ZFIN;Acc:ZDB-GENE-030131-9510])

HSP 1 Score: 115.161 bits (287), Expect = 2.209e-25
Identity = 66/189 (34.92%), Postives = 110/189 (58.20%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAES---GEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADI--KEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KC   IE   L+  GIYRV+ +K +V  + ++  +     +L +  P  ++NV+K  L  L EPL+ +  YN+F+ L KE +S    E++ ++ K++ L+ QLP+++ K   L+  HL ++   +EEN+M + NLG +F PTLI  KPR   AD+     +D   QA IV+++I + E +F
Sbjct:  688 DGIPFIIRKCTTEIENRALNIKGIYRVNGAKSRVEKLCQAFENGKDLVELSDLYPHDISNVLKLYLRQLPEPLILFRYYNDFIGLAKECQSIIIDELNRVLFKIKDLLRQLPTTHYKTLQLLIRHLHRVTEKAEENKMTASNLGIIFGPTLI--KPRQADADVSLSSLVDYPYQALIVELLIRHYEMIF 874          

HSP 2 Score: 51.6026 bits (122), Expect = 6.728e-6
Identity = 45/167 (26.95%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  179 ITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIE-----IQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQ 664
            + E D +L + D + V+ +L YAK W K+ KEL+   +K+ ++++E  +S +K  +S +T  +         R    +  K  I+  + ++     +Q NK +  LL     ++ E  K RK  KE+W+ + KKM +AE+ + K +    QR ++  + R   + A+
Sbjct:  228 VEELDSVLQQSD-SGVESALLYAKAWSKYTKELLNWVDKRLSMDLECAKSLAKMAESAKTLANQQEHMA--FRDIYTTAFKNDIEYSQVLQHTVSALQANKFMQPLLA----RKNELDKLRKEVKEQWQREQKKMHEAESALKKARLLKDQRQEEYERARISTSRAE 387          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: gmip (GEM interacting protein [Source:NCBI gene;Acc:103034590])

HSP 1 Score: 108.997 bits (271), Expect = 1.279e-23
Identity = 62/192 (32.29%), Postives = 104/192 (54.17%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKE----------AESGE-VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGP 2206
            IV +C   IE   L+  G+YRVS SK ++  +  +  +Q    DL    P  + +V+K     L EPL+ + LYN+F+++GKE          AE+ + V ++V  ++ L+ +LP  N      +  HL +I+ N EEN+M   NLG +F PTL++      ++ I   +++  QA +V+ +I N + +FGP
Sbjct:  570 IVQRCTGEIESRALTVQGVYRVSGSKPRILKLCHAFETQKDQVDLAEVSPHDVTSVLKYFFKELPEPLLTFDLYNDFINIGKEIQRLSEKDHVAETAQIVENIVINIKQLLARLPPCNYSTVRHMMGHLHRISENFEENKMSPGNLGIVFGPTLLRPLVSGDVSMIA-LLESSYQAMLVEFMITNHDQIFGP 760          

HSP 2 Score: 67.3958 bits (163), Expect = 8.713e-11
Identity = 48/186 (25.81%), Postives = 92/186 (49.46%), Query Frame = 2
Query:  182 TEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNN---KKLGKLL-----DVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGST 715
             +D  L   + ++ V+ +L YAK+WC++ K+L+   +K+ +LE E  ++ +K  ++ ++ V+   M   P+        + I     E +I+ +   K   +LL       ++ +R E  K R+ +KE+W  + K+M DA   + + +  Y QRC       EEL  A+A+       G++E G +
Sbjct:   97 AQDADLAMCRSESGVELALQYAKMWCRYAKDLLTWLDKRISLEQEYAKNITKAAETAKSCVTQQDMM--PL--------QYIYTMAMEQDIKTSATAKHTTELLHQRCYQALSAKRNEIDKWRREFKEQWAKEQKRMNDAVAALKRARQQYLQRC-------EELEKAKAISA----KGLEEAGGS 261          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: gmip (GEM interacting protein [Source:NCBI gene;Acc:103034590])

HSP 1 Score: 108.997 bits (271), Expect = 1.328e-23
Identity = 62/192 (32.29%), Postives = 104/192 (54.17%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKE----------AESGE-VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGP 2206
            IV +C   IE   L+  G+YRVS SK ++  +  +  +Q    DL    P  + +V+K     L EPL+ + LYN+F+++GKE          AE+ + V ++V  ++ L+ +LP  N      +  HL +I+ N EEN+M   NLG +F PTL++      ++ I   +++  QA +V+ +I N + +FGP
Sbjct:  604 IVQRCTGEIESRALTVQGVYRVSGSKPRILKLCHAFETQKDQVDLAEVSPHDVTSVLKYFFKELPEPLLTFDLYNDFINIGKEIQRLSEKDHVAETAQIVENIVINIKQLLARLPPCNYSTVRHMMGHLHRISENFEENKMSPGNLGIVFGPTLLRPLVSGDVSMIA-LLESSYQAMLVEFMITNHDQIFGP 794          

HSP 2 Score: 58.5362 bits (140), Expect = 4.477e-8
Identity = 48/210 (22.86%), Postives = 94/210 (44.76%), Query Frame = 2
Query:  182 TEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSV---------MFGAPMRSESLSL---------------SKLIIDQCKEIEIQNN---KKLGKLL-----DVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGST 715
             +D  L   + ++ V+ +L YAK+WC++ K+L+   +K+ +LE E  ++ +K  ++ ++ V+  V         +    ++ E                    + I     E +I+ +   K   +LL       ++ +R E  K R+ +KE+W  + K+M DA   + + +  Y QRC       EEL  A+A+       G++E G +
Sbjct:   97 AQDADLAMCRSESGVELALQYAKMWCRYAKDLLTWLDKRISLEQEYAKNITKAAETAKSCVTQQVYEHTWVNVDVHAFALKCEETCFLVNDASCACVQDMMPLQYIYTMAMEQDIKTSATAKHTTELLHQRCYQALSAKRNEIDKWRREFKEQWAKEQKRMNDAVAALKRARQQYLQRC-------EELEKAKAI----SAKGLEEAGGS 295          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: gmip (GEM interacting protein [Source:NCBI gene;Acc:103034590])

HSP 1 Score: 108.612 bits (270), Expect = 1.889e-23
Identity = 63/195 (32.31%), Postives = 105/195 (53.85%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKE----------AESGE-VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGP 2206
            V  IV +C   IE   L+  G+YRVS SK ++  +  +  +Q    DL    P  + +V+K     L EPL+ + LYN+F+++GKE          AE+ + V ++V  ++ L+ +LP  N      +  HL +I+ N EEN+M   NLG +F PTL++      ++ I   +++  QA +V+ +I N + +FGP
Sbjct:  567 VPFIVQRCTGEIESRALTVQGVYRVSGSKPRILKLCHAFETQKDQVDLAEVSPHDVTSVLKYFFKELPEPLLTFDLYNDFINIGKEIQRLSEKDHVAETAQIVENIVINIKQLLARLPPCNYSTVRHMMGHLHRISENFEENKMSPGNLGIVFGPTLLRPLVSGDVSMIA-LLESSYQAMLVEFMITNHDQIFGP 760          

