Transmembrane O-mannosyltransferase targeting cadherins 3

Overview
NameTransmembrane O-mannosyltransferase targeting cadherins 3
Smed IDSMED30009974
Length (bp)2494
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane O-mannosyltransferase targeting cadherins 3 (SMED30009974) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane O-mannosyltransferase targeting cadherins 3 (SMED30009974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane O-mannosyltransferase targeting cadherins 3 (SMED30009974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane O-mannosyltransferase targeting cadherins 3 (SMED30009974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
whole organismSMED30009974h1SMcG0015270 Contig52877newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30009974h1SMcG0015270 Contig52877uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Human
Match: TMTC3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:HGNC Symbol;Acc:HGNC:26899])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 397/814 (48.77%), Postives = 544/814 (66.83%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSG------------IIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFI 2460
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N+I HA+V ++F ++C ++ D   S ++++LFAVHPIHTEAVTGVVGRAELLSS+FFL +   +++  +SK   N      I L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S             ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S+ D+R + T   + F+G+L +  I R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I     F+K  +    +++L+H++ T++RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAEE++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V+IELK  +EAL  F+ +L+L+  HK A  + A    E  E   R EA+      I  E      +F L M+  DDK    AE     ++K     R +LFNLALLY+   K+  +AL +L  LL  YP+H+KG +L GDIL+N K+D+  A   F++  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HLNIVR+++  S+S+FI
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAA---FLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGITVVGICCVYEVF-IAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSI-RYSGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISTKSVFKKLSWICLSMVILTHSLKTFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSYINEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKEL-KALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVVYFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKI--SSSSFI 824          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Human
Match: TMTC3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:HGNC Symbol;Acc:HGNC:26899])

HSP 1 Score: 339.347 bits (869), Expect = 3.244e-108
Identity = 193/381 (50.66%), Postives = 254/381 (66.67%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSG------------IIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQK 1167
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N+I HA+V ++F ++C ++ D   S ++++LFAVHPIHTEAVTGVVGRAELLSS+FFL +   +++  +SK   N      I L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S             ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S+ D+R + T   + F+G+L +  I R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAA---FLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGITVVGICCVYEVF-IAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSI-RYSGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK 395          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Human
Match: TMTC4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:HGNC Symbol;Acc:HGNC:25904])

HSP 1 Score: 317.39 bits (812), Expect = 7.446e-96
Identity = 243/719 (33.80%), Postives = 378/719 (52.57%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK--SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVR---------YTRSGIIFM------GAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLE-ADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ ETP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH+ + +L   + ++ F  +               S L+A+LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    +  +K         +LL + L ++  LCKEQ IT LG+      + ++ + K + + I +K   +             G++F       G A ++++R +I G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ SI+D R++     +   IGL+   +    +      L + L  +V+ FLPASNLF  VGFVVAERVLY PS+G+C+++        KH +K +K I    + +L  +T+    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A+RY+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N  +  E A+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +L+L  +      SLA+   +  +K +E+++++   IKA   +   H  LA++     +  LA+KHY  SL+ DPT+ G+  N  LL
Sbjct:   34 FARSYDGDFVFDDSEAIVNNKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHSGISVLMVDVFSVLFGGLQYTSKGRRLHLAPRASLLAALLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCKAFRESNKEGAHSSTFWVLLSIFLGAVAMLCKEQGITVLGLN---AVFDILVIGKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPPAFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWRVIALAALWFCLIGLICQALCSE-DGHKRRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVGYCVLLTFGFGALSKHTKK-KKLIAAVVLGILFINTLRCVLRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLL 729          

HSP 2 Score: 52.7582 bits (125), Expect = 3.115e-6
Identity = 54/245 (22.04%), Postives = 113/245 (46.12%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGY 2442
            RS E R++   + +AL   P +A +HYN+G    +      A+  +  +++L+  +  A  +L +   E  E  +EA+ +    ++ + +       L +++   K F+ AE+ Y  ++K+        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A    ++A EL P +     +L  V+ +  K  E+E+   +A+K +PN      +L ++ +R G+
Sbjct:  460 RSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERNE-LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMI--ILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGH 701          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Human
Match: TMTC4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:HGNC Symbol;Acc:HGNC:25904])

HSP 1 Score: 317.39 bits (812), Expect = 1.169e-95
Identity = 243/719 (33.80%), Postives = 378/719 (52.57%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK--SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVR---------YTRSGIIFM------GAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLE-ADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ ETP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH+ + +L   + ++ F  +               S L+A+LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    +  +K         +LL + L ++  LCKEQ IT LG+      + ++ + K + + I +K   +             G++F       G A ++++R +I G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ SI+D R++     +   IGL+   +    +      L + L  +V+ FLPASNLF  VGFVVAERVLY PS+G+C+++        KH +K +K I    + +L  +T+    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A+RY+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N  +  E A+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +L+L  +      SLA+   +  +K +E+++++   IKA   +   H  LA++     +  LA+KHY  SL+ DPT+ G+  N  LL
Sbjct:   53 FARSYDGDFVFDDSEAIVNNKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHSGISVLMVDVFSVLFGGLQYTSKGRRLHLAPRASLLAALLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCKAFRESNKEGAHSSTFWVLLSIFLGAVAMLCKEQGITVLGLN---AVFDILVIGKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPPAFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWRVIALAALWFCLIGLICQALCSE-DGHKRRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVGYCVLLTFGFGALSKHTKK-KKLIAAVVLGILFINTLRCVLRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLL 748          

HSP 2 Score: 52.373 bits (124), Expect = 3.338e-6
Identity = 54/245 (22.04%), Postives = 113/245 (46.12%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGY 2442
            RS E R++   + +AL   P +A +HYN+G    +      A+  +  +++L+  +  A  +L +   E  E  +EA+ +    ++ + +       L +++   K F+ AE+ Y  ++K+        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A    ++A EL P +     +L  V+ +  K  E+E+   +A+K +PN      +L ++ +R G+
Sbjct:  479 RSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERNE-LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMI--ILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGH 720          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Human
Match: TMTC1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:HGNC Symbol;Acc:HGNC:24099])

HSP 1 Score: 305.449 bits (781), Expect = 4.208e-90
Identity = 264/855 (30.88%), Postives = 412/855 (48.19%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFS-TLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLC--TIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIY-----INIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFP------------------IRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSI---IVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKF-QKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFY--------SEDKEKR------------------------EEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNH---------VKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHL 2415
            Y  SL   FV DDV AI +N D+RP  P    +F NDFWG  + +  SHKSYRPL VLTF+ N FL  +NP  +HA+N+ILH +V ++    C  T++ +   +F++A+LFAVHPIHTEAV G+VGRA++L+ + FLL+ L Y        V   + +      +LL L L +   L KE  IT  GVC+    Y L  L    + + +     R  +       ++L      + NGK   F         HSP P                  +R LT++YL + N+ LL  P+ LC DW +G+I LV +I D+R + T+     + LLS+      KR+E K    + + LL +V  F+PASNLF  VGFVVAERVLY PS+G+C++    L K      +     +  S V+LLL  +  T  +N  W +  +LF S +Q   +NAK+  N  + L+ + + ++A+ ++  A K  P    +  N+G TL   +   EA+  ++ AL   PQ  +                 NL NLL K++ +  EA   L+ +I   P+F DAY +   +L +  R +EA   Y T ++  P+S+DLH N GV  ++    ++A++ +  +++L  SH  A ++L   Y        +E+  KR                        EEA  IY +    +    +   ALA +       + AEK   H +  +         L+ +Y+ + +  D+AL  +++ L+  P            KG+ L    LL+       AF +++ A +L P  AQA  N+  +   + K V A +    A++L P+   +K++L
Sbjct:   41 YGRSLQGEFVHDDVWAIVNNPDVRPGAPLRWGIFTNDFWGKGMAENTSHKSYRPLCVLTFKLNIFLTGMNPFYFHAVNIILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPIHTEAVAGIVGRADVLACLLFLLAFLSYNRSLDQGCVGGSFPSTVSPFFLLLSLFLGTCAMLVKETGITVFGVCL---VYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPH-RENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLVETIWDMRNLATIFLAVVMALLSLHCLAAFKRLEHKE---VLVGLLFLVFPFIPASNLFFRVGFVVAERVLYMPSMGYCILFVHGLSKLCTWLNRCGATTLIVSTVLLLLLFSWKTVKQNEIWLSRESLFRSGVQTLPHNAKVHYNYANFLKDQGRNKEAIYHYRTALKLYPRHASALNNLG-TLT--RDTAEAKMYYQRALQLHPQHNR--------------ALFNLGNLL-KSQEKKEEAITLLKDSIKYGPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLVDTGLPEKAVAHYQQAIKLSPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQ-ENHDKALDAIDKALQLKPKDPKVISELFFTKGNQLREQNLLD------KAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYVSARAYYERALQLVPDSKLLKENL 863          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Celegans
Match: F38B6.6 (Protein O-mannosyl-transferase TMTC1 [Source:UniProtKB/Swiss-Prot;Acc:Q20144])

HSP 1 Score: 253.062 bits (645), Expect = 5.445e-73
Identity = 219/708 (30.93%), Postives = 336/708 (47.46%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTI------YFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITAL--GVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLM--FLRLKINGKYMPFFTDFDNPAA--HSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVR-IVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDK-EKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEA 2145
            Y + L   FVFDD  +I +N  +  + P   +F  DFWG  I    SHKSYRP+T  TF  NY L E +  GYH +N+I H +  ++F++L         +F+I  +F ++ILFAVHP+HTEAV  + GRAELL ++F L +L+++   VK++  N K        ++LV + TL KEQ +  +   +CI   A+                   R  RS  + M   L+   FLR+ +NG     FT  DNP A  +S F  R + + Y+   +  LL  P+ LC D++MG IS +T++ D+R + P L       + +I++I            +S L+ ++SFLPASN+F +VGF +AERVLY PS GFCL+  +  +K   HF+          + L+L     TY R+ +W+ E +L+ S L V   NAK+  N+G  L      +DA + +  A K  P       +  + L NL   LE               K G + T                           A++ L RA+++RP F  A+ N G   + L +  EA      +L  RPNSA   +NLGV+     R++ A+S +  + ++D SH  +  +L  F   D   +  +   + Y  + +     + H  +        NF  AE H   ++  +PTS     NL +LY   + +  EA
Sbjct:   43 YLSCLGGDFVFDDAESIVNNPIVNGKDPLLQIFSRDFWGRSISSSNSHKSYRPVTTFTFWLNYKLHETSTLGYHVVNIICHTVATLVFYKLGKQLEHIFDFFNI--AFSASILFAVHPVHTEAVANITGRAELLMTIFSLAALILH---VKNREINCK-------FVLLVILSTLSKEQGLMTIPIAICIDFLAH-------------------RSCRSNFVRMICLLVAIGFLRMMVNGFEAAKFTKLDNPTAFLNSKF-YRMINYTYIWLYHAYLLVIPVNLCFDYSMGCISSITTMWDLRALSPVL-------IFTIVIIGVKFQNECRAFTLSSLMGIISFLPASNIFFTVGFSIAERVLYLPSAGFCLLCAIIFKKLSVHFKNADV----LSITLILLLISKTYRRSGEWKTELSLYSSGLSVCPTNAKIHYNLGKVLGDNGLTKDAEKNYWNAIKLDP-------SYEQALNNLGNLLE---------------KSGDSKT---------------------------AESLLARAVTLRPSFAVAWMNLGISQMNLKKYYEAEKSLKNSLLIRPNSAHCLFNLGVLYQRTNRDEMAMSAWKNATRIDPSHSQSWTNL--FVVLDHLSQCSQVIDLSYQALSSVPNESRVHMQIGSCHAKHSNFTAAENHIKSAIDLNPTSVLFHANLGILY-QRMSRHKEA 655          

HSP 2 Score: 50.0618 bits (118), Expect = 6.380e-6
Identity = 60/248 (24.19%), Postives = 109/248 (43.95%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMM-----ETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            RS E + +   Y + L   P +A +HYNLG V  +     +A   +  +++LD S++ A  +L +      EK  ++K+    L +A   + +  FA+A M     + + K +  AEK   +SL   P S   LFNL +LY     + + A+          P+H +    L  +L +  +      L++Q  S + P  ++    +     + S    AE+ +  A+ L+P       +L I+  R+
Sbjct:  410 RSGEWKTELSLYSSGLSVCPTNAKIHYNLGKVLGDNGLTKDAEKNYWNAIKLDPSYEQALNNLGNLL----EKSGDSKTAESLLARA--VTLRPSFAVAWMNLGISQMNLKKYYEAEKSLKNSLLIRPNSAHCLFNLGVLY-QRTNRDEMAMSAWKNATRIDPSHSQSWTNLFVVLDHLSQCSQVIDLSYQALSSV-PNESRVHMQIGSCHAKHSNFTAAENHIKSAIDLNPTSVLFHANLGILYQRM 649          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Celegans
Match: F32D1.3 (pep chromosome:WBcel235:V:4349775:4361552:-1 gene:WBGene00017983.1 transcript:F32D1.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32D1.3)

HSP 1 Score: 184.111 bits (466), Expect = 2.687e-48
Identity = 157/469 (33.48%), Postives = 237/469 (50.53%), Query Frame = 1
Query:   73 SLDCGFVFDDVTAIKDNKDLRPETPFSTLF-YNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSF--LSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGL-----LSIIVIKRIETKSSETLAMSLLIMVLS--FLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVG 1446
            +L+  FV+DD  AI  N D+   TP+ +L  +NDFWG PI  + SHKSYRPL   +FR  + +  L    +H +N+I H I  +L  +L      + + F  LSA++FA HPI +EAV  +VGRA+LLS++  L    + I    S  S  +        +VL  +    KE  I  L          L+ L+ +     + K F R   + +I + A  L +LRL IN    P F+  DNP AH P  + R LTF YL   +L L+  P  L  DW+M  I  V S+ D RI+    T+  IG+     L +++  R    S E  ++  L  + +   + +SNL   VGFV AER+LY  ++ +C++     +   K  +   K +   +++LL   T+ T  R  DW+ E +LF SAL+VN   A +  N+G+    +KK+E A  ++  A K Q N   +  N+G
Sbjct:   37 TLNADFVYDDRPAILTNDDVLGRTPWRSLIVHNDFWGNPIGLQGSHKSYRPLITASFRLQFAVHGLKAELFHGVNLICHMINSMLVLKLARQMRIMGNEFSLLSALIFACHPITSEAVCSIVGRADLLSTMLIL----LAITCHTSDPSTFR-------TIVLSILAVTAKETGIILLP---------LITLYDVLFKTSNTKQFRRDVTAYLISLLA--LCYLRLSINNFQSPKFSKNDNPIAHEPNSLTRALTFMYLPVFHLNLIVFPKTLSYDWSMDAIPKVESLIDSRII---LTFIVIGVGEHVLLKLLLGLRNSENSHENRSLLFLFALFTTPHILSSNLLTHVGFVAAERILYLNTVAYCILAAFLAEMCSK--RSSPKSVLPLYILLLSLFTIRTMQRVDDWKTEESLFKSALEVNPTKANM--NLGYVYTTQKKYELAKYHYRQALKRQGNLADAWYNLG 476          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 100.523 bits (249), Expect = 2.192e-21
Identity = 105/386 (27.20%), Postives = 177/386 (45.85%), Query Frame = 1
Query: 1237 TMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLI--KAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSP 2388
             +N   +N +   +Y++   A++VN   A+ ++N+G+  + + + +DAL  + +A K +P  + ++IN+   LV+     +A  A+  AL              +++P    V  +L NLL K   RL EA     +AI  +P F  A+ N G +    G    A + +  A+   PN  D + NLG V  E +  D A+S +  +L L  +H     +LA  Y E +   + A   Y   I  +  F    C+ A A+ E    +   AE+ Y+ +L+  PT   S  NLA +   E  K ++A  L  + LE YP     H  L  IL    + L  A L++++A  + P  A A  N+   + E      A +C   A++++P
Sbjct:  167 AINFQTKNLEKSMQYSML--AIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNAL--------------QINPDLYCVRSDLGNLL-KAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYE-QGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKG--SVVEAEQMYMKALELCPTHADSQNNLANI-KREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGK-LNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINP 530          

HSP 2 Score: 68.9366 bits (167), Expect = 1.281e-11
Identity = 76/334 (22.75%), Postives = 138/334 (41.32%), Query Frame = 1
Query: 1282 TLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQ-------------AYTTRVSPKDLNVFINL----SNL--LIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLA-------SFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLL 2205
            + ++ AL ++ N+A +  N+      +   + A+  +  A   QP+   ++ N+   L      +EAE+ +  AL   P     Q                TR+  K L ++       SNL  +++ + +L +A  + + AI + P F DAY N G+ L ++G S  A   Y  A+Q  P  AD H NL  ++ +     EA+  + T+L+L      A  +LA        +   DK  R+  + +   L K    S   H ++    +      +A KH   SL +D      L    L++ +     +   + +  +  ++ NH   HL+
Sbjct:  350 SAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVEDQLCKKRLPSVHPHHSMLYPLSHAARIAIAAKHA--SLCFDKVHVQMLGKTPLIHADRFSVQNGQRLRIGYVSSDFGNHPTSHLM 681          

HSP 3 Score: 58.5362 bits (140), Expect = 1.885e-8
Identity = 70/298 (23.49%), Postives = 121/298 (40.60%), Query Frame = 1
Query: 1549 RVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDL-PAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            +V+ +    + NL N   K K +L +A    + A+ ++P+F+DAY N    L+  G  E+A   Y  ALQ  P+   +  +LG +   + R +EA  C+  +++       A  +L   ++   E                                     LA  H+  ++  DP    +  NL  +   E + FD A+    R L    NH   H  L  +   Y++ L   A   ++KA +L+P    A  NL   + E+  +VEAE    +A++L P     + +L  ++   G
Sbjct:  187 KVNNQCAEAYSNLGNYY-KEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGE-----------------------------------IWLAIHHFEKAVTLDPNFLDAYINLGNVLK-EARIFDRAVSAYLRALNLSGNHAVVHGNLACVY--YEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQG 445          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 100.523 bits (249), Expect = 2.192e-21
Identity = 105/386 (27.20%), Postives = 177/386 (45.85%), Query Frame = 1
Query: 1237 TMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLI--KAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSP 2388
             +N   +N +   +Y++   A++VN   A+ ++N+G+  + + + +DAL  + +A K +P  + ++IN+   LV+     +A  A+  AL              +++P    V  +L NLL K   RL EA     +AI  +P F  A+ N G +    G    A + +  A+   PN  D + NLG V  E +  D A+S +  +L L  +H     +LA  Y E +   + A   Y   I  +  F    C+ A A+ E    +   AE+ Y+ +L+  PT   S  NLA +   E  K ++A  L  + LE YP     H  L  IL    + L  A L++++A  + P  A A  N+   + E      A +C   A++++P
Sbjct:  167 AINFQTKNLEKSMQYSML--AIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNAL--------------QINPDLYCVRSDLGNLL-KAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYE-QGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKG--SVVEAEQMYMKALELCPTHADSQNNLANI-KREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGK-LNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINP 530          

HSP 2 Score: 68.9366 bits (167), Expect = 1.281e-11
Identity = 76/334 (22.75%), Postives = 138/334 (41.32%), Query Frame = 1
Query: 1282 TLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQ-------------AYTTRVSPKDLNVFINL----SNL--LIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLA-------SFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLL 2205
            + ++ AL ++ N+A +  N+      +   + A+  +  A   QP+   ++ N+   L      +EAE+ +  AL   P     Q                TR+  K L ++       SNL  +++ + +L +A  + + AI + P F DAY N G+ L ++G S  A   Y  A+Q  P  AD H NL  ++ +     EA+  + T+L+L      A  +LA        +   DK  R+  + +   L K    S   H ++    +      +A KH   SL +D      L    L++ +     +   + +  +  ++ NH   HL+
Sbjct:  350 SAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVEDQLCKKRLPSVHPHHSMLYPLSHAARIAIAAKHA--SLCFDKVHVQMLGKTPLIHADRFSVQNGQRLRIGYVSSDFGNHPTSHLM 681          

HSP 3 Score: 58.5362 bits (140), Expect = 1.885e-8
Identity = 70/298 (23.49%), Postives = 121/298 (40.60%), Query Frame = 1
Query: 1549 RVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDL-PAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            +V+ +    + NL N   K K +L +A    + A+ ++P+F+DAY N    L+  G  E+A   Y  ALQ  P+   +  +LG +   + R +EA  C+  +++       A  +L   ++   E                                     LA  H+  ++  DP    +  NL  +   E + FD A+    R L    NH   H  L  +   Y++ L   A   ++KA +L+P    A  NL   + E+  +VEAE    +A++L P     + +L  ++   G
Sbjct:  187 KVNNQCAEAYSNLGNYY-KEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGE-----------------------------------IWLAIHHFEKAVTLDPNFLDAYINLGNVLK-EARIFDRAVSAYLRALNLSGNHAVVHGNLACVY--YEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQG 445          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 100.138 bits (248), Expect = 2.451e-21
Identity = 103/368 (27.99%), Postives = 169/368 (45.92%), Query Frame = 1
Query: 1291 MSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLI--KAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSP 2388
            M A++VN   A+ ++N+G+  + + + +DAL  + +A K +P  + ++IN+   LV+     +A  A+  AL              +++P    V  +L NLL K   RL EA     +AI  +P F  A+ N G +    G    A + +  A+   PN  D + NLG V  E +  D A+S +  +L L  +H     +LA  Y E +   + A   Y   I  +  F    C+ A A+ E    +   AE+ Y+ +L+  PT   S  NLA +   E  K ++A  L  + LE YP     H  L  IL    + L  A L++++A  + P  A A  N+   + E      A +C   A++++P
Sbjct:    5 MLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNAL--------------QINPDLYCVRSDLGNLL-KAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYE-QGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEK--GSVVEAEQMYMKALELCPTHADSQNNLANI-KREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGK-LNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINP 352          

HSP 2 Score: 69.707 bits (169), Expect = 6.145e-12
Identity = 76/334 (22.75%), Postives = 138/334 (41.32%), Query Frame = 1
Query: 1282 TLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQ-------------AYTTRVSPKDLNVFINL----SNL--LIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLA-------SFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLL 2205
            + ++ AL ++ N+A +  N+      +   + A+  +  A   QP+   ++ N+   L      +EAE+ +  AL   P     Q                TR+  K L ++       SNL  +++ + +L +A  + + AI + P F DAY N G+ L ++G S  A   Y  A+Q  P  AD H NL  ++ +     EA+  + T+L+L      A  +LA        +   DK  R+  + +   L K    S   H ++    +      +A KH   SL +D      L    L++ +     +   + +  +  ++ NH   HL+
Sbjct:  172 SAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVEDQLCKKRLPSVHPHHSMLYPLSHAARIAIAAKHA--SLCFDKVHVQMLGKTPLIHADRFSVQNGQRLRIGYVSSDFGNHPTSHLM 503          

