mxi-1 protein

Overview
Namemxi-1 protein (AGZ94930.1)
Smed IDSMED30009973
Length (bp)1876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mxi-1 protein (SMED30009973) t-SNE clustered cells

Violin plots show distribution of expression levels for mxi-1 protein (SMED30009973) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of mxi-1 protein (SMED30009973) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for mxi-1 protein (SMED30009973) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009973

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30009973SMESG000047681.1 SMESG000016277.1 dd_Smed_v4_4415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009973SMESG000047681.1 SMESG000016277.1 dd_Smed_v4_4415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009973SMESG000047681.1 SMESG000016277.1 dd_Smed_v4_4415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30009973SMESG000047681.1 SMESG000016277.1 dd_Smed_v4_4415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009973SMESG000047681.1 KF487115smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30009973SMESG000047681.1 KF487115smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30009973SMESG000047681.1 KF487115smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30009973SMESG000047681.1 KF487115smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30009973SMESG000047681.1 KF487115smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009973SMESG000047681.1 KF487115smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30009973SMESG000047681.1 SMESG000016277.1 dd_Smed_v4_4415_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mxi-1 protein vs. Ensembl Human
Match: MXI1 (MAX interactor 1, dimerization protein [Source:HGNC Symbol;Acc:HGNC:7534])

HSP 1 Score: 51.6026 bits (122), Expect = 8.516e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Human
Match: MXI1 (MAX interactor 1, dimerization protein [Source:HGNC Symbol;Acc:HGNC:7534])

HSP 1 Score: 51.6026 bits (122), Expect = 8.516e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Human
Match: MXI1 (MAX interactor 1, dimerization protein [Source:HGNC Symbol;Acc:HGNC:7534])

HSP 1 Score: 51.6026 bits (122), Expect = 8.516e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Human
Match: MXI1 (MAX interactor 1, dimerization protein [Source:HGNC Symbol;Acc:HGNC:7534])

HSP 1 Score: 51.6026 bits (122), Expect = 8.516e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Human
Match: MXI1 (MAX interactor 1, dimerization protein [Source:HGNC Symbol;Acc:HGNC:7534])

HSP 1 Score: 51.6026 bits (122), Expect = 8.516e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Zebrafish
Match: mxd4 (MAX dimerization protein 4 [Source:ZFIN;Acc:ZDB-GENE-050208-44])

HSP 1 Score: 54.299 bits (129), Expect = 7.378e-8
Identity = 50/144 (34.72%), Postives = 78/144 (54.17%), Query Frame = 1
Query:  394 KKSQIPI-------RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYT-RERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLK-NMEAMSMESTKAERMRNYSECSVLTTSSD---DSNCDGV 789
            KK++ PI       R SHNELEK RRA LR  +E+LK+++    DS   R T L++LK+A   I    E++  ++NMKE                LQR+++ LK  +E +S++    ER+R  S  S ++T S+   D + +G+
Sbjct:   40 KKTKSPISRKPHNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDS--TRHTTLSLLKRAKMHIKKLEEQDRKALNMKE---------------QLQREHRYLKRRLEQLSVQGL--ERIRTDSMGSTISTDSEQEVDVDIEGM 164          
BLAST of mxi-1 protein vs. Ensembl Zebrafish
Match: mxd3 (MAX dimerization protein 3 [Source:NCBI gene;Acc:394031])

HSP 1 Score: 52.7582 bits (125), Expect = 2.023e-7
Identity = 44/126 (34.92%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYK-RLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGV 789
            R  HNELEK RRA LR C+E+LK+ +    DS   R T LN+L++A          +H   ++E   + +   L +RL   QR+ + RL+ ++  S      ERMRN S  S +++   DS  + V
Sbjct:   59 RSVHNELEKHRRAQLRHCLEQLKQQVPLSSDS--SRNTTLNLLRQA---------QLHIKKLQEQDERAKL--LKDRLRWEQRELRTRLEKLQGGS------ERMRNDSLGSAVSSERSDSEREDV 165          
BLAST of mxi-1 protein vs. Ensembl Xenopus
Match: mxi1 (MAX interactor 1, dimerization protein [Source:NCBI gene;Acc:493491])