HSP 2 Score: 68.9366 bits (167), Expect = 3.533e-11
Identity = 48/186 (25.81%), Postives = 92/186 (49.46%), Query Frame = 2
Query:  182 TEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNN---KKLGKLL-----DVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGST 715
             +D  L   + ++ V+ +L YAK+WC++ K+L+   +K+ +LE E  ++ +K  ++ ++ V+   M   P+        + I     E +I+ +   K   +LL       ++ +R E  K R+ +KE+W  + K+M DA   + + +  Y QRC       EEL  A+A+       G++E G +
Sbjct:   97 AQDADLAMCRSESGVELALQYAKMWCRYAKDLLTWLDKRISLEQEYAKNITKAAETAKSCVTQQDMM--PL--------QYIYTMAMEQDIKTSATAKHTTELLHQRCYQALSAKRNEIDKWRREFKEQWAKEQKRMNDAVAALKRARQQYLQRC-------EELEKAKAISA----KGLEEAGGS 261          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: arhgap29b (Rho GTPase activating protein 29b [Source:NCBI gene;Acc:378998])

HSP 1 Score: 107.842 bits (268), Expect = 4.211e-23
Identity = 65/205 (31.71%), Postives = 105/205 (51.22%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE---------------------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KC   IE   LS  GIYRV+ +K +V  + ++  +     +L +  P  ++NV+K  L  L EPL+ Y  YNEF+ L KEA+                     S E++  V K++ L+ QLP ++ +    +  HL ++   +EEN+M + NLG +F PTLIK +       +   +D   QA +V+I I ++ T+F
Sbjct:  655 DGIPFIIKKCTSEIESRALSIKGIYRVNGAKSRVEKLCQAFENGKDLVELSDLYPHDISNVLKLYLRQLPEPLILYRYYNEFIGLAKEAQAILVEEAESARNRPLEEEPSLSMELNRTVFKIRDLLRQLPLAHYRTLHFLITHLHRVTECAEENKMTASNLGIIFGPTLIKPRQTEAEVSLSSLVDYPYQALMVEIFITHLATIF 859          

HSP 2 Score: 54.6842 bits (130), Expect = 8.387e-7
Identity = 41/159 (25.79%), Postives = 84/159 (52.83%), Query Frame = 2
Query:  176 GITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFET-TVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKL--GKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLR 643
            G+ + D+ L + D + V+ +L YAK W K+ K+++   EK+ +L++E  +S++K  +S +   +    M   P R   +S  K  ++   ++ +Q    L   + +  +  ++ +  + RK  KE+W+ + KKM +AE+ + K +    QR ++  K R
Sbjct:  173 GVEKVDQALLKND-SGVESALLYAKAWSKYTKDVLAWVEKRLSLDMECAKSYAKMAESAKAVAIQQDYM---PFRDIYVSAFKNEMEH-SQLLLQTAAALQTNRFIQPLVARKNDLDRRRKELKEQWQREQKKMSEAESAVRKARLLQSQRREEYEKAR 326          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: arhgap5 (Rho GTPase activating protein 5 [Source:ZFIN;Acc:ZDB-GENE-081014-1])

HSP 1 Score: 83.1889 bits (204), Expect = 3.610e-16
Identity = 64/189 (33.86%), Postives = 98/189 (51.85%), Query Frame = 2
Query: 1652 AVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADL----INEQPVTLANVVKSKLISLSEPLVPYHLYNEFVD-LGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFR-MADIKEYMDNKSQAKIVQIIIENVETLF 2200
            AV   + KC++ IE+NGL T G+YRVS +K    ++ + L  Q    D     I+   VT A  +KS   +L EPL+PY       D +G E E     D++T LQ +V +LP  +  +   I  HL ++  +++ N+M S NL   F PTL+  KP F  MA I   + +++    +Q  I +  T+F
Sbjct: 1263 AVPVFIDKCVDFIEMNGLDTEGLYRVSGNKADQENI-QLLFGQDHTVDFRSLGISVHSVTGA--LKSFFTALPEPLIPYEQQKSLADAVGIENEK----DMITALQDVVKKLPQIHYDVFKFIITHLHRVYQHNQNNKMTSENLSICFWPTLM--KPNFTDMASITATLVSRTP---IQPFILHCPTIF 1439          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: arhgap21b (Rho GTPase activating protein 21b [Source:ZFIN;Acc:ZDB-GENE-030131-4944])

HSP 1 Score: 78.9518 bits (193), Expect = 7.742e-15
Identity = 60/183 (32.79%), Postives = 95/183 (51.91%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLIS----LSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            IV  C  ++E  GL + GIYRV  +   V S+ E LN    + D  +++   L NV+ S L S    L EPL     Y EF+D  +  E+G   + +  L+ L+++LP  +      +  HLK IA NS +N+M   NL  +F PTL+++       D+  +M +  Q KIV+ +I++ +  F
Sbjct: 1025 IVEVCCGLVEERGLESTGIYRVPGNNAAVCSLQEELNRGVTEIDTNDDKWRDL-NVISSLLKSFFRKLPEPLFTDEKYYEFIDANR-MENG--VERLKALKKLIHELPEHHFHTLKFLSMHLKTIAENSPKNKMEPRNLAIVFGPTLVRTSE--DNTDMVTHMPD--QYKIVETLIQHYDWFF 1199          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: arhgap5 (Rho GTPase activating protein 5 [Source:ZFIN;Acc:ZDB-GENE-081014-1])

HSP 1 Score: 74.7146 bits (182), Expect = 1.312e-13
Identity = 52/183 (28.42%), Postives = 89/183 (48.63%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNS-QGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLL---VNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
             V KCI  IE  GL+  G+YRVS SK++  ++  + ++ Q    D +      +A  +K+    L  PL+PY ++   +      E+  + D  T+L  L   + +LP++N  +   +  HL  ++ NS  N+M S NL   F PTL+  +P F + D    M  +   +I++  I     +F
Sbjct: 1245 FVEKCITFIEDKGLTMEGVYRVSGSKVEQDNLQRTFDADQNIIFDNMELNVNAVAGALKAFFNELPGPLIPYDMHQGLI------EAITIPDKTTRLLALRGKLKKLPAANMAVLKCVITHLHTVSQNSSLNKMTSENLSICFWPTLM--RPDFTVVD--PVMATRVYKQILETFIHQCPFMF 1417          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 70.4774 bits (171), Expect = 3.797e-13
Identity = 55/187 (29.41%), Postives = 88/187 (47.06%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADL---INEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQL----PSSNRKLAGLIFH-HLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +V  CI  IE  GL + G+YRVS     V  V  + + +G  AD+     E    +   +K     L  PLV Y  Y  FV      E+ +VSD   +L+ L   L    P+    L  L+ H H ++++   + N M S NL  +F PTL++   +  +A +      + Q  +V+++I +V+ LF
Sbjct:  128 VVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFV------EAAKVSDPAERLEQLRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRPHEQDVLATLN---GMRHQRLLVELLIRHVQELF 305          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 68.1662 bits (165), Expect = 6.929e-13
Identity = 52/187 (27.81%), Postives = 91/187 (48.66%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADL-------INEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGE-VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            +V  CI+ IE+ GL + G+YRVS     +  V  + +  G  AD+       IN     +   +K     L  PL+ Y  Y +F++  K  ++ E +  +   L+LL    P ++ +    +  HLK++   S+EN M + NL  +F PTL++   +  +A +    D + Q  +++ +I N E LF
Sbjct:   48 VVDMCIKEIEMRGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDIN----IITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEGIHEALRLL----PPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRPPEQDVLATLN---DIRYQRLVIETLINNEEILF 223          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 55.8398 bits (133), Expect = 3.305e-8
Identity = 51/200 (25.50%), Postives = 92/200 (46.00%), Query Frame = 2
Query: 1643 EVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLI-------NEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTK---LQLLVNQLPSSN-RKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPE 2209
            E D V  IV +CI VI+  GL   GIYR SA+ L V  + E ++   A+  +I       +     + +++K+   SL + ++P  L +E           ++ D  T+   +  L+  LP +    L  L+F HLK++  +  +N+M    L  ++ PT+  + P        +  D   Q   +++++E  +  F PE
Sbjct:  481 EQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEI------KVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVF-HLKRVLAHEAQNRMNLRALCIIWGPTIAPANP-------DDANDVNFQIMAMEVLLEVSDQAFEPE 666          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 52.7582 bits (125), Expect = 3.589e-7
Identity = 49/194 (25.26%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1700 GLSTHGIYRVSASKLKVGSVMESL---NSQGADA------DLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGE-----------------VSDLVTKLQLLVNQ-LPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            GL+  G+YR S S+  V  +       NS  +D        L+N+    +A+V+K  L  L +P++ + +Y+  +DL +  +  E                 + ++V K  L + + LP  ++++  ++  H+ K+   SE N M   NL  +FAP+LI           K+ +D K +  IV+ I+ N   +F
Sbjct:  818 GLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIHD-----FDGEKDIVDMKERNYIVEFILGNYRDIF 1006          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Match: BAG7 (Rho GTPase activating protein (RhoGAP); stimulates the intrinsic GTPase activity of Rho1p, which plays a bud growth by regulating actin cytoskeleton organization and cell wall biosynthesis, resulting in the downregulation of Rho1p; structurally and functionally related to Sac7p; BAG7 has a paralog, SAC7, that arose from the whole genome duplication [Source:SGD;Acc:S000005660])