HSP 3 Score: 60.4622 bits (145), Expect = 5.362e-9
Identity = 73/317 (23.03%), Postives = 133/317 (41.96%), Query Frame = 1
Query: 1288 FMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIK--AEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNN------ELKKFDEALVLLNRLLENYPNHVKGHLLLGD 2214
            ++ A++     A  W+N+G     + +   A+ +F  A    PN + ++IN+G  L   + F  A  A+  AL+               S     V  NL+ +  +     L  D Y ++AI ++P F DAY N  + L + G   EA   Y+ AL+  P  AD   NL  +  E  + ++A   +  +L++      A  +LAS   + + K  +A   Y + I+    F     +    + E  D +  +A   Y  +++ +P    +  NLA ++ +       ++ +  AL L     + Y N    H ++ D
Sbjct:  106 YLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNL--------------SGNHAVVHGNLACVYYEQGLIDLAIDTY-KKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQ-QGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIA--CYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICD 404          

HSP 4 Score: 59.3066 bits (142), Expect = 1.174e-8
Identity = 70/298 (23.49%), Postives = 121/298 (40.60%), Query Frame = 1
Query: 1549 RVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDL-PAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            +V+ +    + NL N   K K +L +A    + A+ ++P+F+DAY N    L+  G  E+A   Y  ALQ  P+   +  +LG +   + R +EA  C+  +++       A  +L   ++   E                                     LA  H+  ++  DP    +  NL  +   E + FD A+    R L    NH   H  L  +   Y++ L   A   ++KA +L+P    A  NL   + E+  +VEAE    +A++L P     + +L  ++   G
Sbjct:    9 KVNNQCAEAYSNLGNYY-KEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGE-----------------------------------IWLAIHHFEKAVTLDPNFLDAYINLGNVLK-EARIFDRAVSAYLRALNLSGNHAVVHGNLACVY--YEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQG 267          

HSP 5 Score: 58.5362 bits (140), Expect = 1.829e-8
Identity = 81/376 (21.54%), Postives = 150/376 (39.89%), Query Frame = 1
Query: 1264 DWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPN 2391
            D     T + +ALQ+N +   + +++G+ L+   + E+A   ++ A +TQP    +  N+G    +      A   F+ A++                P  L+ +INL N+L + +       AYL RA+++  +    + N   +  + G  + A + Y  A+  +P+  D + NL     E     EA   +  +L+L  +H  ++ +LA+   E + K E+A  +Y   ++   E    H  LA +         A  HY  +++  PT   +  N+     N LK+                                  D  AA   + +A ++ P  A A  NL  +  +   + EA    + A+KL P+
Sbjct:   64 DLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTL--------------DPNFLDAYINLGNVLKEARIFDRAVSAYL-RALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKRE-QGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMG----NTLKEMG--------------------------------DSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPD 387          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Fly
Match: Tmtc3 (gene:FBgn0020312 transcript:FBtr0071638)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 371/843 (44.01%), Postives = 519/843 (61.57%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHS---------------------FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXX--XXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTR---------SGI-------------IFMGAAL-LMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKS---SETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQ-KFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSE--DKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            Y+NS  CG VFDD++AI+DNKDLRP TP   +F NDFWGTP+R+E+SHKSYRPLTVLTFR+NY L  L P GYH +N++LH  V +L+ ++C +      +                     F++++LFAVHP+HTEAVTGVVGRAELLSS+ FL + L Y   V       +     L       +    LCKEQ IT  G+C+  E + + +L  +H  +   + F   T          SGI               +G  L L+  R+ + G  +P FT FDNPA+ +  P RQLT+ YL  +N  LL CP  LCCDWTMGT+ L+   TD R + TL T+  +G +   V K   T++   S TL M L  MVL FLPASNLF  VGFVVAER+LY PS+G+CL++    ++  +     +Q+    +  +LLL+H + T+ RN DWR EY+LFMS + VNQ NAKL+NNVGH+LE+E KFE+AL YF  A + Q +D+G+HINVGRT  NL+R+ EAE+A+  A +  PQ K G +Y  R++P  LNVFINL+NL+ KN+TRL EAD   R+AISMR D+V AY NRGDIL+KL R+ +A+  Y  AL Y   +AD++YNLGVV +E  ++ +A   F+ +++L   H+ A L+ A    E   +E R  ++S  Y +++ + ++EK +F L M+  D+ +F  AE+ +  ++      R +LFNLALL  +  +  D A+  LN+L+ ++P+HVKG +LLGDI +N+ +DL  A   ++     +P N Q  HNLCVV VE+ +L +A +CL  A +L+P E+YI +HL IV  RL
Sbjct:   48 YYNSTQCGLVFDDISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGYHLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHPVHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLCKEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTLWKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLLCPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAM---VAKTCFTRNLALSRTLIMCLGWMVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAILLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLD-AVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQGLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARL 886          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Fly
Match: Tmtc3 (gene:FBgn0020312 transcript:FBtr0071637)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 371/843 (44.01%), Postives = 519/843 (61.57%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHS---------------------FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXX--XXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTR---------SGI-------------IFMGAAL-LMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKS---SETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQ-KFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSE--DKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            Y+NS  CG VFDD++AI+DNKDLRP TP   +F NDFWGTP+R+E+SHKSYRPLTVLTFR+NY L  L P GYH +N++LH  V +L+ ++C +      +                     F++++LFAVHP+HTEAVTGVVGRAELLSS+ FL + L Y   V       +     L       +    LCKEQ IT  G+C+  E + + +L  +H  +   + F   T          SGI               +G  L L+  R+ + G  +P FT FDNPA+ +  P RQLT+ YL  +N  LL CP  LCCDWTMGT+ L+   TD R + TL T+  +G +   V K   T++   S TL M L  MVL FLPASNLF  VGFVVAER+LY PS+G+CL++    ++  +     +Q+    +  +LLL+H + T+ RN DWR EY+LFMS + VNQ NAKL+NNVGH+LE+E KFE+AL YF  A + Q +D+G+HINVGRT  NL+R+ EAE+A+  A +  PQ K G +Y  R++P  LNVFINL+NL+ KN+TRL EAD   R+AISMR D+V AY NRGDIL+KL R+ +A+  Y  AL Y   +AD++YNLGVV +E  ++ +A   F+ +++L   H+ A L+ A    E   +E R  ++S  Y +++ + ++EK +F L M+  D+ +F  AE+ +  ++      R +LFNLALL  +  +  D A+  LN+L+ ++P+HVKG +LLGDI +N+ +DL  A   ++     +P N Q  HNLCVV VE+ +L +A +CL  A +L+P E+YI +HL IV  RL
Sbjct:   48 YYNSTQCGLVFDDISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGYHLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHPVHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLCKEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTLWKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLLCPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAM---VAKTCFTRNLALSRTLIMCLGWMVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAILLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLD-AVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQGLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARL 886          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Fly
Match: CG31690 (gene:FBgn0051690 transcript:FBtr0301682)

HSP 1 Score: 243.047 bits (619), Expect = 3.709e-68
Identity = 248/877 (28.28%), Postives = 372/877 (42.42%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSA-ILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITAL---GVCIGLEAYHLVKLWKMHNVNIDKKY---FVRYTRSGIIFMGAALL--MFLRLKINGKYMPFFTDFDNPAAH-SPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY----------------------AFIGLLSIIVIKRIETKSSETL--------------------------------------AMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLW---LQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRG-------DILLKL-------GRSEEARNQYITALQYRP-----NSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIK-AEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHL 2415
            Y N+L+ GFV+DD  AI  N D+    P + L  NDFWGTP+    SH S+RPL VL+FR NY  G + P GYH +NV+LH +   L F +           L+A  LFAVHP HTEAV G+VGRA+L S V +LL+ L Y      ++   ++   ++L ++L     LCKE  ITAL   G+C  L         K+ + +I       F R  RS +  +G  LL  ++ RL +  +    F+  DNP AH S F  R LTF YL   N  +L  P +L  DW M  +S + ++ D R + T   Y                      A +  +S+ +++R+   S  T                                        +    +VL FLPASNL   VGFV+AERVLY PS+G+CL+ GL    L + +    + +  +     +LL  H + T+ RN DWR+E  LF SA+ +N   A    N+G  L  + ++E+A     +    +P    +H N+G        F  A   F+ A+   PQ                  ++NL   LI       EA + LR    +    V   ++RG          L+L       GR ++A      +L+  P       A LH  LG +  EL+  +EA      ++QL      A ++     + +  +  EA+S +   ++ A  E    H     +E  +++ + A    L +    P            Y  +     +AL LLNRL E                         A L ++KA  L+P  A A  NL  ++  +    EA +C  +A++L P     + +L
Sbjct:   34 YLNTLNAGFVYDDRRAILANGDVTGARPLANLLRNDFWGTPLVDSGSHGSWRPLCVLSFRLNYLAGGMTPLGYHLVNVMLHCVATWLVFLVARTLLPSRMGVLAAGALFAVHPAHTEAVAGLVGRADLASCVCYLLAYLSY-----RRHMLNREWGSLILTIMLALAALLCKETAITALLLCGLCDVLSPVGRENSDKVCDGSISGLASFNFQRRFRS-LSILGFTLLCGLYCRLSLLPRPSTAFSAADNPTAHESCFWTRTLTFLYLPVANFGILLWPQELSFDWGMEAVSRIRTLWDARNILTAGFYGSLVAILWKGSGLRSAASPMDFAEVANISLPLLRRLGGNSCHTWLGLTCDCHHQLSAPSYRSASAIYSTSSKSKSASWTAAPILGTAFLVLPFLPASNLLFYVGFVMAERVLYLPSVGYCLLFGLGFGHLWQRVNSSWRSRLMLLCGLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINPPKAL--GNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAV--------------AYLNLGTSLISLGDHRQEAISVLRTGARLEGSGV---RDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHE-ALGLRLRAAALAPQD----------YTLQ-SCVADALRLLNRLAE-------------------------AELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAISRANL 848          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Fly
Match: CG5038 (gene:FBgn0038324 transcript:FBtr0083089)

HSP 1 Score: 230.335 bits (586), Expect = 1.640e-64
Identity = 208/703 (29.59%), Postives = 337/703 (47.94%), Query Frame = 1
Query:   88 FVFDDVTAIKDNKDLRP-ETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLC-TIYFDIIHS----FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIF--MGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLM--IGL--WLQKSIK--HFQKFQKCIYGSFVVLLLSHTM-NTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEAL 2148
            FVFDD  AI  N+D+    T ++ +F +DFWG  +    SHKS+RPLT L F   Y L  L+ A    +N++LH +  +L ++L  ++Y   + +     LSA LFA HPIHTEAV+GVVGRAEL+  +  LL LL+ +            ++ +L  + ++      KE  +T    C+ L+ +        +++    ++ +  TR   +F  +G   L+  RL       P F + DNP AH+   + R L+  YL  +N+ L+ CP  LC DW +G + LVT+I D+R+         IG  SI+++  +  +    + ++L +M++ FLPAS + I VGFV+AER LY PS+GFCL+   G   W   S +  H++   + +    ++LL S  M  T  R  DW NE  LF SALQV  +NAK+                                  H N+ R   ++    +A + +  A+   P  +              +  +NL NL  +   +L  A+ Y+R A+   P F  A+ N G +    G+ ++A   Y  AL+YR N A  +YN+G + +E KR  EAL  +  ++ L+     A  ++ +   ++K  +++A  I    ++         F  A +    K++  AE  Y   ++ +P +     NL +LY +   K  EA+
Sbjct:   37 FVFDDTVAIVKNRDVNSLPTNWTAIFTHDFWGASLLSSDSHKSFRPLTTLMFHCEYALLGLSAAHMKFLNLLLHCVNTLLMWRLIRSLYVPEVSTARWAILSAALFAAHPIHTEAVSGVVGRAELMFGMIHLLCLLLTVANTGRLGPQTGGLIMLLTAVGMLF-----KESAVTIPMSCVLLDYFQN----GYYHLRFKDQWSLLRTRISYLFYLLGTLGLLTARLWWQDFETPTFKEVDNPVAHNEHVLTRGLSQQYLLVMNIWLMLCPHWLCYDWALGCVKLVTNIWDLRL------QGVIGFYSIVLVALMNFRRLPGMMLALGLMIVPFLPASGI-ICVGFVIAERTLYVPSIGFCLLSIYGFLYWYDSSTENTHWRTALRIL----LMLLFSVMMVRTRQRATDWLNEEQLFKSALQVCPDNAKV----------------------------------HYNIARLATDMGNNTKAFQHYHRAIELYPNYE--------------SALMNLGNL-YREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTML-DNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLY-HRWDKTQEAI 668          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Fly
Match: CG4341 (gene:FBgn0028481 transcript:FBtr0077949)

HSP 1 Score: 176.407 bits (446), Expect = 3.117e-45
Identity = 125/325 (38.46%), Postives = 175/325 (53.85%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSA-ILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYS-NIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLM-FLRLKINGKYMPFFTDFDNPAAHSPFP-IRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSET 1023
            Y N+L  GFV+DD  AI  N D+   TP+   F NDFWGTP+    SH S+RPL VL+FR NY + G   P G+H +N +LH +   L  ++       + + L+A  LFA HPIHTEAV GVVGRA+L + V +LL+ L Y+  ++ + S + +  L +   L+L + G LCKE  ITAL VC       L  + +  +  +DK+      RS  I +GA   M + RL I       F+  DNP A +P    R LTF YL   NLRLL  P  L  DW M  +  VTS+ D R   + C Y+ +  ++    +++ + S E 
Sbjct:   46 YLNTLGAGFVYDDRRAILANADVSGGTPWQRSFSNDFWGTPLTDSGSHGSWRPLCVLSFRLNYLIGGGFAPWGFHLVNNLLHCVATALVVRVARTLLASVWAVLAAGALFAAHPIHTEAVAGVVGRADLAACVCYLLTYLSYLRHMRWRESGDPRQWLALGATLILAAAGLLCKETAITALLVCA------LFDVMRGLSGQVDKQRL----RSVCIVLGALFCMAYCRLVIVPGPQTAFSSADNPIARTPSAWTRLLTFLYLPVFNLRLLLQPNVLSFDWGMDALPRVTSLWDRRNAQSACFYSVLVGVAWGSCRQLLSGSKEV 360          

HSP 2 Score: 129.028 bits (323), Expect = 3.555e-30
Identity = 109/352 (30.97%), Postives = 167/352 (47.44%), Query Frame = 1
Query: 1021 TLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQ---------------PKKGQAYTTRVSPKDLN----------------VFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDA----YQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN----DEALSCFHTSLQLDRSHKPARLSLASFYSE--DKEKREEAKSIYY 1953
             L MSL  + L FLPASNL   VGFVVAER+LY PS+GFCL++G  + K +   Q+ +  +  SF +LL + ++ T  RN DWR+E +L+ SA+ +N   A    N+G  L  + ++E+A +    A + +PN    H N+G    N Q +  A E F+ A+ F P                 K+ QA     +  +L+                 ++ L  L ++ + +L  A A  R A+S  P         YQ  GD+L +L + +EA   +  AL+ +PN    H + G   I L RN     EA   F  +L+L     P + S+   Y+E    + R    +IY+
Sbjct:  504 VLIMSLSFLALPFLPASNLLFYVGFVVAERLLYLPSVGFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAINPPKAL--GNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVE-QGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYG---ITLARNSSRASEAEMWFKRALKL----APEQASVYHHYAEFLSLQSRHHESAIYH 845          

HSP 3 Score: 77.0258 bits (188), Expect = 4.796e-14
Identity = 73/264 (27.65%), Postives = 114/264 (43.18%), Query Frame = 1
Query: 1642 RRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLA-SFYSEDKEKRE-EAKSIYYDLIKAEFESEKCH--------FALAMMETDDKNFQLAEKHY---LHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNE 2394
            R AI++ P    A  N G +L   GR EEA+     A+++RPN AD+H+NLG+++   +    A+ CF  +++   +   A L+L  SF +  K ++  E      +L  A       H          L  +  +    Q A   Y   L SL   P  R  L+         L+++DEA       LE  PN V  HL  G  L         A + F++A +L P+ A   H+    +  QS+  E+      A +L+PN+
Sbjct:  594 RSAIAINPP--KALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPND 855          

HSP 4 Score: 68.5514 bits (166), Expect = 2.032e-11
Identity = 54/190 (28.42%), Postives = 88/190 (46.32%), Query Frame = 1
Query: 1312 QNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLV-NLQRFLEAEEAFKVALSFMPQPK-----------------KGQAYTTR---VSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYN---LGVVNI 1809
            Q    L+  +G  L   +++++A R+   A + QPN V +H++ G TL  N  R  EAE  FK AL   P+                   +   Y  R   ++P D  + +  +  + +   R ++A+ + R+A+++RP    A+ N G IL  LGR+  A   Y  AL+ +P  A    N   LGV N+
Sbjct:  750 QQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPNDYTLVVAAATAM-RLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRTNHAAASYKAALRLQPGDAITLGNLAKLGVTNV 938          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Zebrafish
Match: tmtc3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:ZFIN;Acc:ZDB-GENE-061221-2])

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 390/817 (47.74%), Postives = 523/817 (64.01%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSG-------------IIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMI--GLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFIP 2463
            Y+NSL CGFVFDDV+AI DNKDLRP TP   LF NDFWGTP+ +ERSHKSYRPLTVLTFR NY   ELN + YH +NV+LHA+V +LF   C +  D   S ++ +LFAVHPIHTEAVTGVVGRAELLSS+F L + L Y     + +S +     I+  + LV++ TLCKEQ IT +G+C   E +  V       + ID    V   + G             ++ +   LL+ +R+++    +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI LV S+ D R + TL  Y F+GLL+   +      SS+ + M+L ++VL F+PASNLF  VGFVVAERVLY PS+GFC+++  G  L       +K    + G   +LL +H + T+ RN+DW +EYTLF SAL+VN+NNAKLWNNVGH+LE++  +E ALRYF+ A++ QP+D+G+H+NVGRT  NL R  EAEEA+ +A S MPQ   G+ Y TRV+P  LNV+INL+NL+  N +RL EAD   R+AISMRPDF  AY +RG++LLK+ +  EA++ Y+ AL+    +ADL YNL +VNIE+K   EAL  F+ +L L+  HK A  + A    E  E   R EA   +   +K E +    +F L M+  D    + AE     ++   P  R +LFNLALLY+   ++ D AL +L  LL  +P HVKG +L GDIL+N+++D   A   F++   ++P N QAKHNLCVV  E+ +L  AE CL + + ++P E YI++HL IVRN++   ++   P
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLRPTTPLKNLFLNDFWGTPMSEERSHKSYRPLTVLTFRLNYLFSELNSSSYHLLNVVLHAVVCVLFLHFCRLLLDRSTSLIATLLFAVHPIHTEAVTGVVGRAELLSSIFLLAAFLAYTKSKGTDHSIV--WTPIISTVFLVAVATLCKEQGITVIGICCIYEVF--VAQGFTLPMLIDTLLQVLRGKDGFPYAVLQTLLKLIVLIISTLLLVIIRVQVIQSQLPVFTRFDNPAAVSSTPSRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLVESLLDSRNLATLVFYTFLGLLAYHGL-WYNHSSSKIIMMALSLIVLPFIPASNLFFPVGFVVAERVLYVPSMGFCVLVAYGFKLLSQKGGLKKMSWLLMG---ILLTTHAVKTFNRNWDWESEYTLFTSALKVNRNNAKLWNNVGHALENQNSYERALRYFLQATRVQPDDIGAHMNVGRTYKNLNRSREAEEAYLIAKSLMPQIIPGKKYATRVAPNHLNVYINLANLIRANDSRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPSEAKDAYLRALELDHTNADLWYNLAIVNIEMKDPSEALRNFNRALDLNPRHKLALFNSALLMQESGEAKLRPEANRRFLTYVKEEPDDANGYFNLGMLAMDANENEEAEHWMREAIHLQPGFRSALFNLALLYSQSQRELD-ALPVLEELLRYHPEHVKGLILKGDILMNHRKDTRGAKTCFERILSMDPSNVQAKHNLCVVYFEERELQRAERCLVDTLAMAPQEEYIRRHLAIVRNKMAAMSAAGQP 827          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Zebrafish
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:ZFIN;Acc:ZDB-GENE-070912-148])

HSP 1 Score: 330.872 bits (847), Expect = 3.516e-101
Identity = 246/715 (34.41%), Postives = 375/715 (52.45%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFD--------------IIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGI--------------IFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSP-FPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIV-PTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            + NS D  FVFDD  AI +NKDL P+TP S ++ NDFWG+ +    SHKSYRPLTVLTFR NY L G L+P G+H +NV LH ++ +L   +  I                    SFL+A+ FA HP+HTE+V G+VGRA+LL ++FF LS L+Y    +        +L I   ++L ++  LCKEQ ITALGV     AY ++ +  ++   +  +   R   + I              +F+G +LLM+ R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG + L++S  D RIV P +  +  IGL+S  +  + ++    TL   L+++V+ FLPASN+F  VGFV+AERVLY  S G+CL++   +     H++K ++ +  + + LL  +   +  R+  WR+E +LF SAL V   NAK+  NVG +L        A++Y+  A +  P  V +  N+G  L       EAEE    A+    QP    A+        +N+ I  ++L   NK     A+     AI  R  + D Y N G +   L RS +A N +  A   +P+ + L +N  V+ ++   N  +A      +L++         SLA+   + +EK +E++  + + +K       CH  LA++        LA++HY  SL+ DP++ G+  N  +L
Sbjct:   34 FINSYDGDFVFDDSEAIINNKDLNPDTPLSNIWKNDFWGSNLSSNSSHKSYRPLTVLTFRINYLLAGGLHPVGFHVLNVALHCVISVLMIDVFAILIGGPVQDGKGAKLSLPPKASFLAALFFAAHPVHTESVAGIVGRADLLCALFFQLSFLVYCKAFQVGGDKKFSVLWIFGSILLCAVAMLCKEQGITALGVN---AAYDILMVCNLNIYELAHRLLSRRKSADIGGLPRNGLLMRLALLFLGGSLLMYTRWKIMGTGPPSFTEVDNPASFAENIILRIVNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLISSAADWRIVWPAVLWFCLIGLVSQALFSQ-DSNKRRTLTFGLVLLVIPFLPASNVFFRVGFVIAERVLYLSSAGYCLILAYAVGYCSCHWRKHKRLLRAATLTLLCVNVTRSAQRSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNQSAAVQYYREAVRLHPKYVHAMNNLGNILKERNELKEAEELLSAAVHI--QPDFAAAW--------MNLGIVQNSLKKFNK-----AEQSYWNAIRFRKKYPDCYYNLGRLYADLNRSIDALNAWRNATMLKPDHS-LAWNNMVILLDNTGNLAQAELIGKEALKILPKDHTIMFSLANVLGK-QEKYKESEGFFLNALKINPNVASCHGNLAVLYHRWGKLDLAKRHYELSLRLDPSAPGTKENYNML 727          