HSP 1 Score: 54.6842 bits (130), Expect = 9.708e-8
Identity = 43/137 (31.39%), Postives = 69/137 (50.36%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKF 825
            R +HNELEK RRAHLR C+E+LK ++  + D+   R T L +L KA          +H   +++T  + +     ++L  L+R+ + LK         T+ ER+R+ S  S  +T   DS  + +     ST  S+ 
Sbjct:   59 RSTHNELEKNRRAHLRLCLERLKDLIPLESDAA--RHTTLGLLNKA---------KLHIKKLEDTSRRGQ-----HQLEVLEREQRFLKRRLEQLQGGTEPERVRSDSIGSHASTDPSDSEREEIEVDVESTELSQL 179          
BLAST of mxi-1 protein vs. Ensembl Xenopus
Match: mxi1 (MAX interactor 1, dimerization protein [Source:NCBI gene;Acc:493491])

HSP 1 Score: 55.0694 bits (131), Expect = 1.010e-7
Identity = 43/137 (31.39%), Postives = 69/137 (50.36%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKF 825
            R +HNELEK RRAHLR C+E+LK ++  + D+   R T L +L KA          +H   +++T  + +     ++L  L+R+ + LK         T+ ER+R+ S  S  +T   DS  + +     ST  S+ 
Sbjct:  101 RSTHNELEKNRRAHLRLCLERLKDLIPLESDA--ARHTTLGLLNKA---------KLHIKKLEDTSRRGQ-----HQLEVLEREQRFLKRRLEQLQGGTEPERVRSDSIGSHASTDPSDSEREEIEVDVESTELSQL 221          
BLAST of mxi-1 protein vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:NCBI gene;Acc:100124794])

HSP 1 Score: 51.2174 bits (121), Expect = 9.725e-7
Identity = 45/128 (35.16%), Postives = 72/128 (56.25%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLK-NMEAMSMESTKAERMRNYSECSVLTTSSD-DSNCDGV 789
            R SHNELEK RRA LR  +E+LK+++    DS   R T L++LK+A   I    E++  ++N+KE                LQR+++ LK  +E +S+     ERMR  S  S+++T S+ + + +G+
Sbjct:   56 RSSHNELEKHRRAKLRLYLEQLKQLVPLGPDS--NRHTTLSLLKRAKMHIKKLEEQDRKALNVKE---------------QLQREHRYLKRRLEQLSVHGM--ERMRTDSMGSIISTDSEQEVDIEGM 164          
BLAST of mxi-1 protein vs. Ensembl Mouse
Match: Mxd1 (MAX dimerization protein 1 [Source:MGI Symbol;Acc:MGI:96908])

HSP 1 Score: 51.2174 bits (121), Expect = 2.140e-7
Identity = 41/122 (33.61%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  412 IRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSN 777
             R +HNE+EK RRAHLR C+EKLK ++    +S   R T L++L KA          +H   +++   K       ++++ LQR+ + LK      +E   AER R  S  SV+++   DS+
Sbjct:    1 FRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPES--SRHTTLSLLTKA---------KLHIKKLEDCDRKA-----VHQIDQLQREQRHLKR----RLEKLGAERTRMDSVGSVVSSERSDSD 102          
BLAST of mxi-1 protein vs. Ensembl Mouse
Match: Mxd1 (MAX dimerization protein 1 [Source:MGI Symbol;Acc:MGI:96908])

HSP 1 Score: 52.7582 bits (125), Expect = 3.602e-7
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:  394 KKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSN 777
            KK+    R +HNE+EK RRAHLR C+EKLK ++    +S   R T L++L KA          +H   +++   K       ++++ LQR+ + LK      +E   AER R  S  SV+++   DS+
Sbjct:   50 KKNSTSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPES--SRHTTLSLLTKA---------KLHIKKLEDCDRKA-----VHQIDQLQREQRHLKR----RLEKLGAERTRMDSVGSVVSSERSDSD 157          
BLAST of mxi-1 protein vs. Ensembl Mouse
Match: Mxi1 (MAX interactor 1, dimerization protein [Source:MGI Symbol;Acc:MGI:97245])

HSP 1 Score: 51.2174 bits (121), Expect = 6.014e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Mouse
Match: Mxi1 (MAX interactor 1, dimerization protein [Source:MGI Symbol;Acc:MGI:97245])

HSP 1 Score: 51.2174 bits (121), Expect = 6.014e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. Ensembl Mouse
Match: Mxi1 (MAX interactor 1, dimerization protein [Source:MGI Symbol;Acc:MGI:97245])