HSP 1 Score: 51.9878 bits (123), Expect = 3.693e-7
Identity = 48/172 (27.91%), Postives = 83/172 (48.26%), Query Frame = 2
Query: 1643 EVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVT-----LANVVKSKLISLSEPLVPYHLYNEFVD--LGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEY 2137
            E+ ++  ++ K  + ++ N L T GI+R++ S  +V   ++++ S+  D     E         +A ++K  L SLSEPLVP  LY+ F +  L     +     ++   + +   LP  NR L   +   L   A N ++N M + NL  +  P+L+ S P+  M   KEY
Sbjct:   71 EIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRE-LQAVFSKPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALYDIFRNPILENPKINEHKEQIIKDYEDIYMLLPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLL-SHPKDEMCP-KEY 239          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 52.7582 bits (125), Expect = 3.818e-7
Identity = 40/161 (24.84%), Postives = 77/161 (47.83%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGA-DADLINE-----QPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQL--LVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLI 2095
            ++E   +  IV+K +E IE+ GL   G+YR+  S   + ++  + + +GA D     E     +   +A   K  L  L + L  + + N+F DL  + ++  + +   K  +  L+ +LP+   +    I  HL K+  +   N+M + NL  +F+ + I
Sbjct: 1974 ERENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFI 2134          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 50.447 bits (119), Expect = 1.855e-6
Identity = 48/212 (22.64%), Postives = 94/212 (44.34%), Query Frame = 2
Query: 1643 EVDAVTEIVLKCIEVIEIN--GLSTHGIYRVSASKLKVGSVMESLNSQGADAD-----LINEQPV-TLANVVKSKLISLSEPLVPYHLYNEFVDL--------------GKEAESGEVSDLV----TKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            E + +  I+  CI+ IE +   + + GIYR S S+L +  + +  ++     +     ++ EQ +  +  V+K  L  L  P+  + +Y   + L              GK +   + SD      + L+ ++  LP  + ++  ++  H++K+   S  N+M   NL  +FAP LI+       +  K+ +D K +  IV  I  N + + 
Sbjct:  800 ENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLIRD-----FSGEKDIIDMKERNYIVAFIFGNYKDIL 1006          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO45667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS04])

HSP 1 Score: 90.5077 bits (223), Expect = 2.799e-18
Identity = 59/191 (30.89%), Postives = 100/191 (52.36%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPV----------TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGP 2206
             + K I  +E  GL+  G+YR+    + VGS +++L  Q  +   I++  +          T+ + +K  L ++  PL  Y  + +F+D  K+         V  L  LV  LP  N+KL  +I  HLK +A NS +N M + NLG +F PTL+KS+    MA I   M+ K Q+ +++++++  + +FGP
Sbjct:  395 FIRKSIRAVEKRGLTDQGLYRI----VGVGSKVQNLLFQCVEKKKISQIELESDDSEYEVKTITSALKQHLRNMDPPLFTYEYHEDFLDAVKQ---DTYEKRVASLSKLVQLLPEENKKLIVMIMEHLKNVAANSNKNLMAASNLGVVFGPTLMKSREE-TMAAI---MNLKYQSVVIELLVKEFDRVFGP 574          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 83.1889 bits (204), Expect = 4.568e-16
Identity = 65/189 (34.39%), Postives = 97/189 (51.32%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESL--NSQGADADLINEQPV-TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFR--MADIKEYMDNKSQAKIVQIIIE-NVETLFGPED 2212
            IV+ C+  IE  GL   GIYR+S +   V  + E    NSQ A   L++E  +  +A + K  L  L EPL    LY++FV     A++ E  +  T L+L    LP+ NR  A  +F HL+K+A  SE ++MG  NL T+F P +++  P+    M   +  +D  SQ  I    ++ + E L  P D
Sbjct:  628 IVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSALV-LVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKRE--TMLELF-QSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRPSPKTSSPMDLAQGTLDVMSQVGIFMYFLKLDAEELHLPND 812          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO46865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI7])

HSP 1 Score: 75.485 bits (184), Expect = 9.636e-14
Identity = 48/189 (25.40%), Postives = 100/189 (52.91%), Query Frame = 2
Query: 1655 VTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGAD--ADLINEQPV-TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPED 2212
            + E+V  C+  I+  GL   GI+R+S S   +   M+ L   G D  A L + + +  +A +++     L +PL P   Y +F++  +   +    D++ ++  ++N+LP S  ++   +F  LK+++ +SE+N+M + NL  +F PTL++      M   + +++      ++++II+N + +F   D
Sbjct:  441 IPEVVESCVRFIKRFGLDHPGIFRLSGSSTDIND-MKQLFECGRDPLAGLNHWKDINAVAGLLRVYFRELEDPLFPSSHYQQFIEASRFPTN---EDVIRQVTCVINELPDSVNRVMKYLFKFLKQVSEHSEQNKMDAHNLAVVFGPTLLRIPSEQDMITYQSHVNG-----MMEVIIKNYDQVFPQND 620          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO49086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI38])

HSP 1 Score: 67.781 bits (164), Expect = 4.972e-13
Identity = 45/158 (28.48%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 1718 IYRVSASKLKVGSVMESLNSQGADADLINEQPV----TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIII 2179
            + RV  +   VG++ E LN +GA+     E+       + +++K  L  L E LV   LY  F++  ++ +  E    +  L++L+N+LP  N +    +  HLK +A +++ N+M + NL  +F PTL+++     M+ +K+  D   Q +IV+ I+
Sbjct:    4 VRRVPGNSAAVGALSEELNEKGAENINFQEEKWHDVNNITSLLKQFLRKLPEGLVTAELYESFIEANRKDDPVE---RMGALKMLINELPDHNYETLRHLLTHLKHVAEHADTNKMEARNLAIVFGPTLVRTGEDTMMSMVKDMSD---QCRIVETIL 155          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO44981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUA5])