HSP 2 Score: 55.4546 bits (132), Expect = 2.657e-7
Identity = 53/244 (21.72%), Postives = 113/244 (46.31%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            RS++ R++   + +AL   P +A +HYN+G    +      A+  +  +++L   +  A  +L +   E  E +E A+ +    +  + +       L +++   K F  AE+ Y +++++        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A L  ++A ++ PK+     +L  V+ +Q K  E+E     A+K++PN      +L ++ +R G
Sbjct:  458 RSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNQSAAVQYYREAVRLHPKYVHAMNNLGNILKERNELKE-AEELLSAAVHIQPDFAAAWMNLGIVQNSLKKFNKAEQSYWNAIRFRKKYPDCYYNLGRLYADLNRSIDALNAWRNATMLKPDHSLAWNNMV--ILLDNTGNLAQAELIGKEALKILPKDHTIMFSLANVLGKQEKYKESEGFFLNALKINPNVASCHGNLAVLYHRWG 698          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Zebrafish
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:ZFIN;Acc:ZDB-GENE-070912-148])

HSP 1 Score: 330.872 bits (847), Expect = 3.516e-101
Identity = 246/715 (34.41%), Postives = 375/715 (52.45%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFD--------------IIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGI--------------IFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSP-FPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIV-PTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            + NS D  FVFDD  AI +NKDL P+TP S ++ NDFWG+ +    SHKSYRPLTVLTFR NY L G L+P G+H +NV LH ++ +L   +  I                    SFL+A+ FA HP+HTE+V G+VGRA+LL ++FF LS L+Y    +        +L I   ++L ++  LCKEQ ITALGV     AY ++ +  ++   +  +   R   + I              +F+G +LLM+ R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG + L++S  D RIV P +  +  IGL+S  +  + ++    TL   L+++V+ FLPASN+F  VGFV+AERVLY  S G+CL++   +     H++K ++ +  + + LL  +   +  R+  WR+E +LF SAL V   NAK+  NVG +L        A++Y+  A +  P  V +  N+G  L       EAEE    A+    QP    A+        +N+ I  ++L   NK     A+     AI  R  + D Y N G +   L RS +A N +  A   +P+ + L +N  V+ ++   N  +A      +L++         SLA+   + +EK +E++  + + +K       CH  LA++        LA++HY  SL+ DP++ G+  N  +L
Sbjct:   34 FINSYDGDFVFDDSEAIINNKDLNPDTPLSNIWKNDFWGSNLSSNSSHKSYRPLTVLTFRINYLLAGGLHPVGFHVLNVALHCVISVLMIDVFAILIGGPVQDGKGAKLSLPPKASFLAALFFAAHPVHTESVAGIVGRADLLCALFFQLSFLVYCKAFQVGGDKKFSVLWIFGSILLCAVAMLCKEQGITALGVN---AAYDILMVCNLNIYELAHRLLSRRKSADIGGLPRNGLLMRLALLFLGGSLLMYTRWKIMGTGPPSFTEVDNPASFAENIILRIVNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLISSAADWRIVWPAVLWFCLIGLVSQALFSQ-DSNKRRTLTFGLVLLVIPFLPASNVFFRVGFVIAERVLYLSSAGYCLILAYAVGYCSCHWRKHKRLLRAATLTLLCVNVTRSAQRSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNQSAAVQYYREAVRLHPKYVHAMNNLGNILKERNELKEAEELLSAAVHI--QPDFAAAW--------MNLGIVQNSLKKFNK-----AEQSYWNAIRFRKKYPDCYYNLGRLYADLNRSIDALNAWRNATMLKPDHS-LAWNNMVILLDNTGNLAQAELIGKEALKILPKDHTIMFSLANVLGK-QEKYKESEGFFLNALKINPNVASCHGNLAVLYHRWGKLDLAKRHYELSLRLDPSAPGTKENYNML 727          

HSP 2 Score: 55.4546 bits (132), Expect = 2.657e-7
Identity = 53/244 (21.72%), Postives = 113/244 (46.31%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            RS++ R++   + +AL   P +A +HYN+G    +      A+  +  +++L   +  A  +L +   E  E +E A+ +    +  + +       L +++   K F  AE+ Y +++++        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A L  ++A ++ PK+     +L  V+ +Q K  E+E     A+K++PN      +L ++ +R G
Sbjct:  458 RSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNQSAAVQYYREAVRLHPKYVHAMNNLGNILKERNELKE-AEELLSAAVHIQPDFAAAWMNLGIVQNSLKKFNKAEQSYWNAIRFRKKYPDCYYNLGRLYADLNRSIDALNAWRNATMLKPDHSLAWNNMV--ILLDNTGNLAQAELIGKEALKILPKDHTIMFSLANVLGKQEKYKESEGFFLNALKINPNVASCHGNLAVLYHRWG 698          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Zebrafish
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:ZFIN;Acc:ZDB-GENE-070912-148])

HSP 1 Score: 330.872 bits (847), Expect = 3.516e-101
Identity = 246/715 (34.41%), Postives = 375/715 (52.45%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFD--------------IIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGI--------------IFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSP-FPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIV-PTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            + NS D  FVFDD  AI +NKDL P+TP S ++ NDFWG+ +    SHKSYRPLTVLTFR NY L G L+P G+H +NV LH ++ +L   +  I                    SFL+A+ FA HP+HTE+V G+VGRA+LL ++FF LS L+Y    +        +L I   ++L ++  LCKEQ ITALGV     AY ++ +  ++   +  +   R   + I              +F+G +LLM+ R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG + L++S  D RIV P +  +  IGL+S  +  + ++    TL   L+++V+ FLPASN+F  VGFV+AERVLY  S G+CL++   +     H++K ++ +  + + LL  +   +  R+  WR+E +LF SAL V   NAK+  NVG +L        A++Y+  A +  P  V +  N+G  L       EAEE    A+    QP    A+        +N+ I  ++L   NK     A+     AI  R  + D Y N G +   L RS +A N +  A   +P+ + L +N  V+ ++   N  +A      +L++         SLA+   + +EK +E++  + + +K       CH  LA++        LA++HY  SL+ DP++ G+  N  +L
Sbjct:   34 FINSYDGDFVFDDSEAIINNKDLNPDTPLSNIWKNDFWGSNLSSNSSHKSYRPLTVLTFRINYLLAGGLHPVGFHVLNVALHCVISVLMIDVFAILIGGPVQDGKGAKLSLPPKASFLAALFFAAHPVHTESVAGIVGRADLLCALFFQLSFLVYCKAFQVGGDKKFSVLWIFGSILLCAVAMLCKEQGITALGVN---AAYDILMVCNLNIYELAHRLLSRRKSADIGGLPRNGLLMRLALLFLGGSLLMYTRWKIMGTGPPSFTEVDNPASFAENIILRIVNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLISSAADWRIVWPAVLWFCLIGLVSQALFSQ-DSNKRRTLTFGLVLLVIPFLPASNVFFRVGFVIAERVLYLSSAGYCLILAYAVGYCSCHWRKHKRLLRAATLTLLCVNVTRSAQRSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNQSAAVQYYREAVRLHPKYVHAMNNLGNILKERNELKEAEELLSAAVHI--QPDFAAAW--------MNLGIVQNSLKKFNK-----AEQSYWNAIRFRKKYPDCYYNLGRLYADLNRSIDALNAWRNATMLKPDHS-LAWNNMVILLDNTGNLAQAELIGKEALKILPKDHTIMFSLANVLGK-QEKYKESEGFFLNALKINPNVASCHGNLAVLYHRWGKLDLAKRHYELSLRLDPSAPGTKENYNML 727          

HSP 2 Score: 55.4546 bits (132), Expect = 2.657e-7
Identity = 53/244 (21.72%), Postives = 113/244 (46.31%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            RS++ R++   + +AL   P +A +HYN+G    +      A+  +  +++L   +  A  +L +   E  E +E A+ +    +  + +       L +++   K F  AE+ Y +++++        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A L  ++A ++ PK+     +L  V+ +Q K  E+E     A+K++PN      +L ++ +R G
Sbjct:  458 RSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNQSAAVQYYREAVRLHPKYVHAMNNLGNILKERNELKE-AEELLSAAVHIQPDFAAAWMNLGIVQNSLKKFNKAEQSYWNAIRFRKKYPDCYYNLGRLYADLNRSIDALNAWRNATMLKPDHSLAWNNMV--ILLDNTGNLAQAELIGKEALKILPKDHTIMFSLANVLGKQEKYKESEGFFLNALKINPNVASCHGNLAVLYHRWG 698          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Zebrafish
Match: tmtc1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:ZFIN;Acc:ZDB-GENE-070705-219])

HSP 1 Score: 320.857 bits (821), Expect = 3.660e-96
Identity = 256/838 (30.55%), Postives = 414/838 (49.40%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLC--TIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK-----SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLE---------AYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKF-QKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFY---SEDKE-----------------------------KREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNH----VKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHL 2415
            Y NSL   FV DD+ AI +N D++P +   ++F NDFWG  +    SHKSYRPL +LTF+ N  LG L P  +H +NV LH +V  L    C   ++ D   SFL+A+LF+VHPIHTEAV+G+VGRA++L+S+ FLL+ L YI  V       ++     +  + L L+L +   L KE  +T  GVC+  +           HL +  ++  +      FV+  R+ ++ +   ++M +RL + G  MP F++ DNPA+ SP+ + R LT+ YL + N  LL  P+ LC DW +G+I LV S+ D R + +L     +  LS+  +  ++    + + + LL +V  F+PASNLF  VGFVVAERVLY PS+G+C+++   L +      ++    +  S +V+LL  +  T  +N  W +   LF S +Q   +NAK+  N  + L+ + + ++A+ ++  A +  P    +  N+G TL +     EAE  ++ AL   PQ  +                 NL NLL K++ +  EA+  L+ +I   P F DAY +   +    G S+EA   Y   ++  P S+DLH N GV  ++  R D A   +  +++L  +H  A ++L       +++KE                             + EEA  +Y +    + +S     ALA +         AEK  L  +            L+ +Y+ +     EAL  L   L+   +      + H  +G+ L     +L  AF +++ A EL+P+ +QA  N+  +   +     A      A+ LSP+   +K++L
Sbjct:   45 YSNSLWGEFVHDDIWAITNNPDVKPGSSLRSIFTNDFWGKRMADNTSHKSYRPLCILTFKLNILLGGLTPFFFHLVNVFLHCVVTALLMYTCQQCVFEDSNFSFLTALLFSVHPIHTEAVSGIVGRADVLASMLFLLAFLSYIRSVSPIRSADEFPPTVCVWSLALSLLLGTCAMLVKETGVTVFGVCVLYDFLVLCRKPLILHLSRS-RLKELGRISSPFVK--RACVVSLHVTVIMSVRLWLMGGSMPLFSEQDNPASFSPYLLTRFLTYCYLLAFNAWLLLAPIMLCYDWQVGSIPLVESLWDGRNIASLTLALVMLALSLNCVTCLQKMKGKEVLVGLLFLVFPFIPASNLFFRVGFVVAERVLYMPSMGYCILVVHGLNRLYSVVSRWGAAALTVSMLVVLLLFSWKTVQQNEIWLSREALFRSGIQTLPHNAKVHYNYANFLKDKGRNQEAIYHYKTALRLYPRHASALNNLG-TLTHQAE--EAEVYYRRALDINPQHNRA--------------LFNLGNLL-KSQGKEEEAERMLKESIRFGPHFADAYSSLASLYADQGHSKEANEIYTKGIENCPESSDLHNNYGVFLVDTGRGDRAAFHYQEAVRLKPAHYVAMVNLGRLLRSSNDNKEAELWYKRALQVVRKVDILTPLGALYYNTGRYEEALEVYREASTLQPDSTDIWLALAQVLAMAGRSTEAEKMTLGIISKTSNCIECYRLLSAIYSKQ-GNHTEALDALKTALQQESSEPAVRAELHFSMGNQLREMN-ELDRAFQSYKLAVELKPEQSQAWMNMGGIQHIKGDYAAARMYYQRALLLSPDSKLLKENL 859          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Xenopus
Match: ENSXETT00000045155.1 (transmembrane and tetratricopeptide repeat containing 3 [Source:NCBI gene;Acc:100145573])

HSP 1 Score: 502.286 bits (1292), Expect = 1.511e-166
Identity = 271/562 (48.22%), Postives = 368/562 (65.48%), Query Frame = 1
Query:  760 MPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIG-LWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ SI D+R + TL  Y  +    I+   R    SS+T+ M+L +++L F+PASNLF  VGFVVAERVLY PS+GFC+++   W + S     +    I+ + VV   +H + T+ RN+DW +EYTLF SAL+VN+NNAKLWNNVGH+LE+EK +E ALR+F  A++ QP+D+G+H+NVGRT  NL R  EAEE++ +A + MPQ   G+ Y  RV+P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  EAR  YI AL+    +ADL YNL +V IELK   EAL  F+ +L+L+  HK A  + A    E      R EAK      ++ E      +F L M+  D+K    AE     +++     R +LFNLALLY+   ++  EAL +L+ LL  YP+H KG +L GDIL+N K+D+  A   F+K  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HL+IVR ++
Sbjct:   98 LPVFTRFDNPAAVSTTPARQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESILDIRNLATLLFYFLL-GYLIVFSVRYSGDSSKTVLMALCLIILPFIPASNLFFPVGFVVAERVLYVPSMGFCMLVAHGWKKLSSNGRLRTLSWIFLALVVF--THAIKTFNRNWDWESEYTLFTSALKVNKNNAKLWNNVGHALENEKNYERALRFFKKATEVQPDDIGAHMNVGRTYKNLNRSKEAEESYLIAKALMPQVIPGKKYAARVAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLEAREAYIKALELDRMNADLWYNLAIVYIELKDPSEALRNFNQALELNPRHKLALFNSALLMQESGSARLRPEAKRRLLTYVEEEPHDANGYFNLGMLAMDEKKDTEAEVWMKKAIQLHHGFRSALFNLALLYSQTSREL-EALPVLDELLRFYPDHSKGLILKGDILMNQKKDIKGAKKCFEKIVEMDPNNVQGKHNLCVVYFEERDLIKAEKCLVETLALAPHEEYIQRHLSIVRGKI 655          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Xenopus
Match: ENSXETT00000045136.1 (transmembrane and tetratricopeptide repeat containing 3 [Source:NCBI gene;Acc:100145573])

HSP 1 Score: 502.671 bits (1293), Expect = 1.833e-166
Identity = 271/562 (48.22%), Postives = 368/562 (65.48%), Query Frame = 1
Query:  760 MPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIG-LWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ SI D+R + TL  Y  +    I+   R    SS+T+ M+L +++L F+PASNLF  VGFVVAERVLY PS+GFC+++   W + S     +    I+ + VV   +H + T+ RN+DW +EYTLF SAL+VN+NNAKLWNNVGH+LE+EK +E ALR+F  A++ QP+D+G+H+NVGRT  NL R  EAEE++ +A + MPQ   G+ Y  RV+P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  EAR  YI AL+    +ADL YNL +V IELK   EAL  F+ +L+L+  HK A  + A    E      R EAK      ++ E      +F L M+  D+K    AE     +++     R +LFNLALLY+   ++  EAL +L+ LL  YP+H KG +L GDIL+N K+D+  A   F+K  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HL+IVR ++
Sbjct:   98 LPVFTRFDNPAAVSTTPARQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESILDIRNLATLLFYFLL-GYLIVFSVRYSGDSSKTVLMALCLIILPFIPASNLFFPVGFVVAERVLYVPSMGFCMLVAHGWKKLSSNGRLRTLSWIFLALVVF--THAIKTFNRNWDWESEYTLFTSALKVNKNNAKLWNNVGHALENEKNYERALRFFKKATEVQPDDIGAHMNVGRTYKNLNRSKEAEESYLIAKALMPQVIPGKKYAARVAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLEAREAYIKALELDRMNADLWYNLAIVYIELKDPSEALRNFNQALELNPRHKLALFNSALLMQESGSARLRPEAKRRLLTYVEEEPHDANGYFNLGMLAMDEKKDTEAEVWMKKAIQLHHGFRSALFNLALLYSQTSREL-EALPVLDELLRFYPDHSKGLILKGDILMNQKKDIKGAKKCFEKIVEMDPNNVQGKHNLCVVYFEERDLIKAEKCLVETLALAPHEEYIQRHLSIVRGKI 655          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Xenopus
Match: ENSXETT00000045169.1 (transmembrane and tetratricopeptide repeat containing 3 [Source:NCBI gene;Acc:100145573])

HSP 1 Score: 381.719 bits (979), Expect = 2.394e-123
Identity = 202/393 (51.40%), Postives = 266/393 (67.68%), Query Frame = 1
Query:  760 MPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIG-LWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREE 1935
            +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ SI D+R + TL  Y  +    I+   R    SS+T+ M+L +++L F+PASNLF  VGFVVAERVLY PS+GFC+++   W + S     +    I+ + VV   +H + T+ RN+DW +EYTLF SAL+VN+NNAKLWNNVGH+LE+EK +E ALR+F  A++ QP+D+G+H+NVGRT  NL R  EAEE++ +A + MPQ   G+ Y  RV+P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  EAR  YI AL+    +ADL YNL +V IELK   EAL  F+ +L+L+  HK A  + A    E   K  E
Sbjct:   98 LPVFTRFDNPAAVSTTPARQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESILDIRNLATLLFYFLL-GYLIVFSVRYSGDSSKTVLMALCLIILPFIPASNLFFPVGFVVAERVLYVPSMGFCMLVAHGWKKLSSNGRLRTLSWIFLALVVF--THAIKTFNRNWDWESEYTLFTSALKVNKNNAKLWNNVGHALENEKNYERALRFFKKATEVQPDDIGAHMNVGRTYKNLNRSKEAEESYLIAKALMPQVIPGKKYAARVAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLEAREAYIKALELDRMNADLWYNLAIVYIELKDPSEALRNFNQALELNPRHKLALFNSALLMQESGVKIGE 487          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Xenopus
Match: bnip2 (BCL2/adenovirus E1B 19kDa interacting protein 2 [Source:Xenbase;Acc:XB-GENE-1016160])

HSP 1 Score: 319.316 bits (817), Expect = 3.557e-95
Identity = 277/863 (32.10%), Postives = 429/863 (49.71%), Query Frame = 1
Query:   88 FVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCT--IYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKS-----KYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL-------------------WKMHNVNIDKKYFVRYT------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHF-QKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFY---SEDKE-----------------------------KREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYD-----PTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVK----GHLLLGDIL--LNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQH---LNIVRNRL 2436
            FV DDV AI +N D R ETP S++F NDFWG  +    SHKSYRPL VL+FR N FLG LN   +HAIN++LHA V  L    C+  ++ D   +  +A+LF+ HPIHTEAV G+VGRA++LS + FLL+ L YI  + S      +      L +LL L+L +   L KE  IT  GVC+    Y L+ L                   W++++ + D +  + Y       R+ ++ +  AL+++ RL+I G  MP F++ DNPA+ SP+P+ R LT+ YL + N  LL  P+ LC DW +G+I L+ S+ DVR + TL     +G L++  +  ++    E + + LL +V  F+PASNLF  VGFVVAERVLY PS+GFC++    L+    H  Q+    +   F+ LLL  +  +  ++  WR+   LF S +Q   +NAK+  N  + L+ + + ++A+ ++    +  P    +  N+G    N     EAEE ++ AL               +SP+      NL NLL  NK +  EA+  LR ++     F DAY + G +L    R EEA + Y T ++  P ++DLH N GV  +++ +  E  S +  +L L   H  A L+L   Y    ++KE                             + EEA+ +Y + +     + +   +LA +        L + H   +L Y      P        L+ +Y+   + + +AL L++  L+   N  K     H   G+ L  LN+   L  AF ++++ +EL P  AQA  N+  +   Q     A +   +A  L P+   +K++   L  + NRL
Sbjct:   56 FVHDDVWAILNNPDSRAETPLSSIFGNDFWGKAMNDNTSHKSYRPLCVLSFRINVFLGGLNAIYFHAINIVLHAAVSSLLMFTCSTAVFEDKRLALAAALLFSAHPIHTEAVAGIVGRADVLSCLLFLLTFLSYIRSMDSGPPRHSFPPTSAPLFLLLSLILGTGAVLVKETGITVFGVCL---TYDLLLLCPTRCKRFVCLYVSMCTYEWELYS-SPDPRASIWYVAGPFLKRAALVSLYVALVLYFRLRIMGGSMPLFSEQDNPASFSPYPLTRFLTYLYLLAFNSWLLLAPITLCYDWQVGSIPLINSLWDVRNLATLLFVGIVGSLALHCLAFLKVHLLEEVLVGLLFLVFPFIPASNLFFRVGFVVAERVLYMPSMGFCILCVHGLKVLQSHVGQRRSLSLTLCFLFLLLLFSCKSLSQSECWRSREALFRSGVQTLPHNAKVHYNYANFLKDQSRKDEAIMHYKTVLRLYPKHSSALNNLGTLTANTT---EAEEYYRRAL--------------MISPQHSRALFNLGNLL--NKGQDDEAELLLRESLHYGSYFGDAYSSLGSLLADQKRYEEADDVYQTGIKSCPENSDLHNNYGVFLVDMGKFSE--SHYLHALHLRPDHHVAMLNLGRLYRSLGQNKEAEKWYRKALQISREADVISPLGALLYNTGQHEEARRLYQEAVGLHPRNIQIRLSLAQVLA-----VLGQIHEAEALAYGIAAEVPDCTECFRLLSAIYSKR-EDYVKALELIDFALQMKSNDAKLLSELHFTRGNQLRELNH---LEEAFQSYERVAELNPTQAQAWMNMGGIRHMQGDYTSARAFYQKAAVLDPDSKLLKENLAKLQRIENRL 884          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Xenopus
Match: bnip2 (BCL2/adenovirus E1B 19kDa interacting protein 2 [Source:Xenbase;Acc:XB-GENE-1016160])