HSP 1 Score: 72.4034 bits (176), Expect = 1.072e-12
Identity = 55/186 (29.57%), Postives = 88/186 (47.31%), Query Frame = 2
Query: 1664 IVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADL----INEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPE 2209
             V KCI+ +E  G+   GIYR S     + ++  S + +  DAD     +N   VT A  +K  L  L EPL+P +L N  +D     ++ E    +  L+ LV QLP  N  +   +  HL ++   S+EN M S NL T+  PT+++++       ++      +    +Q  IE  E +F  E
Sbjct: 1540 FVEKCIDFVEAEGMQIEGIYRKSGKIEDIRTIQNSFDEK-RDADFSALEMNVHAVTGA--LKKFLKLLPEPLIPNNLQNNILDATVIMDADE---RLAVLRGLVMQLPKVNFAVLKYLMCHLNRVTEYSKENLMESRNLATVIFPTILRTE----FESLQTMARTMNYGLFIQTCIEKCEYMFDEE 1715          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: gmip (GEM interacting protein [Source:NCBI gene;Acc:101164647])

HSP 1 Score: 108.997 bits (271), Expect = 1.845e-23
Identity = 62/199 (31.16%), Postives = 104/199 (52.26%), Query Frame = 2
Query: 1637 QKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAE----------SGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFG 2203
            Q   D V  +V +C   IE   LS  G+YRVS SK ++  + ++   Q    DL +  P  + +++K     L EPL+ + LYN+FV +GK  +          S E+ D+V  LQ L+ +LP+ +      I  HL++++ N  EN+M   NLG +F PTL++      M+ I   ++   Q+ +++ +I +  T+FG
Sbjct:  537 QDTADEVPFVVTRCTSEIESRALSVQGVYRVSGSKPRIQKLCQAFEMQKEQVDLSDNSPHDITSMLKHFFKELPEPLLTFDLYNDFVAVGKAIQHLFEKETSPGSNEIMDIVQDLQKLLKRLPTHSYSTLQHIISHLQRVSEN-HENKMSPSNLGIVFGPTLLRPLVSADMSMIA-ILETSYQSMLIEFLITHYNTIFG 733          

HSP 2 Score: 68.1662 bits (165), Expect = 5.380e-11
Identity = 42/144 (29.17%), Postives = 75/144 (52.08%), Query Frame = 2
Query:  215 KNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNN---KKLGKLLD-----VINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRC 622
            ++ V+ +L YAK+WC++ K+L+   EK+ +LE E  ++  K  +  +T V    M   P+        + I +   E +I+N+   +K  +LL       +  +R E  K R+ +KE+W  + +KM DA   + K +  Y+QRC
Sbjct:   98 EDGVETALQYAKMWCRYAKDLLAWMEKRISLEQEFAKNVIKTAEGAKTNVWQQEMM--PL--------QYIYNMALEQDIKNSLTSRKTCELLQTRCYQALAAKRNEIDKWRREFKEQWAREQRKMNDAVTALKKARHQYFQRC 231          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: arhgap42a (rho GTPase-activating protein 42 [Source:NCBI gene;Acc:101172099])

HSP 1 Score: 106.686 bits (265), Expect = 7.147e-23
Identity = 64/183 (34.97%), Postives = 107/183 (58.47%), Query Frame = 2
Query: 1673 KCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGA------DADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFG 2203
            KCIE+IE  G++T G+YR      KV  +M S+ +  A      D+D+ + + +T A  +K     L+EPL+ Y L+ +FV   + A+  + S  V  +  LV++LP  N+ +  L+ +HL K++++S++NQM   NLG +F PTL++S+       +   M+ K Q  +V+IIIEN + +FG
Sbjct:  400 KCIELIEARGITTVGLYRTGGVNSKVQRLMTSVFASTATSEIQLDSDVWDNKTITSA--LKDYFRCLAEPLLTYRLHKDFV---RAAKFEDQSYRVRAIHALVHKLPEKNKAMLDLLTNHLLKVSSHSDQNQMTVSNLGMIFGPTLMRSQEE----TVAAMMNIKFQNIVVEIIIENHKKIFG 573          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: arhgap45b (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:101162675])

HSP 1 Score: 106.301 bits (264), Expect = 1.275e-22
Identity = 64/213 (30.05%), Postives = 101/213 (47.42%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGE-----------------------------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KCI  IE   L   GIYRV+  K +V  + ++  +     +L    P  ++NV+K  L  L EP++P+ LYN  + + KE+  GE                             V  LV  L+ ++ +LP +N      I HHL++IA   EEN+M   NLG +F P+LI+ +P      +   +D   QA+IV+ +I    ++F
Sbjct:  798 DCIPFIITKCISEIERRALKMKGIYRVNGVKTRVEKLCQAFENGKELVELSQCSPHDISNVLKLYLRQLPEPIMPFRLYNTLMGMAKESLHGEGEESEPSAINPAVSRGPELIDLGPDTDPDVLALVDSLKEILKELPKANFATLRYIIHHLRRIAELEEENKMSPSNLGIVFGPSLIRPRPTGATISLSSLVDYPHQARIVEALIVFYSSIF 1010          

HSP 2 Score: 69.3218 bits (168), Expect = 2.379e-11
Identity = 82/379 (21.64%), Postives = 153/379 (40.37%), Query Frame = 2
Query:  176 GITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS-ESLSLSKLIIDQCKEIEIQ---NNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEK-QLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTT 1297
            G  E+  ++ +  +  VD +L YAK   K+ K+L+   EK+ +LE+E  +   K +QS + +++   M   P+ S  SL+L +   DQ + + +Q   N  +    +  + +++ E  K RK  KE W    +K+++ E  + K K AY  RC       EE   A+      ++ G   TGST  + +                                             K  +LE++  +   K +E   +Y+  + +A  + +E E  K+  L  ++    +SD+ ++     Y +++      +   Y  L    + Y P   Y   +   QL  +P ++   +  E Y   + +      GH  R+DS  T
Sbjct:  308 GRVEEVDVILQHSEGGVDSALLYAKSTAKYMKDLISYVEKRTSLEMEFSKGLQKLYQSCKHSITHPHM---PLFSIYSLALEQ---DQEQSVGLQQASNTLQSQTFVQPLTQRKQEHEKKRKEIKENWFRARRKLLECEANLRKAKQAYMARC-------EEYEKAKTATCRAEEEG---TGSTAKSVE---------------------------------------------KKKRLEEEARN---KAVEAEATYRTCIADATTQQLELEHTKVTVLRQLQDIIKQSDQTLRSATISYYQLMHMQTVALPVHYQTLCESSKLYDPGQQYAAHVRDLQLPGQPTVH---YVFETY---SPSSSGTSHGHRPRNDSFNT 616          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: arhgap45b (Rho GTPase activating protein 45 [Source:NCBI gene;Acc:101162675])

HSP 1 Score: 106.301 bits (264), Expect = 1.385e-22
Identity = 64/213 (30.05%), Postives = 101/213 (47.42%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGE-----------------------------VSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KCI  IE   L   GIYRV+  K +V  + ++  +     +L    P  ++NV+K  L  L EP++P+ LYN  + + KE+  GE                             V  LV  L+ ++ +LP +N      I HHL++IA   EEN+M   NLG +F P+LI+ +P      +   +D   QA+IV+ +I    ++F
Sbjct:  846 DCIPFIITKCISEIERRALKMKGIYRVNGVKTRVEKLCQAFENGKELVELSQCSPHDISNVLKLYLRQLPEPIMPFRLYNTLMGMAKESLHGEGEESEPSAINPAVSRGPELIDLGPDTDPDVLALVDSLKEILKELPKANFATLRYIIHHLRRIAELEEENKMSPSNLGIVFGPSLIRPRPTGATISLSSLVDYPHQARIVEALIVFYSSIF 1058          

HSP 2 Score: 69.707 bits (169), Expect = 1.837e-11
Identity = 82/379 (21.64%), Postives = 153/379 (40.37%), Query Frame = 2
Query:  176 GITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS-ESLSLSKLIIDQCKEIEIQ---NNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEK-QLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTT 1297
            G  E+  ++ +  +  VD +L YAK   K+ K+L+   EK+ +LE+E  +   K +QS + +++   M   P+ S  SL+L +   DQ + + +Q   N  +    +  + +++ E  K RK  KE W    +K+++ E  + K K AY  RC       EE   A+      ++ G   TGST  + +                                             K  +LE++  +   K +E   +Y+  + +A  + +E E  K+  L  ++    +SD+ ++     Y +++      +   Y  L    + Y P   Y   +   QL  +P ++   +  E Y   + +      GH  R+DS  T
Sbjct:  356 GRVEEVDVILQHSEGGVDSALLYAKSTAKYMKDLISYVEKRTSLEMEFSKGLQKLYQSCKHSITHPHM---PLFSIYSLALEQ---DQEQSVGLQQASNTLQSQTFVQPLTQRKQEHEKKRKEIKENWFRARRKLLECEANLRKAKQAYMARC-------EEYEKAKTATCRAEEEG---TGSTAKSVE---------------------------------------------KKKRLEEEARN---KAVEAEATYRTCIADATTQQLELEHTKVTVLRQLQDIIKQSDQTLRSATISYYQLMHMQTVALPVHYQTLCESSKLYDPGQQYAAHVRDLQLPGQPTVH---YVFETY---SPSSSGTSHGHRPRNDSFNT 664          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: arhgap29a (rho GTPase-activating protein 29 [Source:NCBI gene;Acc:101167748])

HSP 1 Score: 102.064 bits (253), Expect = 2.849e-21
Identity = 67/208 (32.21%), Postives = 106/208 (50.96%), Query Frame = 2
Query: 1649 DAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDL---------VTKLQL-------------LVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADI--KEYMDNKSQAKIVQIIIENVETLF 2200
            D +  I+ KC   IE   L+  GIYRV+ +K +V  + ++  +     +L    P  ++NV+K  L  L EPL+ +  YN+F+ L KE++S  V DL         VT  Q+             L+  LP ++ K    +  HL ++   SEEN+M + NLG +F PTL+  KPR   AD+     +D   QA IV+++I + + +F
Sbjct:  747 DGIPFIIRKCTSEIENRALNIKGIYRVNGAKSRVEKLCQAFENGKHLVELSELYPHDISNVLKLYLRQLPEPLILFRYYNDFIGLAKESQSIIVEDLEALRLNTNPVTPAQVSVDLNRVLFKMKDLLRHLPPAHYKTLQFLIEHLHRVTECSEENKMTASNLGIIFGPTLL--KPRQADADVSLSSLVDYPYQALIVELLIRHYQMVF 952          

HSP 2 Score: 63.929 bits (154), Expect = 1.109e-9
Identity = 45/152 (29.61%), Postives = 80/152 (52.63%), Query Frame = 2
Query:  185 EDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLS-------LSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQR 619
            E D+ L R+D + VD +L YAK W K+ KEL+   EK+  ++IE  ++++K  ++ +   S       P R   ++        S+L+++      +Q+NK +  LL     ++ E  + RK  KE+W+ + KKM +A+N + K +    QR
Sbjct:  228 EVDRALQRQD-SGVDSALLYAKAWSKYTKELLTWVEKRLNMDIECAKTYAKMAETAKGLASQQEFM--PFREIYMTAFKNDNEYSQLVLNTAA--ILQSNKFMQPLL----ARKNELDRRRKEVKEQWQREQKKMHEADNALKKARLLQTQR 370          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000078332.1 (SMESG000078332.1)

HSP 1 Score: 2022.28 bits (5238), Expect = 0.000e+0
Identity = 1126/1133 (99.38%), Postives = 1128/1133 (99.56%), Query Frame = 2
Query:  101 MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPASSNRTGVLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSEPAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVPASGHTVXXXXXXTPEKPAPKMMDMLFGXXXXXXXXXXXPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRXXXXXXXXXXXXXXXXXXXXPLIEHNIKSSNSMLXXXXXXXXXXXXYNYSSHLDSTSNSQNENTDSQSHLPFDPILETLFNSPLSNSKNCSHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRVPLLAKSFSDVNNSSVTFFTEGDDNFNSKGSNDKSKLSMSSQYTKLNSFLLKYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV 3499
            MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQ NTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTGVLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTGCTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCS PAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVP SGHTVSSSISSTPEKPAPKMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPTSATTRSYNYSSHLDSTSNSQNENTDSQSHLPFDPI ETLFNSPLSNSKNCSHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRVPLLAKSFSDVNNSSVT FTEGDDNFNSKGSNDKSKLSMSSQY+K+NSFLLKYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV
Sbjct:    1 MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQTNTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTGVLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTGCTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSIPAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVPTSGHTVSSSISSTPEKPAPKMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPTSATTRSYNYSSHLDSTSNSQNENTDSQSHLPFDPIPETLFNSPLSNSKNCSHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRVPLLAKSFSDVNNSSVTIFTEGDDNFNSKGSNDKSKLSMSSQYSKMNSFLLKYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV 1133          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000078332.1 (SMESG000078332.1)

HSP 1 Score: 1996.86 bits (5172), Expect = 0.000e+0
Identity = 1118/1133 (98.68%), Postives = 1120/1133 (98.85%), Query Frame = 2
Query:  101 MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPASSNRTGVLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSEPAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVPASGHTVXXXXXXTPEKPAPKMMDMLFGXXXXXXXXXXXPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRXXXXXXXXXXXXXXXXXXXXPLIEHNIKSSNSMLXXXXXXXXXXXXYNYSSHLDSTSNSQNENTDSQSHLPFDPILETLFNSPLSNSKNCSHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRVPLLAKSFSDVNNSSVTFFTEGDDNFNSKGSNDKSKLSMSSQYTKLNSFLLKYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV 3499
            MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQ NTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEK        SDSQTTRGLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTGVLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTGCTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCS PAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVP SGHTVSSSISSTPEKPAPKMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPTSATTRSYNYSSHLDSTSNSQNENTDSQSHLPFDPI ETLFNSPLSNSKNCSHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRVPLLAKSFSDVNNSSVT FTEGDDNFNSKGSNDKSKLSMSSQY+K+NSFLLKYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV
Sbjct:    1 MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQTNTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEK--------SDSQTTRGLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTGVLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTGCTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSIPAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVPTSGHTVSSSISSTPEKPAPKMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPTSATTRSYNYSSHLDSTSNSQNENTDSQSHLPFDPIPETLFNSPLSNSKNCSHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRVPLLAKSFSDVNNSSVTIFTEGDDNFNSKGSNDKSKLSMSSQYSKMNSFLLKYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV 1125          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000078332.1 (SMESG000078332.1)