HSP 1 Score: 320.857 bits (821), Expect = 6.612e-94
Identity = 268/832 (32.21%), Postives = 418/832 (50.24%), Query Frame = 1
Query:   88 FVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCT--IYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKS-----KYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYT------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHF-QKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQ------------PKKGQAYTTRVSPKDL--------NVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYD-----PTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVK----GHLLLGDIL--LNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQH---LNIVRNRL 2436
            FV DDV AI +N D R ETP S++F NDFWG  +    SHKSYRPL VL+FR N FLG LN   +HAIN++LHA V  L    C+  ++ D   +  +A+LF+ HPIHTEAV G+VGRA++LS + FLL+ L YI  + S      +      L +LL L+L +   L KE  IT  GVC+  +   L         + D +  + Y       R+ ++ +  AL+++ RL+I G  MP F++ DNPA+ SP+P+ R LT+ YL + N  LL  P+ LC DW +G+I L+ S+ DVR + TL     +G L++  +  ++      + + LL +V  F+PASNLF  VGFVVAERVLY PS+GFC++    L+    H  Q+    +   F+ LLL  +  +  ++  WR+   LF S +Q   +NAK+  N  + L+ + + ++A+ ++    +  P    +  N+G    N     EAEE ++ AL   PQ              KGQ     +  ++         + + +L +LL   K R  EAD   +  I   P+  D + N G  L+ + +S++A + Y+ AL  RP+      NLG +   L +N EA   +  +LQ+ R         A  Y  +  + EEA+ +Y + +     + +   +LA +        L + H   +L Y      P        L+ +Y+   + + +AL L++  L+   N  K     H   G+ L  LN+   L  AF ++++ +EL P  AQA  N+  +   Q     A +   +A  L P+   +K++   L  + NRL
Sbjct:  340 FVHDDVWAILNNPDSRAETPLSSIFGNDFWGKAMNDNTSHKSYRPLCVLSFRINVFLGGLNAIYFHAINIVLHAAVSSLLMFTCSTAVFEDKRLALAAALLFSAHPIHTEAVAGIVGRADVLSCLLFLLTFLSYIRSMDSGPPRHSFPPTSAPLFLLLSLILGTGAVLVKETGITVFGVCLTYDLLLLCPTRCKRYSSPDPRASIWYVAGPFLKRAALVSLYVALVLYFRLRIMGGSMPLFSEQDNPASFSPYPLTRFLTYLYLLAFNSWLLLAPITLCYDWQVGSIPLINSLWDVRNLATLLFVGIVGSLALHCLAFLKRAPRREVLVGLLFLVFPFIPASNLFFRVGFVVAERVLYMPSMGFCILCVHGLKVLQSHVGQRRSLSLTLCFLFLLLLFSCKSLSQSECWRSREALFRSGVQTLPHNAKVHYNYANFLKDQSRKDEAIMHYKTVLRLYPKHSSALNNLGTLTANTT---EAEEYYRRALMISPQHSRALFNLGNLLRNKGQDDEAELLLRESLHYGSYFGDAYSSLGSLLADQK-RYEEADDVYQTGIKSCPENSDLHNNYGVFLVDMEKSQKAESHYLHALHLRPDHHVAMLNLGRLYRSLGQNKEAEKWYRKALQISREADVISPLGALLY--NTGQHEEARRLYQEAVGLHPRNIQIRLSLAQVLA-----VLGQIHEAEALAYGIAAEVPDCTECFRLLSAIYSKR-EDYVKALELIDFALQMKSNDAKLLSELHFTRGNQLRELNH---LEEAFQSYERVAELNPTQAQAWMNMGGIRHMQGDYTSARAFYQKAAVLDPDSKLLKENLAKLQRIENRL 1156          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Mouse
Match: Tmtc3 (transmembrane and tetratricopeptide repeat containing 3 [Source:MGI Symbol;Acc:MGI:3036255])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 397/809 (49.07%), Postives = 536/809 (66.25%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKIN------------GKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYS 2445
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N + HA+V ++F ++C ++ D   S ++A+LFAVHPIHTEAVTGVVGRAELLSSVFFL +   +++  KSK   N      I+L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S  + M   L+  + L ++               +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S  DVR + T   + F+G L I  + R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I +    +K  +    +++L+H + T +RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAE ++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V IELK  +EAL  F+ +L+L+  HK A  + A    E  E   R EA+    + +  E +    +F L M+  DDK    AE     ++K  P  R +LFNLALLY+   K+  +AL +L  LL+ YP+H KG +L GDIL+N K+D+P A   F+K  E++P N Q KHNLCVV  E+ +L++AE CL E + L+P+E YI++HL+IVR+R+  S
Sbjct:   25 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAVVSVIFLKVCRLFLDKRSSMIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAA---FLSYTKSKGPDNSIVWTPIVLTVFLVAVATLCKEQGITVVGICCVYEVF-VAQGYTLPMLCTVAGQFLRGKGSIPLSMLQTLVKLIVLMLSTLLLVVVRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESFLDVRNLATFAFFCFLGALGIFSL-RYPGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISNKSVLKKLSWVCLSMVILTHALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTREAEASYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLNYVNEEPQDANGYFNLGMLAMDDKKDSEAESWMKKAIKLQPDFRSALFNLALLYSQTAKEL-KALPILEELLKYYPDHTKGLILKGDILMNQKKDIPGAKKCFEKILEMDPSNVQGKHNLCVVYFEEKELLKAERCLVETLALAPHEEYIQRHLSIVRDRISSS 826          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Mouse
Match: Tmtc3 (transmembrane and tetratricopeptide repeat containing 3 [Source:MGI Symbol;Acc:MGI:3036255])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 321/636 (50.47%), Postives = 427/636 (67.14%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKING------------KYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKRE 1932
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N + HA+V ++F ++C ++ D   S ++A+LFAVHPIHTEAVTGVVGRAELLSSVFFL +   +++  KSK   N      I+L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S  + M   L+  + L ++               +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S  DVR + T   + F+G L I  + R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I +    +K  +    +++L+H + T +RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAE ++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V IELK  +EAL  F+ +L+L+  HK A  + A    E  +  E
Sbjct:   25 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAVVSVIFLKVCRLFLDKRSSMIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAA---FLSYTKSKGPDNSIVWTPIVLTVFLVAVATLCKEQGITVVGICCVYEVF-VAQGYTLPMLCTVAGQFLRGKGSIPLSMLQTLVKLIVLMLSTLLLVVVRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESFLDVRNLATFAFFCFLGALGIFSL-RYPGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISNKSVLKKLSWVCLSMVILTHALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTREAEASYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGKFPE 654          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Mouse
Match: Tmtc4 (transmembrane and tetratricopeptide repeat containing 4 [Source:MGI Symbol;Acc:MGI:1921050])

HSP 1 Score: 323.939 bits (829), Expect = 1.862e-98
Identity = 240/717 (33.47%), Postives = 372/717 (51.88%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK---SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL------WKMHNVNIDKKYFVRYTRSGIIF------MGAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNK-TRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ +TP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH  + IL   + ++ F  +               S L+ +LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    K   +K         +LL + L ++  LCKEQ IT LG+    +   + KL       K+ + +  ++    +   G++F      +G   ++++R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ S+ D R++     +   IGL+   +      K    L + L  +V+ FLPASNLF  VGFVVAERVLY PS G+C+++        +H +K +K +    + +LL + +    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A++Y+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N   R  EA+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +LQL  +      SLA+   +  +K +E+++++   IKA       H  LA++     +   A+KHY  SL+ DP + G+  N +LL
Sbjct:   33 FARSYDGDFVFDDSEAIVNNKDLQSDTPLGDLWHHDFWGSKLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHGSISILMLDVFSVLFGGLQYTGKGQRVHLAPRASLLATLLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCQAFKETGNKEGTHSSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIGKLDILAAVRKVLHKDKSQENAGMFKNGGLLFRIALLTIGGTSMLYIRWKIMGTGPPAFTEVDNPASFADSMLVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVGDWRVIALAALWLCLIGLIFQALCSEDSCK-RRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSAGYCVLLTFGFGALSRHTKK-KKPVAAIILGILLINALRCVIRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDSAKKHYEISLQLDPVAVGTKENYSLL 729          

HSP 2 Score: 50.447 bits (119), Expect = 9.061e-6
Identity = 54/248 (21.77%), Postives = 114/248 (45.97%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTS 2451
            RS E R++   + +AL   P +A +HYN+G    +      A+  +  +++L+  +  A  +L +   E  E  +EA+ +    ++ + +       L +++   K F+ AE+ Y  ++K+        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A    ++A +L P +     +L  V+ +  K  E+E+   +A+K +PN      +L ++ +R G+  S
Sbjct:  460 RSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNE-LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMI--ILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDS 704          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Mouse
Match: Tmtc4 (transmembrane and tetratricopeptide repeat containing 4 [Source:MGI Symbol;Acc:MGI:1921050])

HSP 1 Score: 323.939 bits (829), Expect = 1.862e-98
Identity = 240/717 (33.47%), Postives = 372/717 (51.88%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK---SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL------WKMHNVNIDKKYFVRYTRSGIIF------MGAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNK-TRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ +TP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH  + IL   + ++ F  +               S L+ +LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    K   +K         +LL + L ++  LCKEQ IT LG+    +   + KL       K+ + +  ++    +   G++F      +G   ++++R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ S+ D R++     +   IGL+   +      K    L + L  +V+ FLPASNLF  VGFVVAERVLY PS G+C+++        +H +K +K +    + +LL + +    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A++Y+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N   R  EA+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +LQL  +      SLA+   +  +K +E+++++   IKA       H  LA++     +   A+KHY  SL+ DP + G+  N +LL
Sbjct:   33 FARSYDGDFVFDDSEAIVNNKDLQSDTPLGDLWHHDFWGSKLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHGSISILMLDVFSVLFGGLQYTGKGQRVHLAPRASLLATLLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCQAFKETGNKEGTHSSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIGKLDILAAVRKVLHKDKSQENAGMFKNGGLLFRIALLTIGGTSMLYIRWKIMGTGPPAFTEVDNPASFADSMLVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVGDWRVIALAALWLCLIGLIFQALCSEDSCK-RRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSAGYCVLLTFGFGALSRHTKK-KKPVAAIILGILLINALRCVIRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDSAKKHYEISLQLDPVAVGTKENYSLL 729          

HSP 2 Score: 50.447 bits (119), Expect = 9.061e-6
Identity = 54/248 (21.77%), Postives = 114/248 (45.97%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTS 2451
            RS E R++   + +AL   P +A +HYN+G    +      A+  +  +++L+  +  A  +L +   E  E  +EA+ +    ++ + +       L +++   K F+ AE+ Y  ++K+        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A    ++A +L P +     +L  V+ +  K  E+E+   +A+K +PN      +L ++ +R G+  S
Sbjct:  460 RSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNE-LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMI--ILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDS 704          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Mouse
Match: Tmtc4 (transmembrane and tetratricopeptide repeat containing 4 [Source:MGI Symbol;Acc:MGI:1921050])

HSP 1 Score: 323.939 bits (829), Expect = 1.862e-98
Identity = 240/717 (33.47%), Postives = 372/717 (51.88%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK---SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL------WKMHNVNIDKKYFVRYTRSGIIF------MGAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNK-TRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ +TP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH  + IL   + ++ F  +               S L+ +LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    K   +K         +LL + L ++  LCKEQ IT LG+    +   + KL       K+ + +  ++    +   G++F      +G   ++++R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ S+ D R++     +   IGL+   +      K    L + L  +V+ FLPASNLF  VGFVVAERVLY PS G+C+++        +H +K +K +    + +LL + +    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A++Y+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N   R  EA+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +LQL  +      SLA+   +  +K +E+++++   IKA       H  LA++     +   A+KHY  SL+ DP + G+  N +LL
Sbjct:   33 FARSYDGDFVFDDSEAIVNNKDLQSDTPLGDLWHHDFWGSKLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHGSISILMLDVFSVLFGGLQYTGKGQRVHLAPRASLLATLLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCQAFKETGNKEGTHSSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIGKLDILAAVRKVLHKDKSQENAGMFKNGGLLFRIALLTIGGTSMLYIRWKIMGTGPPAFTEVDNPASFADSMLVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVGDWRVIALAALWLCLIGLIFQALCSEDSCK-RRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSAGYCVLLTFGFGALSRHTKK-KKPVAAIILGILLINALRCVIRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDSAKKHYEISLQLDPVAVGTKENYSLL 729          

HSP 2 Score: 50.447 bits (119), Expect = 9.061e-6
Identity = 54/248 (21.77%), Postives = 114/248 (45.97%), Query Frame = 1
Query: 1717 RSEEARNQ---YITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTS 2451
            RS E R++   + +AL   P +A +HYN+G    +      A+  +  +++L+  +  A  +L +   E  E  +EA+ +    ++ + +       L +++   K F+ AE+ Y  ++K+        +NL  LY +  +  D      N  +    + +  + ++  ILL+   +L  A    ++A +L P +     +L  V+ +  K  E+E+   +A+K +PN      +L ++ +R G+  S
Sbjct:  460 RSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNE-LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMI--ILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDS 704          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. UniProt/SwissProt
Match: sp|Q6ZXV5|TMTC3_HUMAN (Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 398/814 (48.89%), Postives = 541/814 (66.46%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSG------------IIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEAL-SCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFI 2460
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N+I HA+V ++F ++C ++ D   S ++++LFAVHPIHTEAVTGVVGRAELLSS+FFL + L Y        S I     I L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S             ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S+ D+R + T   + F+G+L +  I R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I     F+K  +    +++L+H++ T++RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAEE++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V+IELK  +EAL   F+ +L+L+  HK A  + A    E  E   R EA+      I  E      +F L M+  DDK    AE     ++K     R +LFNLALLY+   K+  +AL +L  LL  YP+H+KG +L GDIL+N K+D+  A   F++  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HLNIVR+++  S+S+FI
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSII--WTPIALTVFLVAVATLCKEQGITVVGICCVYEVF-IAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSI-RYSGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISTKSVFKKLSWICLSMVILTHSLKTFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSYINEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKEL-KALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVVYFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKI--SSSSFI 825          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. UniProt/SwissProt
Match: sp|Q8BRH0|TMTC3_MOUSE (Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2)

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 397/809 (49.07%), Postives = 536/809 (66.25%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKIN------------GKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYS 2445
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N + HA+V ++F ++C ++ D   S ++A+LFAVHPIHTEAVTGVVGRAELLSSVFFL +   +++  KSK   N      I+L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S  + M   L+  + L ++               +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S  DVR + T   + F+G L I  + R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I +    +K  +    +++L+H + T +RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAE ++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V IELK  +EAL  F+ +L+L+  HK A  + A    E  E   R EA+    + +  E +    +F L M+  DDK    AE     ++K  P  R +LFNLALLY+   K+  +AL +L  LL+ YP+H KG +L GDIL+N K+D+P A   F+K  E++P N Q KHNLCVV  E+ +L++AE CL E + L+P+E YI++HL+IVR+R+  S
Sbjct:   25 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAVVSVIFLKVCRLFLDKRSSMIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAA---FLSYTKSKGPDNSIVWTPIVLTVFLVAVATLCKEQGITVVGICCVYEVF-VAQGYTLPMLCTVAGQFLRGKGSIPLSMLQTLVKLIVLMLSTLLLVVVRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESFLDVRNLATFAFFCFLGALGIFSL-RYPGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISNKSVLKKLSWVCLSMVILTHALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHVQPDDIGAHMNVGRTYKNLNRSREAEASYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLNYVNEEPQDANGYFNLGMLAMDDKKDSEAESWMKKAIKLQPDFRSALFNLALLYSQTAKEL-KALPILEELLKYYPDHTKGLILKGDILMNQKKDIPGAKKCFEKILEMDPSNVQGKHNLCVVYFEEKELLKAERCLVETLALAPHEEYIQRHLSIVRDRISSS 826          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. UniProt/SwissProt
Match: sp|Q7K4B6|TMTC3_DROME (Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 371/843 (44.01%), Postives = 519/843 (61.57%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHS---------------------FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXX--XXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTR---------SGI-------------IFMGAAL-LMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKS---SETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQ-KFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSE--DKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            Y+NS  CG VFDD++AI+DNKDLRP TP   +F NDFWGTP+R+E+SHKSYRPLTVLTFR+NY L  L P GYH +N++LH  V +L+ ++C +      +                     F++++LFAVHP+HTEAVTGVVGRAELLSS+ FL + L Y   V       +     L       +    LCKEQ IT  G+C+  E + + +L  +H  +   + F   T          SGI               +G  L L+  R+ + G  +P FT FDNPA+ +  P RQLT+ YL  +N  LL CP  LCCDWTMGT+ L+   TD R + TL T+  +G +   V K   T++   S TL M L  MVL FLPASNLF  VGFVVAER+LY PS+G+CL++    ++  +     +Q+    +  +LLL+H + T+ RN DWR EY+LFMS + VNQ NAKL+NNVGH+LE+E KFE+AL YF  A + Q +D+G+HINVGRT  NL+R+ EAE+A+  A +  PQ K G +Y  R++P  LNVFINL+NL+ KN+TRL EAD   R+AISMR D+V AY NRGDIL+KL R+ +A+  Y  AL Y   +AD++YNLGVV +E  ++ +A   F+ +++L   H+ A L+ A    E   +E R  ++S  Y +++ + ++EK +F L M+  D+ +F  AE+ +  ++      R +LFNLALL  +  +  D A+  LN+L+ ++P+HVKG +LLGDI +N+ +DL  A   ++     +P N Q  HNLCVV VE+ +L +A +CL  A +L+P E+YI +HL IV  RL
Sbjct:   48 YYNSTQCGLVFDDISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGYHLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHPVHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLCKEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTLWKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLLCPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAM---VAKTCFTRNLALSRTLIMCLGWMVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAILLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLD-AVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQGLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARL 886          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. UniProt/SwissProt
Match: sp|Q8BG19|TMTC4_MOUSE (Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.303e-97
Identity = 240/717 (33.47%), Postives = 372/717 (51.88%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK---SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL------WKMHNVNIDKKYFVRYTRSGIIF------MGAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNK-TRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ +TP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH  + IL   + ++ F  +               S L+ +LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    K   +K         +LL + L ++  LCKEQ IT LG+    +   + KL       K+ + +  ++    +   G++F      +G   ++++R KI G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ S+ D R++     +   IGL+   +      K    L + L  +V+ FLPASNLF  VGFVVAERVLY PS G+C+++        +H +K +K +    + +LL + +    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A++Y+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N   R  EA+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +LQL  +      SLA+   +  +K +E+++++   IKA       H  LA++     +   A+KHY  SL+ DP + G+  N +LL
Sbjct:   33 FARSYDGDFVFDDSEAIVNNKDLQSDTPLGDLWHHDFWGSKLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHGSISILMLDVFSVLFGGLQYTGKGQRVHLAPRASLLATLLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCQAFKETGNKEGTHSSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIGKLDILAAVRKVLHKDKSQENAGMFKNGGLLFRIALLTIGGTSMLYIRWKIMGTGPPAFTEVDNPASFADSMLVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVGDWRVIALAALWLCLIGLIFQALCSEDSCK-RRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSAGYCVLLTFGFGALSRHTKK-KKPVAAIILGILLINALRCVIRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADQGNQTAAIKYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEEAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALQLIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNVASYHGNLAVLYHRWGHLDSAKKHYEISLQLDPVAVGTKENYSLL 729          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. UniProt/SwissProt
Match: sp|Q5T4D3|TMTC4_HUMAN (Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2)