HSP 1 Score: 1657.11 bits (4290), Expect = 0.000e+0
Identity = 953/965 (98.76%), Postives = 953/965 (98.76%), Query Frame = 2
Query:  101 MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQIXXXXXXXXXXXXXDGIGXXXXXXXXXXXXXXXXXXXXQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTRGLTRFGIGSIKETDHESRNRNTLPXXXXXXXXXXXXXXXXGVPASSNRTGVLNTIVEFGSNLFRXXXXXXXXXXXXXXXRRNQQNKNKKXXXXXXXXXXXXXXXXAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSEPAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVPASGHTVXXXXXXTPEKPAPKMMDMLFGXXXXXXXXXXXPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRXXXXXXXXXXXXXXXXXXXXPLIEHNIKSSNSMLXXXXXXXXXXXXYNYSSHLDS 2995
            MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQ NTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEK        SDSQTTRGLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTGVLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTGCTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCS PAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVP SGHTVSSSISSTPEKPAPKMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPTSATTRSYNYSSHL S
Sbjct:    1 MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAKLWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRSESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWKSDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQETGSTNATAQTNTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQMSKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHLCDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCYDYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEK--------SDSQTTRGLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTGVLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTGCTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLFGPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSIPAVDSKVKQQRPHSSIIESAVNISALHESSFSRPLSGSLRVPTSGHTVSSSISSTPEKPAPKMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSIPHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYTTGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPTSATTRSYNYSSHLGS 957          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000021141.1 (SMESG000021141.1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.315e-17
Identity = 55/184 (29.89%), Postives = 91/184 (49.46%), Query Frame = 2
Query: 1676 CIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQ---GADADLINEQPV------TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            C   IE  GL   G+YR S        +M+ +        D D+++E+ +       L ++VKS +  L  P+  + LY+EF+  GK     +  + V K+   +  LP  N KL  ++FHHLK I+ +SE+N M + NLG  F+PT+   +P    A +    ++K    ++ I+IE  +  F
Sbjct:  412 CFNSIERRGLENQGLYRTSGRVGYTDKIMKKIAEDLKCPIDGDVMSEKELENLEINVLCSMVKSYIKYLRAPMATFELYDEFISAGKLQNYEDKFNAVDKI---IKSLPKDNFKLFSILFHHLKIISESSEKNLMTAPNLGVCFSPTIF--RPEQVTASLTAIRESKFAGDVITILIEKCDDYF 590          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000021141.1 (SMESG000021141.1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.398e-17
Identity = 55/184 (29.89%), Postives = 91/184 (49.46%), Query Frame = 2
Query: 1676 CIEVIEINGLSTHGIYRVSASKLKVGSVMESLNSQ---GADADLINEQPV------TLANVVKSKLISLSEPLVPYHLYNEFVDLGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQMGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF 2200
            C   IE  GL   G+YR S        +M+ +        D D+++E+ +       L ++VKS +  L  P+  + LY+EF+  GK     +  + V K+   +  LP  N KL  ++FHHLK I+ +SE+N M + NLG  F+PT+   +P    A +    ++K    ++ I+IE  +  F
Sbjct:  412 CFNSIERRGLENQGLYRTSGRVGYTDKIMKKIAEDLKCPIDGDVMSEKELENLEINVLCSMVKSYIKYLRAPMATFELYDEFISAGKLQNYEDKFNAVDKI---IKSLPKDNFKLFSILFHHLKIISESSEKNLMTAPNLGVCFSPTIF--RPEQVTASLTAIRESKFAGDVITILIEKCDDYF 590          
The following BLAST results are available for this feature:
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GMIP2.194e-2332.82GEM interacting protein [Source:HGNC Symbol;Acc:HG... [more]
GMIP2.293e-2332.82GEM interacting protein [Source:HGNC Symbol;Acc:HG... [more]
ARHGAP106.772e-2132.45Rho GTPase activating protein 10 [Source:HGNC Symb... [more]
ARHGAP298.088e-2129.19Rho GTPase activating protein 29 [Source:HGNC Symb... [more]
ARHGAP299.628e-2129.19Rho GTPase activating protein 29 [Source:HGNC Symb... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spv-11.452e-2132.29Spermathecal Physiology Variant [Source:UniProtKB... [more]
spv-11.565e-2132.81Spermathecal Physiology Variant [Source:UniProtKB... [more]
spv-11.811e-2132.29Spermathecal Physiology Variant [Source:UniProtKB... [more]
spv-12.376e-2132.81Spermathecal Physiology Variant [Source:UniProtKB... [more]
spv-13.288e-2132.81Spermathecal Physiology Variant [Source:UniProtKB... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Graf1.592e-1829.03gene:FBgn0030685 transcript:FBtr0074194[more]
Graf1.592e-1829.03gene:FBgn0030685 transcript:FBtr0345133[more]
Graf1.592e-1829.03gene:FBgn0030685 transcript:FBtr0074197[more]
Graf1.592e-1829.03gene:FBgn0030685 transcript:FBtr0074198[more]
Graf1.699e-1829.03gene:FBgn0030685 transcript:FBtr0340306[more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gmip2.114e-2433.16GEM interacting protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
gmip3.974e-2433.16GEM interacting protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
arhgap45a9.275e-2430.92Rho GTPase activating protein 45a [Source:ZFIN;Acc... [more]
arhgap29a2.268e-2229.76Rho GTPase activating protein 29a [Source:ZFIN;Acc... [more]
arhgap42b3.565e-2234.78Rho GTPase activating protein 42b [Source:ZFIN;Acc... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap451.247e-2129.70Rho GTPase activating protein 45 [Source:NCBI gene... [more]
arhgap451.350e-2129.70Rho GTPase activating protein 45 [Source:NCBI gene... [more]
arhgap451.374e-2129.70Rho GTPase activating protein 45 [Source:NCBI gene... [more]
arhgap451.421e-2129.70Rho GTPase activating protein 45 [Source:NCBI gene... [more]
arhgap451.450e-2129.70Rho GTPase activating protein 45 [Source:NCBI gene... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gmip7.437e-2432.31Gem-interacting protein [Source:MGI Symbol;Acc:MGI... [more]
Gmip8.062e-2432.31Gem-interacting protein [Source:MGI Symbol;Acc:MGI... [more]
Arhgap291.706e-2129.19Rho GTPase activating protein 29 [Source:MGI Symbo... [more]
Arhgap293.982e-2129.19Rho GTPase activating protein 29 [Source:MGI Symbo... [more]
Arhgap457.110e-2128.92Rho GTPase activating protein 45 [Source:MGI Symbo... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PGG2|GMIP_MOUSE5.202e-2332.31GEM-interacting protein OS=Mus musculus OX=10090 G... [more]
sp|Q9P107|GMIP_HUMAN1.101e-2232.82GEM-interacting protein OS=Homo sapiens OX=9606 GN... [more]
sp|Q5PQJ5|RHG29_RAT2.094e-2129.67Rho GTPase-activating protein 29 OS=Rattus norvegi... [more]
sp|A7YY57|RHG29_BOVIN5.110e-2130.14Rho GTPase-activating protein 29 OS=Bos taurus OX=... [more]
sp|Q6PCS4|RHG29_DANRE7.761e-2130.24Rho GTPase-activating protein 29 OS=Danio rerio OX... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R5Y15.034e-16842.20RhoGAP OS=Fasciola hepatica OX=6192 GN=D915_005491... [more]
A0A5J4NSN34.312e-16240.08Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A3R7C4238.099e-15940.03Minor histocompatibility protein HA-1 (Fragment) O... [more]
A0A4S2MGP81.082e-15840.08Rho-GAP domain-containing protein OS=Opisthorchis ... [more]
A0A183A9L61.380e-14038.57Rho-GAP domain-containing protein OS=Echinostoma c... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap29a2.209e-2534.92Rho GTPase activating protein 29a [Source:ZFIN;Acc... [more]
gmip1.279e-2332.29GEM interacting protein [Source:NCBI gene;Acc:1030... [more]
gmip1.328e-2332.29GEM interacting protein [Source:NCBI gene;Acc:1030... [more]
gmip1.889e-2332.31GEM interacting protein [Source:NCBI gene;Acc:1030... [more]
arhgap29b4.211e-2331.71Rho GTPase activating protein 29b [Source:NCBI gen... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap53.610e-1633.86Rho GTPase activating protein 5 [Source:ZFIN;Acc:Z... [more]
arhgap21b7.742e-1532.79Rho GTPase activating protein 21b [Source:ZFIN;Acc... [more]
arhgap51.312e-1328.42Rho GTPase activating protein 5 [Source:ZFIN;Acc:Z... [more]
chn23.797e-1329.41chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
chn26.929e-1327.81chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RGD13.305e-825.50GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
RGA23.589e-725.26GTPase-activating protein for polarity-establishme... [more]
BAG73.693e-727.91Rho GTPase activating protein (RhoGAP); stimulates... [more]
BEM23.818e-724.84Rho GTPase activating protein (RhoGAP); involved i... [more]
RGA11.855e-622.64GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456672.799e-1830.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474414.568e-1634.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468659.636e-1425.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490864.972e-1328.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449811.072e-1229.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gmip1.845e-2331.16GEM interacting protein [Source:NCBI gene;Acc:1011... [more]
arhgap42a7.147e-2334.97rho GTPase-activating protein 42 [Source:NCBI gene... [more]
arhgap45b1.275e-2230.05Rho GTPase activating protein 45 [Source:NCBI gene... [more]
arhgap45b1.385e-2230.05Rho GTPase activating protein 45 [Source:NCBI gene... [more]
arhgap29a2.849e-2132.21rho GTPase-activating protein 29 [Source:NCBI gene... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078332.10.000e+099.38SMESG000078332.1[more]
SMESG000078332.10.000e+098.68SMESG000078332.1[more]
SMESG000078332.10.000e+098.76SMESG000078332.1[more]
SMESG000021141.12.315e-1729.89SMESG000021141.1[more]
SMESG000021141.12.398e-1729.89SMESG000021141.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009975 ID=SMED30009975|Name=Rho-GAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3875bp
TTCTGAAATTAATATTTTAAGGATAAGTGTTTTATTAATAAAAAGGAATT
TATTTAAAAACTTATAAAATAGTCAATTATTAAGATTTACCAATCCATTA
ATGAGTGGAGACCAAGATACGGAAAATAAATTATCTGCTGATACTATTAC
GGAGGCTTCTTTGGATTTAAGTCCGGGAATTACTGAAGATGATAAACTTT
TATGGAGAAAAGATAAAAATGCAGTGGATTTCAGTTTGAATTATGCAAAA
CTGTGGTGCAAATTCTGCAAGGAATTGGTAGTTGCATTTGAGAAAAAAGC
AACTTTGGAGATTGAATTATGCCGGAGTTGGTCTAAACAGTTTCAAAGTT
TCGAAACTACAGTTAGTTCCAGTGTCATGTTCGGTGCACCAATGAGGTCA
GAATCCTTGAGTTTGAGCAAGTTGATCATTGACCAATGCAAAGAAATTGA
AATTCAGAATAATAAAAAATTGGGAAAGCTTTTAGATGTTATCAATCGTC
AACGAACTGAATTCAGTAAAACACGAAAGCACTATAAAGAAAAATGGAAA
TCGGATTGCAAAAAAATGATGGACGCGGAAAATACAATGTTAAAAACAAA
ATCTGCTTATTATCAGAGATGCCAGCAAGGGGTGAAATTGAGAGAAGAAT
TAACAAACGCACAAGCTTTGCTGACCTACATGCAGGATCATGGCATTCAA
GAAACCGGATCTACTAACGCTACTGCCCAAATTAACACTTCAAATCAGTC
AAATACCTCTAATGTCAATGTTGATGGAATTGGATCCACAGCCACTATAT
CGGCCTCATCAAGTACCACTTCAGCTGACTCAATATCTGCTTCACAGATG
AGTAAACAAAAACTGAAGGTTGACAAACTTGAGAAGCAATTAGCTGATAA
TGATAAAAAAGAAATAGAACAAATGTATTCTTATAAGGAGTCTGTGGAAA
ATGCGAATAATAAATTAATAGAATTTGAGAAGAAAAAAATGGAACATTTG
TGTGACATCAGATTAACCACATCTAGAAGTGATGAAGTGGTTAAGGATAC
TTTGGCGGAATATCTGAGAATATTAGCTGAAACAAGAACTACCATGCTTA
ATGAATATTCAATTTTGAGCAATAAATTCCAAGAGTATAAACCGTGTTAT
GATTATCGGTGTTTGATTGAAAAACAATTGTCAAATAAGCCTGATATTTA
CAGTGAAAAGTTTCAAGTGGAGCTCTATCATGATTGTGCAACGACCAAAG
AAAAACACAAATTCGGTCACTTTAAACGGTCCGATTCGCAGACAACCAGA
GGTCTAACAAGGTTTGGCATTGGTAGTATAAAAGAAACTGATCACGAATC
CCGCAATAGAAATACGCTTCCAAGTCATTCAGATTCTGATTCTGATACAG
AAACTACGCCAACTGGAGATGGAGTTCCAGCTTCATCAAATCGAACTGGA
GTTTTAAATACAATAGTTGAATTCGGTTCAAATTTATTTCGTCAAGGTGG
AGGTGGAGCACAAGGAAGCACCTCTAGCGATGCTACTCGTCGTAATCAAC
AAAACAAAAATAAAAAGAGTACTTCAGGTAGTACTAGTAGTATGACAGGA
TGTACAGAGGGTGGTGCTGAAAAGGATTTGGAATGGCAGAAAGAAGTCGA
TGCAGTGACGGAAATTGTTTTAAAATGCATTGAAGTTATAGAAATAAACG
GATTATCAACCCATGGAATATATCGCGTGTCTGCTTCAAAGCTTAAAGTG
GGATCGGTTATGGAGTCTCTCAATAGTCAAGGCGCTGATGCAGATCTTAT
CAATGAACAACCAGTTACGTTGGCTAACGTTGTAAAAAGCAAACTCATTT
CCTTATCCGAGCCGCTTGTGCCATACCATCTTTATAATGAATTTGTTGAT
CTTGGAAAAGAAGCAGAAAGTGGAGAGGTGTCAGATCTTGTAACTAAACT
CCAACTACTAGTTAACCAATTGCCTTCATCTAATAGAAAACTTGCGGGAT
TAATATTTCATCATTTGAAAAAGATTGCCAATAATAGTGAAGAAAATCAA
ATGGGATCTGTAAATCTTGGCACATTGTTTGCACCGACTCTTATAAAATC
CAAACCAAGGTTTCGAATGGCGGACATCAAAGAATATATGGACAATAAAT
CCCAGGCAAAGATTGTTCAGATTATAATCGAAAACGTCGAAACATTGTTT
GGACCAGAAGACCAATATTACAATCCCAAATTAACGAAGGGAGACCTTGC
AGACTTTGAAGAAACCAAAATTCAACAAGAAAAAGATTCTTTAAATGTCC
TTAAAGTCTGTTCAGAACCTGCTGTTGACAGCAAAGTTAAACAACAGCGA
CCTCATAGTTCAATTATTGAATCTGCTGTCAATATATCAGCTCTTCATGA
ATCCTCATTCAGTCGACCATTATCTGGAAGCTTGCGAGTGCCTGCGTCTG
GTCATACTGTTTCATCTTCCATTAGTTCTACACCAGAGAAGCCGGCTCCA
AAAATGATGGACATGTTATTTGGATCAGACACAAGTACAACTATACGATC
AACGAGTCCTCGACCCAAAAGAATTACTCCAGAGCCTTCAGCAGATAAAG
AGTCAATATCTATTGACAATAATACGAAAGATAAAAATTCCTCCAGTATT
CCTCATCGCAGTATTTCCGTTGGGTCGGGTCCATTGCCAGAAGCCATAAA
ACTGGCACAACTCAGCCAGCCGTCTAATGATAGTATTTTTAGCAAATCTA
AGGACAATGAGAATATAACTGTAACTGAAAAATCAGTTTTGAATTATACA
ACTGGAGATCGTTACAACGATTTAAAACGATCATTTATTTCGTCTACAGA
ATCTAGTTTTGTTTCTAAAAGCAATCAAAATTCATCAAATCCGCTAATTG
AGCATAACATCAAATCATCAAATTCTATGTTAAGTAGATCACGGCCTACA
TCTGCCACAACTAGGTCTTATAATTATTCAAGTCACCTTGATTCAACAAG
CAATTCACAAAATGAAAACACTGATTCACAATCTCATTTACCATTTGATC
CTATCCTTGAAACTTTATTTAACTCGCCATTGTCCAATTCTAAAAATTGT
TCTCATTTTAGTAATGTTATCCCTAGAAAGAATCTTAGATACCGATCGAG
ATCATATATTATGTCAGTTGAACCGCATAATAAACCATCGAATCGGATCT
CGAGTTCAGTGTCGGCGTCGCCGTTTATCCGCCAATCGAAAATTCGAGTT
CCTTTATTGGCGAAAAGCTTCTCTGACGTGAACAACTCAAGCGTGACGTT
TTTCACTGAAGGCGATGACAATTTCAATAGTAAAGGTTCGAATGATAAGT
CGAAATTATCCATGTCTAGCCAGTATACTAAATTGAATAGTTTTCTTTTG
AAATATTGCTCTGTTGATAACATTGACAAAATTGATCATTCAAAAGTCGC
TAAATACCAAAGTTGGCTGTCTCAGCCAGTTTTCGATGAGTTTTTTGTTT
GAATAGAATACGTTTTTGCCTTACACAATCCATTGAATTATTTGTAATTA
GATAATGATTATTCTTATTTATTTATTGGTTTATTATTTTTATTAAGCAG
AATCGTTTACTTTTATTATTGCACATGTTTGAAAGATTATCTTTGAAATA
AATTTATCGATGAAAATTTGTTTATACTTGTGATTAATATTGCAATGATT
GTTATTTATGTTTCTATTTTCTAGAAAACTATTGTTTTTTTCTTTTTCAA
ATAATAGTGCAAACCGATCGATATATTTCAAAAATTTGATTGATTTTGGA
TAAGTGAATATTTGTTGTTTGAATTTTAAGATTTATGGAAATTTTTGCAT
TATTGTATTTAAATTCATTTAAAAT
back to top