HSP 1 Score: 317.39 bits (812), Expect = 3.576e-95
Identity = 243/719 (33.80%), Postives = 378/719 (52.57%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVK--SKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVR---------YTRSGIIFM------GAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTY-AFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLE-ADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRN-DEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALL 2112
            +  S D  FVFDD  AI +NKDL+ ETP   L+++DFWG+ +    SHKSYRPLTVLTFR NY+L G  +P G+H +N++LH+ + +L   + ++ F  +               S L+A+LFAVHP+HTE V GVVGRA+LL ++FFLLS L Y    +  +K         +LL + L ++  LCKEQ IT LG+      + ++ + K + + I +K   +             G++F       G A ++++R +I G   P FT+ DNPA+ +    +R + +NY  S+N  LL CP  LC DW+MG I L+ SI+D R++     +   IGL+   +    +      L + L  +V+ FLPASNLF  VGFVVAERVLY PS+G+C+++        KH +K +K I    + +L  +T+    R+ +WR+E  LF SAL V   NAK+  N+G +L  +     A+RY+  A +  P  V +  N+G  L       EAEE   +A+              ++ P     ++NL   +++N  +  E A+   R AI  R  + D Y N G +   L R  +A N +  A   +P  + L +N  ++ ++   N  +A +    +L+L  +      SLA+   +  +K +E+++++   IKA   +   H  LA++     +  LA+KHY  SL+ DPT+ G+  N  LL
Sbjct:   34 FARSYDGDFVFDDSEAIVNNKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGFHPVGFHVVNILLHSGISVLMVDVFSVLFGGLQYTSKGRRLHLAPRASLLAALLFAVHPVHTECVAGVVGRADLLCALFFLLSFLGYCKAFRESNKEGAHSSTFWVLLSIFLGAVAMLCKEQGITVLGLN---AVFDILVIGKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPPAFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWRVIALAALWFCLIGLICQALCSE-DGHKRRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVGYCVLLTFGFGALSKHTKK-KKLIAAVVLGILFINTLRCVLRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAV--------------QIQPDFAAAWMNLG--IVQNSLKRFEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHS-LAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKS-QKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLL 729          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. TrEMBL
Match: A0A1S3KH78 (transmembrane and TPR repeat-containing protein 3 OS=Lingula unguis OX=7574 GN=LOC106181858 PE=4 SV=1)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 393/804 (48.88%), Postives = 540/804 (67.16%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVK------LWKMHNVNIDKKYFVRYTRSG-----IIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSE--DKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRL 2436
            Y+NSL CGFVFDDV+AIKDNKDLRPETP S+LF+NDFWGTP+ +E+SHKSYRPL VLTFR NY +  L P  YH +NV+LH IV I+F ++C ++     SF++A++FAVHP+HTEAVTGVVGRAE LSS+F+L + L Y      K  +I     + L L+ V++  LCKEQ IT +GVC   E +   +      L+ + ++   K  F  + R+       +  G   L+  R+K+ G  +P FT FDNPA+ +  P RQLTF+YL  VN  LL CP  LCCDWTMGTI L+ S+ D+R + T   +  +G L    +     ++   + MSL  +VL F+PASNLF  VGFVVAER+LY PS+GFC++  L     +      +  ++ +  +LL++H + TY RN DW +EYTLF +AL+VNQNNAKL+NNVGH+LE E+K+EDAL YF+ A+  QP+D+G+HINVGRT   L+R  EAE AF+ AL  MP PK GQ+YT R++P  LN F+NL+NL+ +N++RLLEADA  R A+SMR D+   Y NRGDILL+L R++EA NQY+TAL+Y   +AD++YNLGVV +E  R+ E++  F+ +L ++  HK    + A    E  D + R EA    + L++ E ++EK +F L M+ TDD  F+ AE  +  +++     RG+LFNLALL  N++K+  +A+  L +LL+ YP+H KG +L+GDI +N+ +D+  A  NF+K  E +P N QA HNLCVV VEQ  L++AE CL E VKL+PNE YI+ HL+IVR RL
Sbjct:   19 YYNSLGCGFVFDDVSAIKDNKDLRPETPISSLFWNDFWGTPMHKEQSHKSYRPLCVLTFRLNYLISGLEPMSYHLVNVLLHGIVCIMFMRMCMLFLSEKMSFVAAMMFAVHPVHTEAVTGVVGRAETLSSIFYLAAFLTYTKCTGRK--SITVWSKLYLTLMFVAVAMLCKEQGITVIGVCCVYEVFIAQRMTLSQILYILSSILHGKPVFPPWLRAATLRACFLVGGTLFLLIARIKVMGAQLPVFTRFDNPASVASTPDRQLTFSYLLPVNTWLLLCPSYLCCDWTMGTIPLIKSLLDIRNLATAAFFISLGKLVQYALTENGPRARAVI-MSLAFLVLPFIPASNLFFPVGFVVAERILYAPSMGFCMLTALGFDIILTKVN-VKSLLWAAMAMLLVTHGLRTYIRNNDWESEYTLFKAALRVNQNNAKLYNNVGHALEAEEKYEDALGYFLKAASVQPDDMGAHINVGRTYNTLKRLDEAEAAFRRALRLMPSPKAGQSYTARIAPNHLNAFLNLANLISQNESRLLEADALYRTALSMRSDYTQGYINRGDILLRLNRTKEAENQYLTALKYDSTNADIYYNLGVVCLEQSRHKESMRYFNKALDINPKHKQTLYNSAVLMQESGDPKLRPEAYKRLFKLMEIEPDNEKMYFNLGMLATDDGEFEKAETWFKRAIELQDNFRGALFNLALLLANDVKRPLDAVPYLKKLLQYYPDHTKGLILMGDININHLKDIRGAEENFKKILETDPTNVQANHNLCVVYVEQGDLLKAEKCLVETVKLAPNEKYIQDHLSIVRGRL 818          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. TrEMBL
Match: D3ZUJ8 (Transmembrane O-mannosyltransferase targeting cadherins 3 OS=Rattus norvegicus OX=10116 GN=Tmtc3 PE=1 SV=1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 399/808 (49.38%), Postives = 536/808 (66.34%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLE-----AYHLVKLWKMHNVNIDKKYFVRYT------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYS 2445
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N + HA+V ++F ++C ++ D   S ++A+LFAVHPIHTEAVTGVVGRAELLSSVFFL +   +++  KSK   N      I L ++LV++ TLCKEQ IT +G+C   E      Y L  L  +    +  K  + ++      +  ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S  DVR + T   + F+G L I  + R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I +    +K  +    +++L+H + T +RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAEE++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V IELK  DEAL  F+ +L+L+  HK A  + A    E  E   R EA+    + I  E +    +F L M+  DDK    AE     ++K  P  R +LFNLALLY+   K+  +AL +L  LL  YP+H KG +L GDIL+N K+D+  A   F+K  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HL+IVR+++  S
Sbjct:   25 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAVVSVIFLKVCRLFLDKRGSVIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAA---FLSYTKSKGPDNSIVWTPIALTVLLVAVATLCKEQGITVVGICCVYEVFVAQGYTLPLLCAVAGQFLRGKGSIPFSMLQTLIKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESFLDVRNLATFAFFCFLGALGIFSL-RYPGDSSKTVLMALSLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISNKSVLKKLSWVCLSMVILTHALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTKEAEESYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPDEALKNFNRALELNSRHKLALFNSAILMQESGEVKLRPEARKRLLNYINEEPQDANGYFNLGMLAMDDKKDSEAETWMKRAIKLQPDFRSALFNLALLYSQTAKEL-KALPILEELLRYYPDHTKGLILKGDILMNQKKDIAGAKKCFEKILEMDPSNVQGKHNLCVVYFEEKDLLKAERCLVETLALAPHEEYIQRHLSIVRDKIASS 826          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. TrEMBL
Match: H2NI75 (Transmembrane O-mannosyltransferase targeting cadherins 3 OS=Pongo abelii OX=9601 GN=TMTC3 PE=4 SV=1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 395/802 (49.25%), Postives = 538/802 (67.08%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFI 2460
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N+I HA+V ++F ++C ++ D   S ++++LFAVHPIHTEAVTGVVGRAELLSS+FFL +   +++  +SK   N      I L + LV++ TLCKEQ IT +G+C   E +     + M              +  ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S+ D+R + T   + F+G L +  I R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I     F+K  +    +++L+H++ T++RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A++ QP+D+G+H+NVGRT  NL R  EAEE++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V+IELK  +EAL  F+ +L+L+  HK A  + A    E  E   R EA+      I  E      +F L M+  DDK    AE     ++K     R +LFNLALLY+   K+  +AL +L  LL  YP+H+KG +L GDIL+N K+D+  A   F++  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HLNIVR+++  S+S+FI
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAA---FLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGITVVGICCVYEVFIAQGPFSMLQT---------LVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGTLGVFSI-RYSGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISTKSVFKKLSWICLSMVILTHSLKTFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATRVQPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSYINEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKEL-KALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVVYFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKI--SSSSFI 804          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. TrEMBL
Match: A0A1U7QKK7 (transmembrane and TPR repeat-containing protein 3 OS=Mesocricetus auratus OX=10036 GN=Tmtc3 PE=4 SV=1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 399/808 (49.38%), Postives = 537/808 (66.46%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLE-----AYHLVKLWKMHNVNIDKKYFVRYT------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYS 2445
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N + HAIV ++F ++C ++ D   S ++A+LFAVHPIHTEAVTGVVGRAELLSSVFFL +   +++  KSK   N      I L ++LV++ TLCKEQ IT +G+C   E      Y L  L       + +K  + ++      +  ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S  D+R + T   ++F+G L I  + R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I +    +K  +    +++L+H + T +RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A+  QP+D+G+H+NVGRT  NL R  EAEE++ +A S MPQ   G+ Y TR++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V IELK  +EAL  F+ +L+L+  HK A  + A    E  E   R EA+      I  E +    +F L M+  DDK    AE     ++K     R +LFNLALLY+   K+  +AL +L  LL  YP+H KG +L GDIL+N K+D+P A   F+K  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HL+IVR+++  S
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLHPTTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNTVFHAIVSVIFLKVCKLFLDKRSSVIAALLFAVHPIHTEAVTGVVGRAELLSSVFFLAA---FLSYTKSKGPDNSIVWSPIALTVLLVAVATLCKEQGITVVGICCVYEVFVAQGYTLPLLCTAAGQFLREKGSIPFSMLQTLIKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESFLDIRNLATFAFFSFLGALGIFSL-RYPGDSSKTVLMALCLMTLPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISNKSVLKKLSWICLSMVILTHALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATYVQPDDIGAHMNVGRTYKNLNRTREAEESYMLAKSLMPQIIPGKKYATRIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSYINEEPQDANGYFNLGMLAMDDKKDSEAEAWMKKAIKLQADFRSALFNLALLYSQTAKEL-KALPILEELLRYYPDHTKGLILKGDILMNQKKDIPGAKKCFEKILEMDPSNVQGKHNLCVVYFEERDLLKAERCLVETLALAPHEEYIQRHLSIVRDKISSS 821          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. TrEMBL
Match: A0A2J8SW46 (TMTC3 isoform 1 OS=Pongo abelii OX=9601 GN=CR201_G0039715 PE=4 SV=1)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 397/814 (48.77%), Postives = 544/814 (66.83%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKY-SNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSG------------IIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFI 2460
            Y+NSL CGFVFDDV+AI DNKDL P TP  TLF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L EL P  YH +N+I HA+V ++F ++C ++ D   S ++++LFAVHPIHTEAVTGVVGRAELLSS+FFL +   +++  +SK   N      I L + LV++ TLCKEQ IT +G+C   E + + + + +  +      F+R   S             ++     LL+ +R+++    +P FT FDNPAA SP P RQLTFNYL  VN  LL  P +LCCDWTMGTI L+ S+ D+R + T   + F+G L +  I R    SS+T+ M+L +M L F+PASNLF  VGFVVAERVLY PS+GFC+++    QK I     F+K  +    +++L+H++ T++RN+DW +EYTLFMSAL+VN+NNAKLWNNVGH+LE+EK FE AL+YF+ A++ QP+D+G+H+NVGRT  NL R  EAEE++ +A S MPQ   G+ Y  R++P  LNV+INL+NL+  N++RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +A+  Y+ AL+   N+ADL YNL +V+IELK  +EAL  F+ +L+L+  HK A  + A    E  E   R EA+      I  E      +F L M+  DDK    AE     ++K     R +LFNLALLY+   K+  +AL +L  LL  YP+H+KG +L GDIL+N K+D+  A   F++  E++P N Q KHNLCVV  E+  L++AE CL E + L+P+E YI++HLNIVR+++  S+S+FI
Sbjct:   20 YWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAA---FLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGITVVGICCVYEVF-IAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGTLGVFSI-RYSGDSSKTVLMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQK-ISTKSVFKKLSWICLSMVILTHSLKTFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATRVQPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSYINEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKEL-KALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVVYFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKI--SSSSFI 824          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Cavefish
Match: ENSAMXT00000049059.1 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:NCBI gene;Acc:103034940])

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 389/813 (47.85%), Postives = 529/813 (65.07%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLE-----AYHLVKLWKMHNVNIDKKYFVRYT------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEK--REEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFIP 2463
            ++NSL CGFVFDDV+AI DNKDLRP TP   LF NDFWGTP+ +ERSHKSYRPLTVLTFR NY L +L P  YH +NV+LHA V +LF + C +  D   S ++A+LFAVHP+HTEAVTGVVGRAELLSS+F L + L Y       ++ +     I+L + LV++ TLCKEQ IT +G+C   E      + L  L++M    +  K    Y       +  ++ +   LL+ +R+++    +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI LV S+ D+R + TL  Y  +G L+   + R    S++T+ M+L ++VL F+PASNLF  VGFVVAERVLY PS+GFC+++     KS+ +    +K  +    +LL +H + T+ R +DW +EYTLF SAL+VN+NNAKLWNNVGH+LE++  +E ALRYF+ A++ QP+D+G+H+NVGRT  NL R  EAEEA+ VA S MPQ   G+ Y TRV+P  LNV+INL+NL+  N +RL EAD   R+AISMRPDF  AY +RG++LLK+ +  EAR+ Y+ AL+    +ADL YNL +VNIE+K   EAL  F+ +L L+  HK A  + A    E  E   R EA   +   +K E +    +F L M+  D    + AE     +++  P  R +LFNLALLY+   ++  EAL +L+ LL ++P HVKG +L GDIL+N+++D   A   FQ+    +P N QAKHNLCVV  E+  L +AE CL E + ++P+E YI++HL IVR ++   ++   P
Sbjct:   20 FWNSLLCGFVFDDVSAILDNKDLRPSTPIQNLFLNDFWGTPMSEERSHKSYRPLTVLTFRLNYLLSQLTPLSYHLLNVLLHAAVCVLFLRFCRLLLDRKTSLVAALLFAVHPVHTEAVTGVVGRAELLSSIFLLAAFLAYTKSKGPDHAIV--WTPIILTVFLVAVATLCKEQGITVIGICCVYEVFVAQGFTLPMLFEMVGQVVRGKSGFPYAVLQTLLKLVVLVISTLLLVIVRVQVIQSQLPVFTRFDNPAAVSSTPARQLTFNYLLPVNGWLLLNPSELCCDWTMGTIPLVESVLDLRNLATLAFYVLLGTLAYHSL-RHSHNSAKTVIMALSLIVLPFIPASNLFFPVGFVVAERVLYVPSMGFCVLVAHGF-KSLTYRWGLKKMSWLLMGILLTAHAVKTFNRTWDWESEYTLFTSALKVNKNNAKLWNNVGHALENQHNYERALRYFLQATRVQPDDIGAHMNVGRTYKNLNRSKEAEEAYLVAKSLMPQIIPGKKYATRVAPNHLNVYINLANLIRANDSRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPNEARDAYLRALELDHTNADLWYNLAIVNIEMKEPTEALRNFNRALDLNPRHKLALFNSALLMQESGEAKLRPEANRRFLTYVKEEPDDANGYFNLGMLAMDANENEAAESWMRQAVRLQPGFRSALFNLALLYSQSQREL-EALPVLDELLWHHPEHVKGLILKGDILMNHRKDTQGARACFQRILRTDPNNVQAKHNLCVVYFEERDLPQAEHCLEETLAMAPHEEYIRRHLAIVRGKMAAMSAAGQP 827          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Cavefish
Match: tmtc1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:NCBI gene;Acc:103036478])

HSP 1 Score: 311.997 bits (798), Expect = 4.828e-93
Identity = 256/835 (30.66%), Postives = 411/835 (49.22%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCT--IYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKS-----KYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDK-KYFVRYTR-----SGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKF-QKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLA-----SFYSEDKE---------------------------KREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNH--VKGHLL--LGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHL 2415
            Y NSL   FV DDV AI +N D R  +   ++F +DFWG  +    SHKSYRPL +LTF+ N  LG +NP  +H +NV LH  V +L    C   ++ +   +FL+++LFAVHPIHTEAV+G+VGRA++L+S+ FLL+ L YI  V        + +      + L L L +   L KE  IT  GVC+  ++  L +     +++  + K  +R +R     + ++ +   L++  RL + G  MP F++ DNPA+ SPF + R LT+ YL + N  LL  P+ LC DW +G+I LV S+ DVR +  L     I  L +  +  ++      + + +L +V  F+PA+NLF  VGFVVAERVLY PS+G+C+++   + +      ++    +  S ++LLL  +  T  +N  W +   LF S +Q   +NAK+  N  + L+   + E A+ ++  A +  P    +  N+G    +++   EAE  ++ AL   PQ  +                 NL NLL K++ +  EA+A L+ +I   P F DAY +   +     R  EA   Y   ++  P+S+DLH N GV  ++   ++ A   +  +++L  SH  A ++LA     S  S++ E                           + EEA  +Y +    + E+     ALA +     + + AEK  L  +            L+ +Y+ +     EAL  L++ L+  P    VK  L   +G+ L     +L  AF N++ A  L+P  +QA  N+  +   +     A      A+ LSP    +K++L
Sbjct:   39 YRNSLRGEFVHDDVWAIVNNPDARAGSSLWSIFTDDFWGKRMSDNTSHKSYRPLCILTFKLNILLGGMNPYYFHVVNVCLHCAVTVLLMHTCERFVFKNSRLAFLTSLLFAVHPIHTEAVSGIVGRADVLASMLFLLAFLSYIRSVSECSMVDSFPSTVSPRFLALSLFLGTCAMLVKETGITVFGVCVLYDSLVLCRKPLFSHLSRSRVKDLIRVSRPFIKRACVVSVYVLLILSARLWLMGGSMPLFSEQDNPASFSPFLLTRFLTYCYLLAFNAWLLLAPIVLCYDWQVGSIPLVESLWDVRNIAALVLALGILALCLHCVTSLQKMEGREVLVGILFLVFPFIPATNLFFRVGFVVAERVLYMPSMGYCILVVHGVNRLCAVVGRWGAAALTVSMLLLLLLFSWKTVQQNEIWLSREALFRSGIQTLPHNAKVHYNYANFLKDRGQNEQAMHHYKTALRLYPRHASAMNNLGTLTHSVE---EAELYYRKALDINPQHNRA--------------LFNLGNLL-KSQGKEEEAEAMLKESIRFGPQFADAYSSLASLYADQKRVSEANEIYTKGIENCPDSSDLHNNYGVFLVDTGDSEGAAVHYQHAVRLKPSHYVAMVNLARLLRSSNGSKEAELWYKRALQVVRKVDILTPLGALYYNTGRYEEALQLYREAAALQPENSDIWLALAQVLAMAGSSKEAEKMTLGIISKSNGCIECYRLLSAIYSKQ-GNHTEALEALDKALQQEPADPAVKAELFFSMGNQLREMN-ELDRAFENYKLAVALKPDQSQAWMNMGGIQHIKGDYAAARMYYQRALLLSPGSKLLKENL 853          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Cavefish
Match: tmtc1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:NCBI gene;Acc:103036478])

HSP 1 Score: 279.256 bits (713), Expect = 2.648e-81
Identity = 248/835 (29.70%), Postives = 398/835 (47.66%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCT--IYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKS-----KYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDK-KYFVRYT-----RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKF-QKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLA-----SFYSEDKE---------------------------KREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNH--VKGHLL--LGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHL 2415
            Y NSL   FV DDV AI +N D R  +   ++F +DFWG  +    SHKSYRPL +LTF+ N  LG +NP  +H +NV LH  V +L    C   ++ +   +FL+++LFAVHPIHTEAV+G+VGRA++L+S+ FLL+ L YI  V        + +      + L L L +   L KE  IT  GVC+  ++  L +     +++  + K  +R +     R+ ++ +   L++  RL + G  MP F++ DNPA+ SPF + R LT+ YL + N  LL  P+ LC DW                                  +++E +  E L + +L +V  F+PA+NLF  VGFVVAERVLY PS+G+C+++   + +      ++    +  S ++LLL  +  T  +N  W +   LF S +Q   +NAK+  N  + L+   + E A+ ++  A +  P    +  N+G    +++   EAE  ++ AL   PQ  +                 NL NLL K++ +  EA+A L+ +I   P F DAY +   +     R  EA   Y   ++  P+S+DLH N GV  ++   ++ A   +  +++L  SH  A ++LA     S  S++ E                           + EEA  +Y +    + E+     ALA +     + + AEK  L  +            L+ +Y+ +     EAL  L++ L+  P    VK  L   +G+ L     +L  AF N++ A  L+P  +QA  N+  +   +     A      A+ LSP    +K++L
Sbjct:   39 YRNSLRGEFVHDDVWAIVNNPDARAGSSLWSIFTDDFWGKRMSDNTSHKSYRPLCILTFKLNILLGGMNPYYFHVVNVCLHCAVTVLLMHTCERFVFKNSRLAFLTSLLFAVHPIHTEAVSGIVGRADVLASMLFLLAFLSYIRSVSECSMVDSFPSTVSPRFLALSLFLGTCAMLVKETGITVFGVCVLYDSLVLCRKPLFSHLSRSRVKDLIRVSRPFIKRACVVSVYVLLILSARLWLMGGSMPLFSEQDNPASFSPFLLTRFLTYCYLLAFNAWLLLAPIVLCYDW----------------------------------QKMEGR--EVL-VGILFLVFPFIPATNLFFRVGFVVAERVLYMPSMGYCILVVHGVNRLCAVVGRWGAAALTVSMLLLLLLFSWKTVQQNEIWLSREALFRSGIQTLPHNAKVHYNYANFLKDRGQNEQAMHHYKTALRLYPRHASAMNNLGTLTHSVE---EAELYYRKALDINPQHNRA--------------LFNLGNLL-KSQGKEEEAEAMLKESIRFGPQFADAYSSLASLYADQKRVSEANEIYTKGIENCPDSSDLHNNYGVFLVDTGDSEGAAVHYQHAVRLKPSHYVAMVNLARLLRSSNGSKEAELWYKRALQVVRKVDILTPLGALYYNTGRYEEALQLYREAAALQPENSDIWLALAQVLAMAGSSKEAEKMTLGIISKSNGCIECYRLLSAIYSKQ-GNHTEALEALDKALQQEPADPAVKAELFFSMGNQLREMN-ELDRAFENYKLAVALKPDQSQAWMNMGGIQHIKGDYAAARMYYQRALLLSPGSKLLKENL 816          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Cavefish
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:ZFIN;Acc:ZDB-GENE-070912-148])

HSP 1 Score: 263.848 bits (673), Expect = 1.337e-77
Identity = 202/612 (33.01%), Postives = 311/612 (50.82%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSK--YSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPA--AHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYA-FIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTL---VNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDE 1830
            + NS D  FVFDD  AI +NKDL P+TP S ++ NDFWG+ +    SHKSYRPLTVLTFR NY L G L P G+H +N+ LH ++  L   +       +               S L+A+ FA HP+HTE+V G+VGRA+LL ++FF LS L Y    + +   S+   +  I++ L+L ++  LCKEQ IT L           V +W      I +   +R           +LL++ R +I G   P FT+ DNPA  A + F +R + +NY  S+N  LL CP  LC DW+MG + L+ S  D RIV  L  +A  IGL+   +     +K   TL   L+++V+ FLPASNLF  VGFV+AERVLY  + G+CL++          ++K +     + + LL  + +   +R+  W +E +LF SAL V   NAK+  NVG +L        A++Y+  A +     +        TL   +      +AE   K AL              ++ PKD  +  +L+N+L K + +  E++ +   A+ + P+    + N   +  + G+ + A+  Y  +L+  P +   + N  ++  +L++   
Sbjct:   22 FINSYDGDFVFDDSEAILNNKDLNPDTPLSNIWKNDFWGSNLSSNSSHKSYRPLTVLTFRLNYLLAGGLYPVGFHVLNIGLHCVISALMIDVFATLIGGLACDGTAKRLGHVPKASLLAALFFAAHPVHTESVAGIVGRADLLCALFFQLSFLSYCRAFQGEGMKSDKFSVSWIVVSLLLCAVAMLCKEQGITVL-----------VGVW------ISRGLIIRLALL---LFCGSLLLYARWRIMGTGPPAFTEVDNPASFAENVF-LRIVNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLIKSAGDWRIVWLLLLWACLIGLIKQALCSPDSSKR-RTLTFGLVLLVIPFLPASNLFFRVGFVIAERVLYLSTAGYCLVLAYAGAHCCCRWRKHK---VAAMLALLGMNVVRCAHRSQQWTSEQSLFTSALSVCPLNAKVHYNVGKNLADHGNQSAAIKYYREAVRYACCKILWENKTALTLDLIIKHSNLAQAELIGKEAL--------------KILPKDHTIMFSLANVLGKQQ-KYKESEGFFLNALKINPNAASCHGNLAVLYHRWGKLDLAKKHYELSLKLDPKAPGTNENYNMLKRKLEQRQR 593          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Cavefish
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:ZFIN;Acc:ZDB-GENE-070912-148])

HSP 1 Score: 261.922 bits (668), Expect = 9.236e-77
Identity = 213/621 (34.30%), Postives = 318/621 (51.21%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDII--------------HSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALG--------VCIGLEAYHLV-KLWKMHNVNIDKKYFVRYTRSGIIFMG-----AALLMFLRLKINGKYMPFFTDFDNPA--AHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYA-FIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNL-QRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILL--KLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKR 1821
            + NS D  FVFDD  AI +NKDL P+TP S ++ NDFWG+ +    SHKSYRPLTVLTF  NY L G L P G+H +N+ LH ++  L   +       +               S L+A+ FA HP+HTE+V G+VGRA+LL ++FF LS L Y    +   S+   +  I++ L+L ++  LCKEQ IT LG        V   L+ Y L  KL          K  V  +R  II +       +LL++ R +I G   P FT+ DNPA  A + F +R + +NY  S+N  LL CP  LC DW+MG + L+ S  D RIV  L  +A  IGL+   +       S  TL   L+++V+ FLPASNLF  VGFV+AERVLY  + G+CL++          ++K +K +  + + LL  + +   +R+  W +E +LF SAL V   NAK+  NVG +L        A++Y+                  R  VNL Q  L  +EA K+                   PKD  +  +L+N+L K + +  E++ +   A+ + P   +A    G+++L  + G+ + A+  Y  +L+  P +   + N  ++  +L++
Sbjct:   34 FINSYDGDFVFDDSEAILNNKDLNPDTPLSNIWKNDFWGSNLSSNSSHKSYRPLTVLTFL-NYLLAGGLYPVGFHVLNIGLHCVISALMIDVFATLIGGLACDGTAKRLGHVPKASLLAALFFAAHPVHTESVAGIVGRADLLCALFFQLSFLSYCRAFQGDKSDKFSVSWIVVSLLLCAVAMLCKEQGITVLGVNGVFDILVICNLDIYELTHKLLVRRKTADCLKVGVWISRGLIIRLALLLFCGSLLLYARWRIMGTGPPAFTEVDNPASFAENVF-LRIVNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLIKSAGDWRIVWLLLLWACLIGLIKQALCS--PDSSKRTLTFGLVLLVIPFLPASNLFFRVGFVIAERVLYLSTAGYCLVLAYAGAHCCCRWRKHKKLLQAAMLALLGMNVVRCAHRSQQWTSEQSLFTSALSVCPLNAKVHYNVGKNLADHGNQSAAIKYY------------------REAVNLAQAELIGKEALKIL------------------PKDHTIMFSLANVLGKQQ-KYKESEGFFLNALKINP---NAASCHGNLVLYHRWGKLDLAKKHYELSLKLDPKAPGTNENYNMLKRKLEQ 610          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Sea Lamprey
Match: tmtc3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:ZFIN;Acc:ZDB-GENE-061221-2])

HSP 1 Score: 336.65 bits (862), Expect = 7.219e-108
Identity = 201/440 (45.68%), Postives = 273/440 (62.05%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXX----XXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLR--------------------LKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGL-WLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQV 1308
            Y+NSL CGFVFDD++AI+DNKDLRP TP   L  NDFWGTP+ +E+SHKSYRPLTV TFR NY +  L+PA YHA+N +LH +V +L+ + C +      S ++A LFA+HP+HTEAVTGVVGRAELLSS+FFL + L Y    K   ++I     +     L ++LV++ TLCKEQ +T +GVC   E +    L  + +V    +  V   + G    G  L  ++R                    +++    +P FT FDNPAA S +P RQLT+NYL  +N  LL CP  LCCDWTMGT+ L+ ++ D R + TL  YA +G L+    +R  T     LAM+L ++VL F+PA NLF  VGFVVAERVLY PS+GFC+++ + W +  + H +  +   +   V+LL +H + T +RN DW  EYTLF SAL+V
Sbjct:    2 YYNSLQCGFVFDDISAIRDNKDLRPSTPLVNLLRNDFWGTPMAEEKSHKSYRPLTVFTFRLNYLVSGLDPASYHAVNGVLHWLVCVLYLRACRLLLSPGASRVAAALFALHPVHTEAVTGVVGRAELLSSIFFLSAFLTYTK-SKGPKNSIGTCTTLWWPITLTVLLVALATLCKEQGLTVIGVCCVYEVFVAQGL-TLRDVLSAARAVVVSEKGG----GTGLPPWVRTTAAKLLVLVSSTLLLLLLRVQVIQSQLPVFTKFDNPAAVSGWPARQLTYNYLLPLNAWLLLCPAALCCDWTMGTVPLLVTLADPRNMATLAMYAALGCLA----QRALT-GDRALAMALSLLVLPFIPACNLFFPVGFVVAERVLYVPSMGFCMVVAMGWYR--LSHLRAVRVLTWAGLVLLLATHAVKTVHRNGDWETEYTLFTSALKV 428          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Sea Lamprey
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:ZFIN;Acc:ZDB-GENE-070912-148])

HSP 1 Score: 259.996 bits (663), Expect = 4.104e-76
Identity = 196/634 (30.91%), Postives = 308/634 (48.58%), Query Frame = 1
Query:   73 SLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHS---------FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXX--XXXXXXXXXXXXCKEQCITALGV--------------------CIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLG-VVNIELKRNDEAL--SCFHTSLQLD 1866
            S D  FVFDD  A+  NKDL+PETP S+L+ +DFWG  +    SHKSYRPLTVLTFR+NY+  G LNP G+H +N+ LH++V  L + +C +      S          L++++FAVHP+H E+V GVVGRA+LL ++FF LS + Y             +     +L + L ++ TLCKEQ +T +GV                     I  + + L K+  +     + +  ++ T+ G    G    +  R  + G   P FT  DNPAA +     R + +NYL ++N  LL  P  LC DW+MG + L+++ +D RIV  LC +  +G LS+  ++  +      L ++L+++++ F PA+N+ + VGFV+AERVLYT + G  L++   L +  +   + ++ +   +++L+  H   + +R+  WR+E  LF SAL V   NAK+  N+G +         A+ Y+  A    P  V    N+G  L    +  EAE+  + A+   P                                                 DF  A+ N G +    G    A   ++TAL++R    D +YNLG +V  + + +  A   +C  T L+ D
Sbjct:   36 SYDGAFVFDDSEAVVGNKDLKPETPLSSLWTDDFWGGRLSSNTSHKSYRPLTVLTFRFNYWASGGLNPTGFHLVNIALHSVVSALLYDVCCLLVGWRGSRGSPACRTALLASVMFAVHPVHAESVAGVVGRADLLCALFFFLSFISYAAAFTGSEHGAASVSATWIVLSVTLSAVATLCKEQGVTVIGVRNYFDILWVGKFIIVSVITTVIVCDEHELKKITLLRQSGFENRVVLQ-TQGG----GGGDRLAARWWVMGGGAPAFTPDDNPAAFADGLLTRVVNYNYLYALNAWLLLDPQWLCFDWSMGCVPLISAASDWRIVAPLCLWLALGALSLRALRARDESERRRLLLALVLLLVPFAPAANVLVRVGFVLAERVLYTSAAGHALLVTHGLSRLARRRPRHKRLLGVLWLLLVALHVSRSVHRSAQWRSEEELFSSALHVCPRNAKVHYNIGKNSADNGDERTAIAYYGRALSLHPAYVQPMNNLGNILKGAGKLHEAEQLLRRAVQIQP-------------------------------------------------DFAAAWMNLGIVQNSRGDFLTAEQSFLTALRHRKQYPDCYYNLGRLVRPQARASPAACARACHATILRDD 615          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007591.1 (pep scaffold:Pmarinus_7.0:GL480573:24572:27393:-1 gene:ENSPMAG00000006852.1 transcript:ENSPMAT00000007591.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.328 bits (573), Expect = 1.590e-66
Identity = 129/307 (42.02%), Postives = 187/307 (60.91%), Query Frame = 1
Query: 1531 GQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSED--KEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYS 2445
            G+ Y+ RV+P  LNV+++L++++  N++RL EAD+  R+AI+MRPDF  AY +RG++LLK+ R  EAR  Y  A+    ++ADL YNL +V+IEL++  +AL+ F  +L L  +H+ A  + A    E    E  EEA        + E   EK +F L M+ TD      AE+    ++   P  RG+LFNLALL      + D AL +L +LLE++P H K  +L GD+LLN + D   A   FQ+A   EP N+QAKHNLCVVM E+ +L  A  CL EA+ ++P E YI++HL +V  +L  S
Sbjct:    2 GRKYSARVAPNHLNVYLHLASIIRTNESRLQEADSLYRQAIAMRPDFTQAYISRGELLLKMQRLPEARAAYEKAVALDGDNADLWYNLAIVHIELRQPRDALAHFERALALKPAHRLALFNSALLIQETGASELLEEAHGRLLRYAELEPSDEKAYFNLGMVATDMGRADEAERWLRRAVALRPDFRGALFNLALLLVQSRHELD-ALPVLEQLLEHHPQHAKALVLQGDVLLNRRGDAAGARRAFQRALAAEPGNSQAKHNLCVVMFEEGELARAHDCLREALAMAPGEEYIRRHLAVVAAKLASS 307          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Sea Lamprey
Match: tmtc1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:ZFIN;Acc:ZDB-GENE-070705-219])

HSP 1 Score: 221.09 bits (562), Expect = 2.293e-63
Identity = 181/511 (35.42%), Postives = 266/511 (52.05%), Query Frame = 1
Query:   70 NSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILF--FQLCTIYFDIIHS-----FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSN--IKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYT---------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGL---LSIIVIKRIET-KSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQK-SIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLF----MSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMP 1518
            NSL   FV DD+ AI  N D +P  P S L  +DFWG  +R   SHKSYRP  VLTFR N +LG ++P G+H +NV LHA   + F  F    ++     S     +L+A LFAVHP+HTEAV+G+VGRA++L+ + FL S   Y+   + ++     +    + L L+L     L KE  +TALG  +   AY  + L ++    I  K  ++ T         R G +  G  LL  ++  + G  +P F + DNPA+ SP  + R LT++YL ++N  LL CP  L  DW  G++ L+TS  D R++      A  GL   L II ++   T +    L   LL++VL FLPASNLF  VGFV+AER+LY PS+G CL++   L    ++   + +  +  + + LL      T  RN  WR+   LF     S ++   +NAK   N  + L  + + E A +++  A    P    +  N+G TL +      AE  ++ AL+  P
Sbjct:   22 NSLQGDFVHDDLLAIVGNPDAQPGAPLSRLMGHDFWGKSMRSPTSHKSYRPFCVLTFRLNVWLGGMHPWGFHVLNVCLHAATCVAFAGFGRSVLWPPAERSLPGAPWLAAALFAVHPVHTEAVSGIVGRADVLACLLFLASFCAYVRCSRRRHCCPVTESPGLLALSLLLGGAAMLVKETGVTALGAAL---AYDALVLSRLPPCRIVFKKSLKDTPLEEGNGQWRRGGLCSGMVLLPLIKWSVMGAKLPAFMEQDNPASFSPHRLTRFLTYSYLCALNAWLLLCPRTLSYDWQAGSVELLTSARDPRVL------APTGLALGLGIIAMRCARTPQERRVLTAGLLLLVLPFLPASNLFFRVGFVMAERILYLPSMGSCLLVTHALTSLYLRAGARARPPVAAAALCLLALFAAKTLQRNQVWRSREALFRHGCRSGVETLPHNAKAHYNYANLLRDKGETERARQHYRAALSLCPGHASALNNLG-TLAH--ELGHAESLYRRALAAAP 520          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Sea Lamprey
Match: tmtc1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:ZFIN;Acc:ZDB-GENE-070705-219])

HSP 1 Score: 218.779 bits (556), Expect = 1.593e-62
Identity = 174/509 (34.18%), Postives = 263/509 (51.67%), Query Frame = 1
Query:   70 NSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILF--FQLCTIYFDIIHS-----FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKS---KYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL---------WKM-HNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQK-SIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLF----MSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMP 1518
            NSL   FV DD+ AI  N D +P  P S L  +DFWG  +R   SHKSYRP  VLTFR N +LG ++P G+H +NV LHA   + F  F    ++     S     +L+A LFAVHP+HTEAV+G+VGRA++L+ + FL S   Y+ + +         +    + L L+L     L KE  +TALG  +  +A  L +L         W    + ++   Y     R  +  +   LL+  RL + G  +P F + DNPA+ SP  + R LT++YL ++N  LL CP  L  DW  G++ L+TS  D R++        +G++++   +  + +    L   LL++VL FLPASNLF  VGFV+AER+LY PS+G CL++   L    ++   + +  +  + + LL      T  RN  WR+   LF     S ++   +NAK   N  + L  + + E A +++  A    P    +  N+G TL +      AE  ++ AL+  P
Sbjct:   24 NSLQGDFVHDDLLAIVGNPDAQPGAPLSRLMGHDFWGKSMRSPTSHKSYRPFCVLTFRLNVWLGGMHPWGFHVLNVCLHAATCVAFAGFGRSVLWPPAERSLPGAPWLAAALFAVHPVHTEAVSGIVGRADVLACLLFLASFCAYVRLSQECGRAGHGHRSPGLLALSLLLGGAAMLVKETGVTALGAALAYDALVLSRLPPCREKETAWHTGRSWDLLHGYKPLLKRGAVTVLWLVLLLAFRLAVMGAKLPAFMEQDNPASFSPHRLTRFLTYSYLCALNAWLLLCPRTLSYDWQAGSVELLTSARDPRVLAPTGLALGLGIIAMRCARTPQVEERRVLTAGLLLLVLPFLPASNLFFRVGFVMAERILYLPSMGSCLLVTHALTSLYLRAGARARPPVAAAALCLLALFAAKTLQRNQVWRSREALFRHGCRSGVETLPHNAKAHYNYANLLRDKGETERARQHYRAALSLCPGHASALNNLG-TLAH--ELGHAESLYRRALAAAP 529          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Nematostella
Match: EDO43484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL8])

HSP 1 Score: 335.109 bits (858), Expect = 5.753e-103
Identity = 247/726 (34.02%), Postives = 365/726 (50.28%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGE-LNPAGYHAINVILHAIVVILFFQLCTIYF-DIIH---------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNI--KDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVR------------------YTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAA-HSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEA 2145
            Y+NS +  FVFDD  AI +NKDLRPE P  TLF +DFWG  +    SHKSYRPLTVLTFR NY+L    +P G+H +NV+LHA+V +L  ++  ++F D +          SFL +++FAVHP+HTE+V GVVGRA+LL ++FF LS L Y+    +         +  +LL +VL ++  LCKEQ ITALG+C    AY L+ + K+  V + +  F +                  Y +  ++  G +LL+  R +I G   P F   DNPA+       R + +NY+ S+N+ LL  P  LC DW+MG I L+ S  DVRI+  L  +  +G L +      +      L + L  +++ FLPASN F  VGFVVAERVLY  S+G CL++ L    +I      +K +  +   +LL +++ T  R  +W  E  LF S   V   NAK+                                  H N+G+     QR  EA   ++ A+              R++P   +   NL NLL K K  + EA+  L RA+     F   + N G +   L + +EA   Y  A++YR    D  +NLG + I+  R+ EA++ F  +++L   H  A ++      +  +KR E   + Y+ +K   +    HF L  M   +K F+ AEKH+L +L+ +P       NL +LY +   K +EA
Sbjct:   65 YWNSCNGDFVFDDSEAILNNKDLRPEAPIWTLFIHDFWGGKLDSNESHKSYRPLTVLTFRLNYWLANGYHPWGFHFVNVVLHAVVSMLSLRIYAVFFEDRVRMKTGQVSQASFLCSLIFAVHPVHTESVAGVVGRADLLCALFFFLSFLCYVKCCSASADEPIQSSLNYLLLSVVLCAVAMLCKEQGITALGICC---AYDLIIVCKVDIVRVLQNAFRKKKPLPTEQEDISWMRGLFYRQFALVLTGVSLLI-ARWQIMGSAPPRFQVSDNPASFEKSLLSRFINYNYIYSINIWLLVHPWWLCFDWSMGCIPLIQSAKDVRILAVLAMWVSLGGLMLYCFFGKDLYFRRLLTIGLAFLIVPFLPASNFFFRVGFVVAERVLYLSSVGSCLIVVLG-AVAISRKPPMRKALSVAVSAVLLFYSIRTVQRTSEWLTEEKLFTSGQAVCPLNAKV----------------------------------HYNIGKVRSTQQRDEEALAYYREAV--------------RLNPTYSDALNNLGNLL-KEKGEISEAEKLLERAVDSSKAFAAGWMNLGTVKAALNKMQEAETCYKNAIRYRKKYPDAFFNLGNLYIDWNRDAEAVAAFRKAVKLKSDHVGAWMN-HILLLDKTDKRTEGIELAYEALKHIPDESSIHFNLGNMLGQEKRFKEAEKHFLRALELNPVQPEIRGNLGVLY-HRWGKLNEA 734          

HSP 2 Score: 59.3066 bits (142), Expect = 5.468e-9
Identity = 56/232 (24.14%), Postives = 109/232 (46.98%), Query Frame = 1
Query: 1765 PNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFA----LAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKG---HLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            P +A +HYN+G V    +R++EAL+ +  +++L+ ++  A  +L +   E  E  E  K     L++   +S K   A    L  ++      Q AE  Y ++++Y      + FNL  LY  +  +  EA+    + ++   +HV     H+LL D        +  A+    +A +  P  +    NL  ++ ++ +  EAE     A++L+P +  I+ +L ++ +R G
Sbjct:  508 PLNAKVHYNIGKVRSTQQRDEEALAYYREAVRLNPTYSDALNNLGNLLKEKGEISEAEK-----LLERAVDSSKAFAAGWMNLGTVKAALNKMQEAETCYKNAIRYRKKYPDAFFNLGNLYI-DWNRDAEAVAAFRKAVKLKSDHVGAWMNHILLLDKTDKRTEGIELAY----EALKHIPDESSIHFNLGNMLGQEKRFKEAEKHFLRALELNPVQPEIRGNLGVLYHRWG 729          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Nematostella
Match: EDO39963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8L8])

HSP 1 Score: 260.766 bits (665), Expect = 3.976e-77
Identity = 193/596 (32.38%), Postives = 303/596 (50.84%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHS-----FLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXX------------------XXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLW------------KMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPF-FTDFDNPAAHSPFP-IRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIG------LLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVV---LLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKL 1713
            + NSL    VFDD   I  N D+RP +  +++F NDFWG P+    SHKSYRP T+LTFR NY +  L P GYH +NV +H  V +LF   C + F  + S      L+ ++FA+HPIHTEAV  V GRA++  ++F+LLS   +++  KS + ++                           L+   +  L KEQ +T L +C+  +  ++  +             +  + + +K+  V   R  II      L+++R+ I G  +P  F + DNP    P    R  T++++ + N   L  P  LC DW+M +I  V SI D R    L ++ F+       LLS I   R    +   +   L+++V+ FLPASNLF+ VGFV+AERVLY PS+G+C+++ L ++ +    +   K    + V+   LLL+    T +RN +W +  TL  S L+VN  NAK+   +G+    +K      +++  + K +P+ V + +N+G  LVN  R  EAE A+ +ALS   +P    A T            N+++LL +   R +EA    ++AIS+RP     +   G++L KL
Sbjct:   12 FLNSLPGELVFDDHEVIATNLDVRPHSSLTSIFRNDFWGEPLDSNHSHKSYRPATILTFRLNYLIHGLQPLGYHVVNVGMHVAVSVLFVSACDVIFQGLTSSDSATLLAGLIFAIHPIHTEAVANVTGRADVQCALFYLLS---FLSFTKSPHPSLHGSSRTNPSLHDGCRPASYSKPWMAACLLFSVVALLSKEQGVTVLAICVIYDVIYVCNITMGTVKELMFCTERHKSSHTNKRSLVE--RVIIISAFCIFLLYIRIVIIGGGLPTSFVESDNPTYFHPDKWTRVRTYSFILAKNAWFLMVPSSLCYDWSMDSIPRVESIWDER---NLISFGFLSYCHSGPLLSAIAYSR----NGRIVLFGLVMVVVPFLPASNLFVPVGFVIAERVLYIPSMGYCVLLSLGIRVTCGIMESASKDEEETNVLVYTLLLTFAAKTVHRNSEWYDTGTLAASGLRVNPENAKIHLTMGNYFA-KKGLLLCEKFYRQSIKLRPHYVTAWVNLGLVLVNTDREKEAESAYNIALSL--KPNSADANT------------NMAHLL-RVTNRHMEAIEQYKKAISLRPSDPMLHFQYGNVLEKL 579          

HSP 2 Score: 58.5362 bits (140), Expect = 7.078e-9
Identity = 33/108 (30.56%), Postives = 59/108 (54.63%), Query Frame = 1
Query: 1549 RVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRS 1872
            RV+P++  + + + N   K    LL  + + R++I +RP +V A+ N G +L+   R +EA + Y  AL  +PNSAD + N+  +     R+ EA+  +  ++ L  S
Sbjct:  459 RVNPENAKIHLTMGNYFAKKG--LLLCEKFYRQSIKLRPHYVTAWVNLGLVLVNTDREKEAESAYNIALSLKPNSADANTNMAHLLRVTNRHMEAIEQYKKAISLRPS 564          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Nematostella
Match: EDO39747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9A3])

HSP 1 Score: 194.126 bits (492), Expect = 1.237e-51
Identity = 131/326 (40.18%), Postives = 186/326 (57.06%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIV----VILFFQLCTIYFDIIHSFLSAILFAVHPIHT-EAVTGVVGRAEXXXXXXXXXXXXIYIN------IVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKL-WKMHNVNIDKK-YFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHS-PFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKR 999
            Y N+LD  FV+DD  AI  N DL P TP+  L +NDFWGTP+    SHKSYRP+ + +FR NY +GELNP GYH +N +LH +V    V+L + L   +   +   +  +LFA HPIHT +AV GVVGRA++ + +F + S L YI        V S+++ ++    +L  LVL ++  LCKEQ +T LGVC   E  ++ KL  K    +++K  +    TR   + + A  L+ LR+ + G   P F+  DNPA+ S  F  R LTF YL + N  LL  P  L  DW+M  I L+ ++ DVR V T+  Y     L +  ++R
Sbjct:   23 YLNTLDAEFVYDDSRAILKNADLLPTTPWINLLFNDFWGTPLTHSGSHKSYRPICIASFRLNYAIGELNPGGYHLVNTLLHGMVCWLTVVLSYNLVDSH---VVGVVGGLLFATHPIHTGKAVAGVVGRADVGACLFLIASFLCYIKSCAHPLTVGSRHTRLR---WLLGSLVLAALSMLCKEQGVTVLGVCAVHEVVYVSKLNGKTLRSSVNKALHRGMATRLLSLAVTAICLIVLRMFLMGNSPPEFSPSDNPASSSESFLTRTLTFLYLPAFNFLLLLYPRTLSFDWSMEAIPLIENVLDVRNVLTVTFYVCFISLGLYSLRR 342          

HSP 2 Score: 134.42 bits (337), Expect = 2.695e-32
Identity = 128/443 (28.89%), Postives = 205/443 (46.28%), Query Frame = 1
Query: 1024 LAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQ-KFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIK-NKTRLLEADAYLRRAISMRPD-----FVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLH--YNL-GVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSE-DKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDI--LLNYKRDLPAAFLNFQKASELEPKNAQAKHNL 2313
            +  SL I+VL F+PASN+F  VGFVVAERVLY PS+GFC+M+G+ +      F    ++ +     V+++     T  RN DW+NE  L+ S + VN   AK W N+G+ L ++ +  +A   +  A   + N   +H N+G  L   +R+ +A ++++ A++F P          R++   LN+ I L  +  K +  R+L+  + +       P            N G IL  LGR EE    Y   ++ RP   + H  YN+ G    +    DEA   +  SL+   SH PA L+LA  YS+  + K+ EA  +    +     S   H+   + E   K    A + ++ + K  P     +FN A  Y  E + ++ A       ++        H+ LG I  LL   ++    +L    A EL P +   + NL
Sbjct:  418 IVTSLAIIVLPFVPASNVFFYVGFVVAERVLYIPSVGFCIMVGVGVGGMWSRFSNSGRRVVLVVVGVVVVLFAAKTMQRNLDWKNEEALYRSGIDVNP--AKAWGNLGNVLGNQGRTNEAEMAYRKALSYRSNMADTHYNLGILLAGQKRYKDAIQSYENAITFRP----------RLAVAHLNLGIVLDQVGRKEDAIRILKNASTISGHGLKDPKQHSHAIASIKYNLGRILTDLGRIEEGLTVYQDVVRTRPAHFEPHSLYNMIGEAYTKAGLLDEAEKWYKRSLESKPSHVPAHLTLAKLYSKTGRTKQAEALFLKAQSLGPRDVSVWTHYGQHLYE--GKQVARAAEMFVKASKLAPDDFDIVFN-AANYLRESESYETAEEFYRSAVKLDQKSNIAHMNLGAILHLLGKHQESERYYLT---ALELNPGDTMTRENL 842          