protein sequence of SMED30009975-orf-1

>SMED30009975-orf-1 ID=SMED30009975-orf-1|Name=SMED30009975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1134bp
MSGDQDTENKLSADTITEASLDLSPGITEDDKLLWRKDKNAVDFSLNYAK
LWCKFCKELVVAFEKKATLEIELCRSWSKQFQSFETTVSSSVMFGAPMRS
ESLSLSKLIIDQCKEIEIQNNKKLGKLLDVINRQRTEFSKTRKHYKEKWK
SDCKKMMDAENTMLKTKSAYYQRCQQGVKLREELTNAQALLTYMQDHGIQ
ETGSTNATAQINTSNQSNTSNVNVDGIGSTATISASSSTTSADSISASQM
SKQKLKVDKLEKQLADNDKKEIEQMYSYKESVENANNKLIEFEKKKMEHL
CDIRLTTSRSDEVVKDTLAEYLRILAETRTTMLNEYSILSNKFQEYKPCY
DYRCLIEKQLSNKPDIYSEKFQVELYHDCATTKEKHKFGHFKRSDSQTTR
GLTRFGIGSIKETDHESRNRNTLPSHSDSDSDTETTPTGDGVPASSNRTG
VLNTIVEFGSNLFRQGGGGAQGSTSSDATRRNQQNKNKKSTSGSTSSMTG
CTEGGAEKDLEWQKEVDAVTEIVLKCIEVIEINGLSTHGIYRVSASKLKV
GSVMESLNSQGADADLINEQPVTLANVVKSKLISLSEPLVPYHLYNEFVD
LGKEAESGEVSDLVTKLQLLVNQLPSSNRKLAGLIFHHLKKIANNSEENQ
MGSVNLGTLFAPTLIKSKPRFRMADIKEYMDNKSQAKIVQIIIENVETLF
GPEDQYYNPKLTKGDLADFEETKIQQEKDSLNVLKVCSEPAVDSKVKQQR
PHSSIIESAVNISALHESSFSRPLSGSLRVPASGHTVSSSISSTPEKPAP
KMMDMLFGSDTSTTIRSTSPRPKRITPEPSADKESISIDNNTKDKNSSSI
PHRSISVGSGPLPEAIKLAQLSQPSNDSIFSKSKDNENITVTEKSVLNYT
TGDRYNDLKRSFISSTESSFVSKSNQNSSNPLIEHNIKSSNSMLSRSRPT
SATTRSYNYSSHLDSTSNSQNENTDSQSHLPFDPILETLFNSPLSNSKNC
SHFSNVIPRKNLRYRSRSYIMSVEPHNKPSNRISSSVSASPFIRQSKIRV
PLLAKSFSDVNNSSVTFFTEGDDNFNSKGSNDKSKLSMSSQYTKLNSFLL
KYCSVDNIDKIDHSKVAKYQSWLSQPVFDEFFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR008936Rho_GTPase_activation_prot
IPR000198RhoGAP_dom
IPR031160F_BAR
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 250..270
NoneNo IPR availableCOILSCoilCoilcoord: 275..302
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 463..506
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 409..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 916..977
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 463..502
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 833..855
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 773..800
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 812..858
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 402..449
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 773..796
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 428..449
NoneNo IPR availablePANTHERPTHR15228FAMILY NOT NAMEDcoord: 518..759
NoneNo IPR availablePANTHERPTHR15228:SF16GEM-INTERACTING PROTEINcoord: 25..184
NoneNo IPR availablePANTHERPTHR15228:SF16GEM-INTERACTING PROTEINcoord: 518..759
NoneNo IPR availablePANTHERPTHR15228FAMILY NOT NAMEDcoord: 25..184
NoneNo IPR availableCDDcd00159RhoGAPcoord: 522..695
e-value: 3.60392E-38
score: 138.589
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 517..697
e-value: 7.1E-35
score: 131.9
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 522..669
e-value: 3.1E-32
score: 111.5
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 508..700
score: 37.085
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 468..708
e-value: 3.3E-43
score: 149.6
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 522..702
IPR031160F-BAR domainPROSITEPS51741F_BARcoord: 28..351
score: 12.505
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 41..361