HSP 3 Score: 78.5666 bits (192), Expect = 7.001e-15
Identity = 86/314 (27.39%), Postives = 133/314 (42.36%), Query Frame = 1
Query: 1540 YTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTS-------LQLDRSHKPARLSLASFYSE---DKEKREEAKSIYYDLIK---AEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELK-KFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            Y + +       + NL N+L  N+ R  EA+   R+A+S R +  D + N G +L    R ++A   Y  A+ +RP  A  H NLG+V  ++ R ++A+     +       L+  + H  A  S+         D  + EE  ++Y D+++   A FE    +  +    T       AEK Y  SL+  P+   +   LA LY+   + K  EAL L  + L   P  V      G  L   K+   AA + F KAS+L P +     N    + E      AE     AVKL    N    +L  + + LG
Sbjct:  507 YRSGIDVNPAKAWGNLGNVL-GNQGRTNEAEMAYRKALSYRSNMADTHYNLGILLAGQKRYKDAIQSYENAITFRPRLAVAHLNLGIVLDQVGRKEDAIRILKNASTISGHGLKDPKQHSHAIASIKYNLGRILTDLGRIEEGLTVYQDVVRTRPAHFEPHSLYNMIGEAYTKAGLLDEAEKWYKRSLESKPSHVPAHLTLAKLYSKTGRTKQAEALFLKAQSLG--PRDVSVWTHYGQHLYEGKQVARAAEM-FVKASKLAPDDFDIVFNAANYLRESESYETAEEFYRSAVKLDQKSNIAHMNLGAILHLLG 816          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Nematostella
Match: EDO39962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8L7])

HSP 1 Score: 133.65 bits (335), Expect = 2.653e-36
Identity = 62/131 (47.33%), Postives = 81/131 (61.83%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHS-----FLSAILFAVHPIHTEAVTGVVGRAE 441
            + NSL    VFDD   I  N D+RP +  +++F NDFWG P+    SHKSYRP T+LTFR NY +  L P GYH +NV +H  V +LF   C + F  + S      L+ ++FA+HPIHTEAV  V GRA+
Sbjct:   10 FLNSLPGELVFDDHEVIATNLDVRPHSSLTSIFRNDFWGEPLDSNHSHKSYRPATILTFRLNYLIHGLQPLGYHVVNVGMHVAVSVLFVSACDVIFQGLTSSDSATLLAGLIFAIHPIHTEAVANVTGRAD 140          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Nematostella
Match: EDO47073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN48])

HSP 1 Score: 101.679 bits (252), Expect = 5.044e-22
Identity = 110/394 (27.92%), Postives = 178/394 (45.18%), Query Frame = 1
Query: 1219 VLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNN--AKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAE--FESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSP 2388
            VLLL  +++   R  D     +   S L + QN   A+ ++N+G+  +   + +DAL  +  A K +P+ +  +IN+   LV       A  A+  AL + P       Y  R          +L NLL K   RL EA A   +AI  +P F  A+ N G +    G    A + +  A+Q  PN  D + NLG V  E +  D A++ +  +L L  +H     +LA  Y E +   + A   Y   I+ +  F    C+ A A+ E        AE+ Y  +L+  PT   SL NLA +   E  K +E++ L  + LE +P     H  L  +L    + L  A L++++A  + P  A A  N+  ++ E   +  A  C + A++++P
Sbjct:   53 VLLLLSSIHFQCRRLD----RSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNP-----DLYCVRS---------DLGNLL-KALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYE-QGLIDLAVDTYRRAIELQPNFPDAYCNLANALKE--QGKVSEAEECYNTALQLSPTHADSLNNLANI-KREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGK-LQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINP 422          

HSP 2 Score: 75.0998 bits (183), Expect = 9.189e-14
Identity = 90/386 (23.32%), Postives = 157/386 (40.67%), Query Frame = 1
Query: 1288 FMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYS 2445
            ++ A++   + A  W+N+G     + +   A+ +F  A +  PN + ++IN+G  L   + F  A  A+  AL+              +SP    V  NL+ +  +     L  D Y RRAI ++P+F DAY N  + L + G+  EA   Y TALQ  P  AD   NL  +  E  + +E++  +  +L+                                 I  EF +   H  LA +       Q A  HY  +++  PT   +  N+  L   E++    A+   +R ++  P     H  L  +  +   ++P A  +++ A +L+P    A  NL               CL      +  +N +K+ +NIV  +L ++
Sbjct:  176 YLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALN--------------LSPNHAVVHGNLACVYYEQGLIDLAVDTY-RRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALE---------------------------------IFPEFAA--AHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLL-KEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKD-SGNIPEAIQSYRTALKLKPSFPDAYCNLA-------------HCLQIICDWTDYDNRMKKLVNIVAEQLEHN 496          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Medaka
Match: tmtc3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:NCBI gene;Acc:101175547])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 391/807 (48.45%), Postives = 523/807 (64.81%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLE-----AYHLVKLWKMHNVNIDKK----YFVRYT--RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMI--GLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKR--EEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            Y+NSL CGFVFDDV+AI DNKDLRP TP   LF NDFWGTP+ +ERSHKSYRPLTVLTFR NY   EL+ A YH +N+ILHA V +LF ++C ++ D     ++A+LFAVHPIHTEAVTGVVGRAELLSS+F L + L Y     + +S +     I L +VLV+  TLCKEQ IT +G+C   E      + L  L       +  K    Y V  T  +  ++ +   LL+ +R+++    +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI LV S+ D+R + TL  Y  +  L      R    S++ + M+L  MVL F+PA NLF  VGFVVAERVLY PS+GFC++I  G  +  +I   +K    + G   VLL +H + T+ RN+DW +EYTLF SAL+VN+NNAKLWNNVGH+LE++  +E ALRYF+ A++ QP+D+G+H+NVGRT  NL R  EAEEA+ VA S MPQ   G+ Y TRV+P  LNV+INL+NL+  N +RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +AR+ Y+ AL+   N+ADL YNL +VNIE+K   EAL  F+ +L+L   HK A  + A    E  E +   EA   +   ++ E      +F L M+  D      AE+    ++      R +LFNLALLY ++ K+  +AL +L+ LL+++P H+KG +L GDIL+N+K+D   A   F++   ++P N Q KHNLCVV  E+  L  AE CL E + L+PNE Y+++HL+IVRN++ 
Sbjct:   20 YWNSLSCGFVFDDVSAILDNKDLRPATPLHNLFLNDFWGTPMTEERSHKSYRPLTVLTFRLNYLFSELSAASYHLLNIILHAAVCVLFLRVCRLFLDKTSGLVAALLFAVHPIHTEAVTGVVGRAELLSSIFLLAAFLSYTKSTGADHSIV--WTPIALTVVLVAAATLCKEQGITVVGICCVYEVFIAQGFTLPMLMDTLRQILRGKDGFPYAVLQTLLKLIVLIISTLLLVIIRVQVIQSQLPVFTRFDNPAAVSSTPSRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLVDSVLDLRNLATLAFYVLL-GLLAHHGLRYRHNSAKAVVMALSFMVLPFIPACNLFFPVGFVVAERVLYVPSMGFCVLIAHGFKIVSNIGQMKKISWLMIG---VLLTTHAVKTFNRNWDWESEYTLFTSALKVNKNNAKLWNNVGHALENQNSYERALRYFLQATRVQPDDIGAHMNVGRTYKNLNRSKEAEEAYLVAKSLMPQVIPGKKYATRVAPNHLNVYINLANLIRANDSRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKLTDARDAYLRALELDRNNADLWYNLAIVNIEMKEPAEALKNFNHALELSPRHKLALFNSALLMQESGEPKFWPEANRRFLMYVEEEPNDANGYFNLGMLAMDANENTAAERWMRKAISLQAGFRSALFNLALLY-SQTKRETDALPVLDELLQHHPEHIKGLILKGDILMNHKKDTRGAKTCFERILSMDPTNVQGKHNLCVVYFEERDLPRAERCLEETLALAPNEEYVRRHLSIVRNKMA 819          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Medaka
Match: tmtc3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:NCBI gene;Acc:101175547])

HSP 1 Score: 531.176 bits (1367), Expect = 1.829e-176
Identity = 321/728 (44.09%), Postives = 442/728 (60.71%), Query Frame = 1
Query:  337 CTIYFDIIHSFL-SAILFAVHPIHT-----------EAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLE-----AYHLVKLWKMHNVNIDKK----YFVRYT--RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMI--GLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKR--EEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLG 2439
            C   FD + + L +  L    P+H              VTGVVGRAELLSS+F L + L Y     + +S +     I L +VLV+  TLCKEQ IT +G+C   E      + L  L       +  K    Y V  T  +  ++ +   LL+ +R+++    +P FT FDNPAA S  P RQLTFNYL  VN  LL  P +LCCDWTMGTI LV S+ D+R + TL  Y  +  L      R    S++ + M+L  MVL F+PA NLF  VGFVVAERVLY PS+GFC++I  G  +  +I   +K    + G   VLL +H + T+ RN+DW +EYTLF SAL+VN+NNAKLWNNVGH+LE++  +E ALRYF+ A++ QP+D+G+H+NVGRT  NL R  EAEEA+ VA S MPQ   G+ Y TRV+P  LNV+INL+NL+  N +RL EAD   R+AISMRPDF  AY +RG++LLK+ +  +AR+ Y+ AL+   N+ADL YNL +VNIE+K   EAL  F+ +L+L   HK A  + A    E  E +   EA   +   ++ E      +F L M+  D      AE+    ++      R +LFNLALLY ++ K+  +AL +L+ LL+++P H+KG +L GDIL+N+K+D   A   F++   ++P N Q KHNLCVV  E+  L  AE CL E + L+PNE Y+++HL+IVRN++ 
Sbjct:   26 CGFVFDDVSAILDNKDLRPATPLHNLFLNDFWGTPMTEVTGVVGRAELLSSIFLLAAFLSYTKSTGADHSIV--WTPIALTVVLVAAATLCKEQGITVVGICCVYEVFIAQGFTLPMLMDTLRQILRGKDGFPYAVLQTLLKLIVLIISTLLLVIIRVQVIQSQLPVFTRFDNPAAVSSTPSRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLVDSVLDLRNLATLAFYVLL-GLLAHHGLRYRHNSAKAVVMALSFMVLPFIPACNLFFPVGFVVAERVLYVPSMGFCVLIAHGFKIVSNIGQMKKISWLMIG---VLLTTHAVKTFNRNWDWESEYTLFTSALKVNKNNAKLWNNVGHALENQNSYERALRYFLQATRVQPDDIGAHMNVGRTYKNLNRSKEAEEAYLVAKSLMPQVIPGKKYATRVAPNHLNVYINLANLIRANDSRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKLTDARDAYLRALELDRNNADLWYNLAIVNIEMKEPAEALKNFNHALELSPRHKLALFNSALLMQESGEPKFWPEANRRFLMYVEEEPNDANGYFNLGMLAMDANENTAAERWMRKAISLQAGFRSALFNLALLY-SQTKRETDALPVLDELLQHHPEHIKGLILKGDILMNHKKDTRGAKTCFERILSMDPTNVQGKHNLCVVYFEERDLPRAERCLEETLALAPNEEYVRRHLSIVRNKMA 746          

HSP 2 Score: 79.337 bits (194), Expect = 1.104e-14
Identity = 32/44 (72.73%), Postives = 36/44 (81.82%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQ 195
            Y+NSL CGFVFDDV+AI DNKDLRP TP   LF NDFWGTP+ +
Sbjct:   20 YWNSLSCGFVFDDVSAILDNKDLRPATPLHNLFLNDFWGTPMTE 63          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Medaka
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:NCBI gene;Acc:101159145])

HSP 1 Score: 301.597 bits (771), Expect = 4.333e-90
Identity = 244/727 (33.56%), Postives = 370/727 (50.89%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXX---XXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTR---SGIIFMGAAL-----------LMFLRLKINGKYMPFFTDFDNPAA-HSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNK-TRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDE 2142
            + NS D  FVFDD  AI +NKDLRP TP S+++ NDFWG+ +R   SHKSYRPLTVLTFR N+ L G L+P G+H +N+ILHA++  L   +  I    +               SFL+ + FA HP+HTE+V G+VGRA+LL ++FF LS L Y     +K S+  D   +  V V +   +   LCKEQ IT LGV     A+ ++ +  ++   + ++   R      S I+ MG              +++ R +I G   P FT+ DNPA+      IR L +NY  S+N  LL CP  LC DW+MG + L+ S TD R+V  L  + F+  L    +   +++   TL + L+++V+ FLPA N+F  VGFV+AERVLY  S G+CL++   L      + +++K +    + LL  +      R+  WR+E +LF SAL V   NAK+  NVG +L        A+RY+  A +  P  V +  N+G  L      +EAE+    A+S   Q     A+            +NL   +++N   +  EA+     AI  R  + D Y N G +     R  +A N +  A   +P+ +    N+ ++   L    +A      +L++  +      SLA+   +  EK +E++S +   ++    +  CH  LA++       +LA+KHY  SLK DP + G+  N    YN  L+K D+
Sbjct:   43 FCNSYDGEFVFDDSEAIVNNKDLRPTTPLSSIWCNDFWGSNLRSNSSHKSYRPLTVLTFRLNHLLAGGLHPVGFHVLNIILHAVISALMIDVFAILIGGLGRDEDGQRLNLAPKTSFLAGLFFAAHPVHTESVAGIVGRADLLCALFFQLSFLTYCKAF-NKGSDRDDSFSVHWVAVSLLLCAAAMLCKEQGITVLGVN---AAFDVLLICNVNVYELSQRLLFRKNSLAFSEILSMGLLRRLGLLGLGGISMLYSRWRIMGTGPPAFTEVDNPASFEESILIRILNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLIKSATDWRMVWLLLLWCFLLGLIGQALCSQDSQRRRTLTLGLVLLVVPFLPACNVFFRVGFVIAERVLYLSSAGYCLLLAYSLGHCCCRWTRYKKLLLALTLALLCVYVARCALRSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNTTAAVRYYREAVRLHPTYVHAMNNLGNILKEKNELIEAEQLLSKAVSI--QSDFAAAW------------MNLG--IVQNSLQKFEEAEQSYLNAIRFRRKYPDCYYNLGRLYADQNRHVDALNAWRNATVLKPDHSLAWNNMVILLDNLGNLAQAELIGREALRIVPNDHTIMFSLANVLGK-LEKYKESESFFLHALQINPNAASCHGNLAVLYHRWGKLELAKKHYELSLKLDPEAAGTKDN----YNMLLRKLDQ 744          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Medaka
Match: tmtc4 (transmembrane O-mannosyltransferase targeting cadherins 4 [Source:NCBI gene;Acc:101159145])

HSP 1 Score: 301.597 bits (771), Expect = 4.333e-90
Identity = 244/727 (33.56%), Postives = 370/727 (50.89%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFL-GELNPAGYHAINVILHAIVVILFFQLCTIYFDIIH--------------SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXX---XXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTR---SGIIFMGAAL-----------LMFLRLKINGKYMPFFTDFDNPAA-HSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNK-TRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDE 2142
            + NS D  FVFDD  AI +NKDLRP TP S+++ NDFWG+ +R   SHKSYRPLTVLTFR N+ L G L+P G+H +N+ILHA++  L   +  I    +               SFL+ + FA HP+HTE+V G+VGRA+LL ++FF LS L Y     +K S+  D   +  V V +   +   LCKEQ IT LGV     A+ ++ +  ++   + ++   R      S I+ MG              +++ R +I G   P FT+ DNPA+      IR L +NY  S+N  LL CP  LC DW+MG + L+ S TD R+V  L  + F+  L    +   +++   TL + L+++V+ FLPA N+F  VGFV+AERVLY  S G+CL++   L      + +++K +    + LL  +      R+  WR+E +LF SAL V   NAK+  NVG +L        A+RY+  A +  P  V +  N+G  L      +EAE+    A+S   Q     A+            +NL   +++N   +  EA+     AI  R  + D Y N G +     R  +A N +  A   +P+ +    N+ ++   L    +A      +L++  +      SLA+   +  EK +E++S +   ++    +  CH  LA++       +LA+KHY  SLK DP + G+  N    YN  L+K D+
Sbjct:   43 FCNSYDGEFVFDDSEAIVNNKDLRPTTPLSSIWCNDFWGSNLRSNSSHKSYRPLTVLTFRLNHLLAGGLHPVGFHVLNIILHAVISALMIDVFAILIGGLGRDEDGQRLNLAPKTSFLAGLFFAAHPVHTESVAGIVGRADLLCALFFQLSFLTYCKAF-NKGSDRDDSFSVHWVAVSLLLCAAAMLCKEQGITVLGVN---AAFDVLLICNVNVYELSQRLLFRKNSLAFSEILSMGLLRRLGLLGLGGISMLYSRWRIMGTGPPAFTEVDNPASFEESILIRILNYNYYYSLNAWLLLCPWWLCFDWSMGCVPLIKSATDWRMVWLLLLWCFLLGLIGQALCSQDSQRRRTLTLGLVLLVVPFLPACNVFFRVGFVIAERVLYLSSAGYCLLLAYSLGHCCCRWTRYKKLLLALTLALLCVYVARCALRSQQWRSEQSLFTSALSVCPLNAKVHYNVGKNLADRGNTTAAVRYYREAVRLHPTYVHAMNNLGNILKEKNELIEAEQLLSKAVSI--QSDFAAAW------------MNLG--IVQNSLQKFEEAEQSYLNAIRFRRKYPDCYYNLGRLYADQNRHVDALNAWRNATVLKPDHSLAWNNMVILLDNLGNLAQAELIGREALRIVPNDHTIMFSLANVLGK-LEKYKESESFFLHALQINPNAASCHGNLAVLYHRWGKLELAKKHYELSLKLDPEAAGTKDN----YNMLLRKLDQ 744          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Medaka
Match: tmtc1 (transmembrane O-mannosyltransferase targeting cadherins 1 [Source:NCBI gene;Acc:101165117])

HSP 1 Score: 290.426 bits (742), Expect = 5.120e-85
Identity = 255/848 (30.07%), Postives = 398/848 (46.93%), Query Frame = 1
Query:   64 YFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIY-FDIIH-SFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYS-----NIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYT------RSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPI-RQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSH-TMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKRE--------------------------------EAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPN----HVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSN 2454
            Y NSL    V DDV AI +N D+R  +   ++F NDFWG  +    SHKSYRPL VLTF+ N  LG L P  +H +NV LH     L    C  + F   H +F++A+LFAVHP+HTEAV+G+VGRA++L+ V FLL+ L Y   V +  S       +    +L+ L+L +   L KE  IT  GVC+  +A  L +   M   +      + +       R+ ++ +  A ++ +RL + G  MP F++ DNPA+ SP  + R LTF YL   N  LL  P  LC DW +G+I LV S+ DVR V T      +  L +  +  ++ + S    + +L +   F+PASNLF  VGFVVAERVLY PS+G+C+++   L +       +   +    ++LLL   +  T  +N  W +   LF S +Q   +NAK+  N  + L+   + ++A+ ++  A +  P    +  N+G TL N      AE  ++ AL   PQ  +                 NL NLL + + +  EA+A L+ +I   P F DA+ +   +     R  EA+  YI  ++  P+S+DLH N GV  +     + A + +  ++QL  +H  A  +L        E  E                                EA  +Y +    +  S     ALA +     +   AEK     +  +         L+ +Y+       EAL  L+R L+  P       + H   G+ L   ++ L  A  +++ A EL+P  +QA  N+  +   +     A +   +A+ L+P    +K++L  + +RL   TS 
Sbjct:   34 YGNSLHGELVHDDVWAIVNNPDVRAGSSLRSIFSNDFWGKKMADNTSHKSYRPLCVLTFKLNVVLGGLTPLYFHLVNVCLHICATCLLLHTCERHVFQQAHLAFITALLFAVHPVHTEAVSGIVGRADVLACVLFLLAFLSYTRSVGAASSEDSLPGTESPAALLISLLLGTCAMLVKETGITVFGVCLLYDALVLCRKSLMRQRSASGLTDLLHGCAPLLKRACLLSVHVAFILSVRLWVMGGSMPLFSEQDNPASFSPHLLTRTLTFLYLLVFNAWLLLAPAVLCYDWQVGSIPLVESLGDVRNVATGLLVVLLVALCLRCVLILQKEDSCAPVVGILFLGFPFIPASNLFFRVGFVVAERVLYMPSMGYCILVTYGLGRLCSTAAGWSATLLKGSMLLLLLLFSWKTIQQNTVWLSREALFRSGIQTLPHNAKVHYNYANFLKDNGRQDEAVYHYNTALRLFPRHASALNNLG-TLTN--SLETAEHYYRKALDINPQHNR--------------ALFNLGNLL-RTQGKDKEAEALLKNSIRYGPHFADAFSSLASLYADQERFVEAKEVYIQGIKNCPDSSDLHNNYGVFLVNTGEGELAAAHYQRAIQLKPAHYVAMANLGRLLRASNENDEAESWFKRALQIARKVDVLTPLGALYYNTGRFYEALQVYREAAALQPRSTDILLALAQVLVMTSHSTEAEKMTQDIISREAGCIECYRLLSAIYSKR-GNHTEALQALDRALQQNPADLTVRAELHFSKGNQLREMQQ-LDEALESYKLAVELKPDQSQAWMNMGGIQHIKGDYATARTYYQQALLLNPTSKLLKENLAKL-DRLEKKTSG 860          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Planmine SMEST
Match: SMESG000021387.1 (SMESG000021387.1)

HSP 1 Score: 1592.02 bits (4121), Expect = 0.000e+0
Identity = 817/818 (99.88%), Postives = 817/818 (99.88%), Query Frame = 1
Query:   10 MIPKXXXXXXXXXXXXXXYFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAEXXXXXXXXXXXXIYINIVKSKYSNIKDXXXXXXXXXXXXXXXXCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFIP 2463
            MIPKIALISLLSAISILLYFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAELLSSVFFLLSLLIYINIVKSKYSNIKDILGILLVLVLVSIGTLCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHF KFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFIP
Sbjct:    1 MIPKIALISLLSAISILLYFNSLDCGFVFDDVTAIKDNKDLRPETPFSTLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVILHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAELLSSVFFLLSLLIYINIVKSKYSNIKDILGILLVLVLVSIGTLCKEQCITALGVCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKINGKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMGTISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMVLSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFPKFQKCIYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIVRNRLGYSTSNFIP 818          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Planmine SMEST
Match: SMESG000002813.1 (SMESG000002813.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.170e-14
Identity = 90/370 (24.32%), Postives = 142/370 (38.38%), Query Frame = 1
Query: 1282 TLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPN 2391
            + ++ A++     A  W+NVG     +     A+ +F  A    PN + +H+N+G      + F  A  A+  AL+              +   +  +  NL+ +  +     L  D+Y R+AI ++P+F DAY N  + L + G   EA   Y TAL+  PN AD   NL  +  E   N+EA++ +  +L+                            IY +   A       H  LA M     + Q A  HY  ++K  P       N A  Y+N    F E                              +DLP A   +Q+A +++P  A A  NL  V  +   + EA    T A+K+ PN
Sbjct:  168 SCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALT--------------LDSDNPILHGNLACVYYEQGLYDLAIDSY-RKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALE----------------------------IYPEFAVA-------HSNLASMLQLQGHLQSALNHYREAIKISP-------NFADAYSNMGNTFKEL-----------------------------QDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINEAIGSYTTALKIKPN 451          

HSP 2 Score: 72.7886 bits (177), Expect = 8.603e-13
Identity = 79/342 (23.10%), Postives = 143/342 (41.81%), Query Frame = 1
Query: 1369 FEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDL-PAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPN 2391
            +E A +Y +   K  PN+    + +      L++    + AF   L+    P+  +AY+            NL N+  K K +L+EA ++ ++A+ ++P+F+DAY N     +  G  + A + YI  L + P    +   LG +   L + +EA SC+  +++                              Y      + +  C F          +  LA  H+  ++  DP    +  NL  ++  E K FD A+    + L    ++   H  L  +   Y++ L   A  +++KA EL+P    A  NL   + E+  ++EAE C   A++L+PN
Sbjct:   27 YEKAEKYCLEIWKLDPNNSAILLFLSSVYFQLKKL--DKSAFFCQLAIKQNPQMAEAYS------------NLGNVF-KEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCYLKAIET-----------------------------YPAFAVAWSNVGCIF------NAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFK-EAKIFDRAVAAYTKALTLDSDNPILHGNLACVY--YEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPN 315          

HSP 3 Score: 70.8626 bits (172), Expect = 3.068e-12
Identity = 97/376 (25.80%), Postives = 154/376 (40.96%), Query Frame = 1
Query: 1282 TLFMSALQVNQNN--AKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSE----DKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPN 2391
            + F   L + QN   A+ ++N+G+  + + +  +A+ ++  A + +PN + ++IN+    V       A   + + L+  P+      Y  R           L NL  K   +L EA +   +AI   P F  A+ N G I    G    A + +  A+   PN  D H NLG V  E K  D A++ +  +L LD  +     +LA  Y E    D       K+I    ++  F    C+ A A+ E    N   AEK Y  +L+ +P    SL NLA +   E    +EA+ L                                   ++KA E+ P+ A A  NL  ++  Q  L  A +   EA+K+SPN
Sbjct:   64 SAFFCQLAIKQNPQMAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPE-----LYHVRSE---------LGNLF-KALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIE---LQPNFPDAYCNLANALKEKG--NVLEAEKCYNTALRLNPNHADSLNNLANI-KREQGLNEEAMNL-----------------------------------YKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKISPN 383          

HSP 4 Score: 60.4622 bits (145), Expect = 5.016e-9
Identity = 56/222 (25.23%), Postives = 98/222 (44.14%), Query Frame = 1
Query: 1288 FMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQP----------KKGQAYTTR---VSPKDLNVF----INLSNL--LIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSL 1896
            +  AL ++ +N  L  N+      +  ++ A+  +  A + QPN   ++ N+   L      LEAE+ +  AL   P            K+ Q        +  K L ++    +  SNL  +++ +  L  A  + R AI + P+F DAY N G+   +L     A   Y  A+Q +P  AD H NL  V  +    +EA+  + T+L++  ++  A  +L
Sbjct:  238 YTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKISPNFADAYSNMGNTFKELQDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINEAIGSYTTALKIKPNYPEAFCNL 459          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Planmine SMEST
Match: SMESG000004465.1 (SMESG000004465.1)

HSP 1 Score: 72.0182 bits (175), Expect = 8.806e-13
Identity = 70/283 (24.73%), Postives = 128/283 (45.23%), Query Frame = 1
Query: 1282 TLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQP----------KKGQAYTTR----------VSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASF------YSEDKEKREEAKSIYYDLIKAE-FESEKCHFALAMMETDDKNFQLAEKH 2049
            T ++ AL +  NNA +  N+      +   E A+  +  A + QPN   ++ N+   L    +  EAEE +  AL   P            K+ Q ++            + P+      NL+++L + + +L EA  + R AI + P+F DAY N G+ L ++     A   Y  A+Q  P  AD H NL  +  +    ++A+S + T+L++  ++  A  +LA        +++  E+ +  K I  + ++A+   S   H  +    T ++  ++AEKH
Sbjct:  238 TAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASML-QLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYKDTGNINDAISSYKTALKIKPNYHDAFCNLAHCLQIICDWNDYGERMKRLKGIVQEQLEAKRLPSVHPHHTMLYPLTPEQRKRIAEKH 519          

HSP 2 Score: 68.5514 bits (166), Expect = 1.101e-11
Identity = 69/281 (24.56%), Postives = 118/281 (41.99%), Query Frame = 1
Query: 1549 RVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDL-PAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSP 2388
            + +P+    + NL N+L K K +L EA    + A+ ++P+F+D Y N     +  G  E A + Y+  L   P+   +  +LG +   L R DEA SC+  +++       A  +L   ++   E                                     LA  H+  ++  DP    +  NL  ++  E + FD A+    + L   PN+   H  L  +   Y+++L   A   +++A EL+P    A  NL   + E+ K+ EAE C   A++L P
Sbjct:   75 KQNPQMAEAYSNLGNVL-KEKGQLAEAIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSE-----------------------------------IWLAIHHFEKAVSLDPNFLDAYLNLGNVF-KEARIFDRAVTAYLKALNLAPNNAIIHGNLACVY--YEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQP 316          

HSP 3 Score: 68.1662 bits (165), Expect = 1.479e-11
Identity = 76/316 (24.05%), Postives = 141/316 (44.62%), Query Frame = 1
Query: 1210 SFVVLLLSHTMNTYYRNFDWRNEY----------TLFMSALQVNQNNAKLWNNVGHSLEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIK--AEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNN 2121
            S  +++L++  + YY   D  N +          + ++ A++     A  W+N+G     + +   A+ +F  A    PN + +++N+G      + F  A  A+  AL+              ++P +  +  NL+ +  +     L  D Y +RAI ++P+F DAY N  + L + G+  EA   Y TAL+ +P  AD   NL  +  E   ++EA+  +  +L++      A  +LAS   + + K  EA   Y + I+    F     +    + E  D N   A + Y  +++ +PT   +  NLA +Y +
Sbjct:  136 STYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVFKEARIFDRAVTAYLKALN--------------LAPNNAIIHGNLACVYYEQNLVELAIDTY-KRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASML-QLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDING--AMQCYQRAIQINPTFADAHSNLASIYKD 433          

HSP 4 Score: 60.4622 bits (145), Expect = 3.389e-9
Identity = 91/358 (25.42%), Postives = 149/358 (41.62%), Query Frame = 1
Query: 1363 KKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKVALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRAISM-------RPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKR--EEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELK---KFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDL---PAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPN 2391
            +K + +  +  +A K  P    ++ N+G  L    +  EA E +K AL              R+ P+ ++ ++NL+   +        A  ++  AIS         PD      + G++   LGR +EA++ Y+ A++  P  A    NLG V         A+  F  ++ LD +   A L+L + +   KE R  + A + Y   +     +   H  LA +  +    +LA   Y  +++  P    +  NLA    N LK   K  EA    N  L   P H        + L N KR+      A   + +A E+ P+ A A  NL  ++  Q KL EA     EA+++SPN
Sbjct:   61 RKLDKSGFFCQLAIKQNPQMAEAYSNLGNVLKEKGQLAEAIENYKHAL--------------RIKPEFIDGYLNLAAAFV--------AAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVF---KEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLA----NALKEKGKVSEAEECYNTALRLQPTHADS----LNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPN 385          
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Planmine SMEST
Match: SMESG000046074.1 (SMESG000046074.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.290e-6
Identity = 58/277 (20.94%), Postives = 109/277 (39.35%), Query Frame = 1
Query: 1594 LLIKNKTRLLEADAYLRRAISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGVVNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIYYDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFNLALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAAFLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENYIKQHLNIV 2424
            L+ + K  + E+ +Y ++   +    V+ ++     L  LGR   A   Y  AL+      ++++NLG+ +++    + A   F  ++   +S                                    E  +  L  +   +K+F+ A  +Y  + +  P +   L  L LLY  +L + ++A       L N P HV   +    I+  +  D   A   ++ A++  P+N     N+ +    + K V A SCL  A  L+P E  I  +L +V
Sbjct:   80 LICRQKGNISESLSYFQQCALLNSSNVNNFKQVAKTLFILGRISSAIEVYQDALKLAGEDWEINHNLGLCHMQCNEFELAKEFFRNAINCRKS------------------------------------ESSYLMLGKIFVIEKDFENAIANYKIATEIAPENSDILMTLGLLYM-DLGQTNKAFEQFGNALSNDPTHVNSIIAASSIIQQHG-DYDVALNKYRIAAQKAPENGPIWSNIGMAFFAKKKYVAAISCLNRAYYLAPFEWKIASNLGLV 318          
The following BLAST results are available for this feature:
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMTC30.000e+048.77transmembrane O-mannosyltransferase targeting cadh... [more]
TMTC33.244e-10850.66transmembrane O-mannosyltransferase targeting cadh... [more]
TMTC47.446e-9633.80transmembrane O-mannosyltransferase targeting cadh... [more]
TMTC41.169e-9533.80transmembrane O-mannosyltransferase targeting cadh... [more]
TMTC14.208e-9030.88transmembrane O-mannosyltransferase targeting cadh... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F38B6.65.445e-7330.93Protein O-mannosyl-transferase TMTC1 [Source:UniP... [more]
F32D1.32.687e-4833.48pep chromosome:WBcel235:V:4349775:4361552:-1 gene:... [more]
ogt-12.192e-2127.20UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-12.192e-2127.20UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-12.451e-2127.99UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmtc30.000e+044.01gene:FBgn0020312 transcript:FBtr0071638[more]
Tmtc30.000e+044.01gene:FBgn0020312 transcript:FBtr0071637[more]
CG316903.709e-6828.28gene:FBgn0051690 transcript:FBtr0301682[more]
CG50381.640e-6429.59gene:FBgn0038324 transcript:FBtr0083089[more]
CG43413.117e-4538.46gene:FBgn0028481 transcript:FBtr0077949[more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmtc30.000e+047.74transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc43.516e-10134.41transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc43.516e-10134.41transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc43.516e-10134.41transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc13.660e-9630.55transmembrane O-mannosyltransferase targeting cadh... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045155.11.511e-16648.22transmembrane and tetratricopeptide repeat contain... [more]
ENSXETT00000045136.11.833e-16648.22transmembrane and tetratricopeptide repeat contain... [more]
ENSXETT00000045169.12.394e-12351.40transmembrane and tetratricopeptide repeat contain... [more]
bnip23.557e-9532.10BCL2/adenovirus E1B 19kDa interacting protein 2 [S... [more]
bnip26.612e-9432.21BCL2/adenovirus E1B 19kDa interacting protein 2 [S... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmtc30.000e+049.07transmembrane and tetratricopeptide repeat contain... [more]
Tmtc30.000e+050.47transmembrane and tetratricopeptide repeat contain... [more]
Tmtc41.862e-9833.47transmembrane and tetratricopeptide repeat contain... [more]
Tmtc41.862e-9833.47transmembrane and tetratricopeptide repeat contain... [more]
Tmtc41.862e-9833.47transmembrane and tetratricopeptide repeat contain... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZXV5|TMTC3_HUMAN0.000e+048.89Protein O-mannosyl-transferase TMTC3 OS=Homo sapie... [more]
sp|Q8BRH0|TMTC3_MOUSE0.000e+049.07Protein O-mannosyl-transferase TMTC3 OS=Mus muscul... [more]
sp|Q7K4B6|TMTC3_DROME0.000e+044.01Protein O-mannosyl-transferase Tmtc3 OS=Drosophila... [more]
sp|Q8BG19|TMTC4_MOUSE1.303e-9733.47Protein O-mannosyl-transferase TMTC4 OS=Mus muscul... [more]
sp|Q5T4D3|TMTC4_HUMAN3.576e-9533.80Protein O-mannosyl-transferase TMTC4 OS=Homo sapie... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KH780.000e+048.88transmembrane and TPR repeat-containing protein 3 ... [more]
D3ZUJ80.000e+049.38Transmembrane O-mannosyltransferase targeting cadh... [more]
H2NI750.000e+049.25Transmembrane O-mannosyltransferase targeting cadh... [more]
A0A1U7QKK70.000e+049.38transmembrane and TPR repeat-containing protein 3 ... [more]
A0A2J8SW460.000e+048.77TMTC3 isoform 1 OS=Pongo abelii OX=9601 GN=CR201_G... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049059.10.000e+047.85transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc14.828e-9330.66transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc12.648e-8129.70transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc41.337e-7733.01transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc49.236e-7734.30transmembrane O-mannosyltransferase targeting cadh... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmtc37.219e-10845.68transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc44.104e-7630.91transmembrane O-mannosyltransferase targeting cadh... [more]
ENSPMAT00000007591.11.590e-6642.02pep scaffold:Pmarinus_7.0:GL480573:24572:27393:-1 ... [more]
tmtc12.293e-6335.42transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc11.593e-6234.18transmembrane O-mannosyltransferase targeting cadh... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO434845.753e-10334.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399633.976e-7732.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397471.237e-5140.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399622.653e-3647.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470735.044e-2227.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmtc30.000e+048.45transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc31.829e-17644.09transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc44.333e-9033.56transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc44.333e-9033.56transmembrane O-mannosyltransferase targeting cadh... [more]
tmtc15.120e-8530.07transmembrane O-mannosyltransferase targeting cadh... [more]
back to top
BLAST of Transmembrane O-mannosyltransferase targeting cadherins 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000021387.10.000e+099.88SMESG000021387.1[more]
SMESG000002813.12.170e-1424.32SMESG000002813.1[more]
SMESG000004465.18.806e-1324.73SMESG000004465.1[more]
SMESG000046074.13.290e-620.94SMESG000046074.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009974 ID=SMED30009974|Name=Transmembrane O-mannosyltransferase targeting cadherins 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2494bp
ATGAAATATATGATTCCAAAAATTGCTTTGATTAGCCTCTTAAGTGCTAT
TTCGATTTTACTTTACTTCAATTCTCTGGATTGTGGATTTGTGTTTGATG
ATGTCACAGCTATTAAAGACAATAAAGATCTTCGACCAGAAACTCCATTT
AGTACATTATTTTATAACGATTTTTGGGGTACGCCAATTCGCCAAGAAAG
AAGCCATAAATCTTACAGACCATTAACTGTTCTAACATTTCGATGGAACT
ATTTTTTAGGAGAATTGAATCCAGCTGGTTACCACGCAATAAATGTAATC
CTACACGCCATTGTGGTTATATTATTTTTTCAGCTATGTACGATTTATTT
CGATATAATTCATTCGTTTCTAAGTGCAATTTTATTTGCTGTCCACCCAA
TTCACACGGAAGCAGTAACTGGAGTTGTTGGCAGAGCTGAATTATTGAGT
AGCGTTTTCTTTCTGTTGTCATTACTGATCTACATCAATATCGTTAAGAG
CAAGTATTCTAATATTAAAGATATATTGGGAATATTGCTCGTGCTAGTTC
TAGTATCAATCGGTACCCTATGTAAAGAGCAATGTATTACTGCACTTGGC
GTTTGTATTGGACTTGAAGCATATCATCTTGTCAAGTTGTGGAAAATGCA
TAATGTCAATATAGACAAGAAATATTTTGTTCGTTATACCAGATCCGGCA
TTATTTTTATGGGCGCCGCACTATTAATGTTTCTTCGTTTAAAAATCAAT
GGAAAATACATGCCATTTTTTACCGATTTTGATAATCCTGCAGCTCATTC
ACCTTTTCCCATTCGACAGTTGACATTCAATTATTTGACATCGGTAAATC
TACGATTGTTGTTTTGTCCTTTACAGTTGTGCTGTGATTGGACAATGGGA
ACGATATCTCTAGTCACTAGTATTACTGACGTGAGGATCGTTCCTACCTT
ATGCACCTATGCATTCATAGGACTTTTATCAATTATTGTTATTAAAAGAA
TAGAAACCAAATCTTCAGAGACATTGGCTATGTCTCTTTTGATCATGGTT
TTATCTTTTCTCCCAGCTTCCAATTTATTCATATCAGTGGGGTTTGTTGT
CGCCGAACGAGTTTTATACACTCCAAGCCTAGGCTTTTGTTTGATGATTG
GACTTTGGTTACAAAAATCAATAAAACATTTTCAAAAATTTCAGAAATGC
ATTTATGGATCGTTTGTGGTTCTGTTATTGTCGCATACAATGAATACATA
TTATAGGAATTTTGATTGGAGGAATGAATACACTTTATTTATGTCTGCAT
TGCAAGTTAATCAAAATAATGCTAAATTATGGAATAATGTCGGTCATTCC
TTAGAGCATGAAAAGAAATTCGAGGATGCGTTAAGATATTTTATTGTGGC
TTCGAAAACACAACCGAATGATGTTGGATCTCACATAAATGTTGGTAGAA
CTCTGGTGAATTTGCAACGATTTCTGGAAGCCGAAGAGGCATTTAAAGTG
GCTCTTAGTTTTATGCCACAACCTAAAAAAGGCCAGGCATATACAACACG
AGTGTCACCGAAAGACTTGAATGTTTTTATTAATCTTAGTAATTTGTTAA
TAAAAAATAAGACCCGTCTTCTTGAAGCAGATGCATATCTTAGGCGAGCC
ATTAGTATGCGCCCGGACTTTGTGGATGCTTATCAAAACAGGGGTGATAT
TTTGTTAAAATTGGGCAGATCTGAAGAAGCCCGAAACCAATATATAACGG
CCCTGCAATATCGACCTAACAGTGCAGATTTGCATTATAACTTAGGAGTT
GTTAATATCGAGTTGAAACGCAATGATGAAGCTCTTTCGTGTTTCCATAC
CTCTTTACAATTAGACAGAAGCCATAAGCCGGCTCGACTAAGTTTGGCTT
CCTTTTATTCTGAAGATAAAGAAAAAAGAGAGGAAGCCAAATCGATATAT
TACGATTTAATAAAGGCGGAATTTGAATCAGAAAAGTGTCACTTTGCATT
AGCTATGATGGAAACTGATGATAAAAATTTCCAATTAGCTGAAAAGCACT
ATTTGCACTCTTTGAAATATGATCCCACTTCTCGAGGCTCTTTGTTCAAT
TTAGCTCTTTTGTATAATAATGAACTGAAAAAATTCGATGAAGCTCTCGT
CTTGCTCAATCGGTTGCTGGAAAATTATCCCAACCATGTCAAAGGACATT
TACTGCTTGGGGATATTCTCTTGAATTACAAGAGAGATTTGCCAGCTGCC
TTTTTGAATTTTCAAAAGGCCTCGGAACTGGAGCCGAAAAATGCTCAGGC
CAAACATAACCTCTGCGTGGTTATGGTGGAACAGAGCAAATTGGTTGAAG
CTGAAAGTTGCCTAACAGAAGCTGTAAAATTATCTCCAAATGAAAACTAT
ATCAAACAACATTTGAACATTGTACGTAACCGTCTCGGTTACTCGACCTC
TAATTTTATTCCGTAGGAATGGGATTTTTATTGGCGATGTAATT
back to top

protein sequence of SMED30009974-orf-1

>SMED30009974-orf-1 ID=SMED30009974-orf-1|Name=SMED30009974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=822bp
MKYMIPKIALISLLSAISILLYFNSLDCGFVFDDVTAIKDNKDLRPETPF
STLFYNDFWGTPIRQERSHKSYRPLTVLTFRWNYFLGELNPAGYHAINVI
LHAIVVILFFQLCTIYFDIIHSFLSAILFAVHPIHTEAVTGVVGRAELLS
SVFFLLSLLIYINIVKSKYSNIKDILGILLVLVLVSIGTLCKEQCITALG
VCIGLEAYHLVKLWKMHNVNIDKKYFVRYTRSGIIFMGAALLMFLRLKIN
GKYMPFFTDFDNPAAHSPFPIRQLTFNYLTSVNLRLLFCPLQLCCDWTMG
TISLVTSITDVRIVPTLCTYAFIGLLSIIVIKRIETKSSETLAMSLLIMV
LSFLPASNLFISVGFVVAERVLYTPSLGFCLMIGLWLQKSIKHFQKFQKC
IYGSFVVLLLSHTMNTYYRNFDWRNEYTLFMSALQVNQNNAKLWNNVGHS
LEHEKKFEDALRYFIVASKTQPNDVGSHINVGRTLVNLQRFLEAEEAFKV
ALSFMPQPKKGQAYTTRVSPKDLNVFINLSNLLIKNKTRLLEADAYLRRA
ISMRPDFVDAYQNRGDILLKLGRSEEARNQYITALQYRPNSADLHYNLGV
VNIELKRNDEALSCFHTSLQLDRSHKPARLSLASFYSEDKEKREEAKSIY
YDLIKAEFESEKCHFALAMMETDDKNFQLAEKHYLHSLKYDPTSRGSLFN
LALLYNNELKKFDEALVLLNRLLENYPNHVKGHLLLGDILLNYKRDLPAA
FLNFQKASELEPKNAQAKHNLCVVMVEQSKLVEAESCLTEAVKLSPNENY
IKQHLNIVRNRLGYSTSNFIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013618DUF1736
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0009791post-embryonic development
GO:0010468regulation of gene expression
GO:0030154cell differentiation
GO:0030324lung development
GO:0034976response to endoplasmic reticulum stress
GO:0048286lung alveolus development
GO:0048747muscle fiber development
GO:0060447bud outgrowth involved in lung branching
GO:1901800positive regulation of proteasomal protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 557..590
e-value: 6.7E-4
score: 29.0
coord: 729..763
e-value: 130.0
score: 5.2
coord: 764..797
e-value: 110.0
score: 5.8
coord: 694..728
e-value: 48.0
score: 9.0
coord: 660..693
e-value: 5.9
score: 15.9
coord: 440..473
e-value: 0.16
score: 21.1
coord: 474..507
e-value: 73.0
score: 7.4
coord: 591..624
e-value: 3.7E-4
score: 29.8
IPR019734Tetratricopeptide repeatPFAMPF13174TPR_6coord: 696..728
e-value: 6.6E-5
score: 23.3
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 591..624
score: 9.381
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 764..797
score: 7.434
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 660..693
score: 6.579
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 695..728
score: 5.015
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 474..507
score: 7.611
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 557..590
score: 9.853
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 440..473
score: 9.352
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 637..814
e-value: 4.0E-24
score: 87.2
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 516..633
e-value: 1.5E-23
score: 85.5
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 413..515
e-value: 2.0E-15
score: 59.0
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 427..509
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 515..812
IPR013618Domain of unknown function DUF1736PFAMPF08409DUF1736coord: 253..322
e-value: 1.0E-26
score: 92.7
NoneNo IPR availablePFAMPF13414TPR_11coord: 564..601
e-value: 1.7E-10
score: 40.4
NoneNo IPR availablePANTHERPTHR44395FAMILY NOT NAMEDcoord: 10..812
NoneNo IPR availablePANTHERPTHR44395:SF1TRANSMEMBRANE AND TPR REPEAT-CONTAINING PROTEIN 3coord: 10..812
NoneNo IPR availableTMHMMTMhelixcoord: 343..365
NoneNo IPR availableTMHMMTMhelixcoord: 145..164
NoneNo IPR availableTMHMMTMhelixcoord: 370..387
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 400..417
NoneNo IPR availableTMHMMTMhelixcoord: 7..25
NoneNo IPR availableTMHMMTMhelixcoord: 312..330
NoneNo IPR availableTMHMMTMhelixcoord: 118..135
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 406..797
score: 54.837