HSP 1 Score: 51.2174 bits (121), Expect = 6.014e-7
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   33 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 151          
BLAST of mxi-1 protein vs. UniProt/SwissProt
Match: sp|P50538|MAD1_MOUSE (Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 2.296e-6
Identity = 43/128 (33.59%), Postives = 67/128 (52.34%), Query Frame = 1
Query:  394 KKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSN 777
            KK+    R +HNE+EK RRAHLR C+EKLK ++    +S   R T L++L KA          +H   +++   K       ++++ LQR+ + LK      +E   AER R  S  SV+++   DS+
Sbjct:   50 KKNSTSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPES--SRHTTLSLLTKA---------KLHIKKLEDCDRKA-----VHQIDQLQREQRHLKR----RLEKLGAERTRMDSVGSVVSSERSDSD 157          
BLAST of mxi-1 protein vs. UniProt/SwissProt
Match: sp|O09015|MXI1_RAT (Max-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mxi1 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.869e-6
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   69 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 187          
BLAST of mxi-1 protein vs. UniProt/SwissProt
Match: sp|Q7SX95|MAD3_DANRE (Max dimerization protein 3 OS=Danio rerio OX=7955 GN=mxd3 PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 6.059e-6
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYK-RLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGV 789
            R  HNELEK RRA LR C+E+LK+ +    DS   R T LN+L++A          +H   ++E   + +   L +RL   QR+ + RL+ ++  S      ERMR+ S  S +++   DS  + V
Sbjct:   59 RSVHNELEKHRRAQLRHCLEQLKQQVPLSSDS--SRNTTLNLLRQA---------QLHIKKLQEQDERAKL--LKDRLRWEQRELRTRLEKLQGGS------ERMRSDSLGSAVSSERSDSEREDV 165          
BLAST of mxi-1 protein vs. UniProt/SwissProt
Match: sp|Q14582|MAD4_HUMAN (Max dimerization protein 4 OS=Homo sapiens OX=9606 GN=MXD4 PE=1 SV=2)

HSP 1 Score: 51.2174 bits (121), Expect = 6.872e-6
Identity = 42/125 (33.60%), Postives = 68/125 (54.40%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLK-NMEAMSMESTKAERMRNYSECSVLTTSSDDSNCD 783
            R SHNELEK RRA LR  +E+LK+++    DS   R T L++LK+A   I    E++  ++++KE                LQ++++ LK  +E +S++S   ER+R  S  S ++T   +   D
Sbjct:   55 RSSHNELEKHRRAKLRLYLEQLKQLVPLGPDS--TRHTTLSLLKRAKVHIKKLEEQDRRALSIKE---------------QLQQEHRFLKRRLEQLSVQSV--ERVRTDSTGSAVSTDDSEQEVD 160          
BLAST of mxi-1 protein vs. UniProt/SwissProt
Match: sp|P50540|MXI1_MOUSE (Max-interacting protein 1 OS=Mus musculus OX=10090 GN=Mxi1 PE=1 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 8.321e-6
Identity = 43/135 (31.85%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     ++L NL+R+ + LK          + ER+R  S  S +++   DS  + +     ST +S
Sbjct:   69 RSTHNELEKNRRAHLRLCLERLKVLIPLGPDCT--RHTTLGLLNKAKA---------HIKKLEEAERKSQ-----HQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFS 187          
BLAST of mxi-1 protein vs. TrEMBL
Match: U5YTN7 (Mxi-1 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=mxi-1 PE=2 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 5.892e-146
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 1
Query:  505 DSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHALLAV 1131
            DSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHALLAV
Sbjct:    1 DSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHALLAV 209          
BLAST of mxi-1 protein vs. TrEMBL
Match: U5YR79 (Mxi-2 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=mxi-2 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.809e-28
Identity = 87/236 (36.86%), Postives = 142/236 (60.17%), Query Frame = 1
Query:  292 IEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNGKKSQIP-----IRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEE 984
            +EGSE+++ I++ARN+R H LKL+K       NG +  +      I++SHNE+E+ RRAHLR+CME+LK+ L F  +    RITML++L+KA+STI ++ ++I ++  +E   K++  ++  RL  +++Q + L +  +M ME    +R RN+SECS+ TTSS++S  D            +F+ +A  ++           K++ N+ D+   S   V KCNSP S S DSGF++
Sbjct:    2 LEGSELDKKIVEARNKRFHNLKLIK-------NGCEKTVQNSNNVIKNSHNEVERSRRAHLRNCMEELKRKLVFSNECHLNRITMLHILRKATSTIKSKGKSIRNLYKRECEVKSQNAQVKQRLMYMEKQQQLLCSKYSMYME----KRNRNFSECSINTTSSEESQLDD-----------RFHSKALLIN-----------KLNINKIDNQLKSI-IVSKCNSPISTSSDSGFDD 203          
BLAST of mxi-1 protein vs. TrEMBL
Match: A0A504YVA0 (Max dimerization protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_09767 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 8.899e-26
Identity = 97/253 (38.34%), Postives = 139/253 (54.94%), Query Frame = 1
Query:  385 HNGKKSQIP-IRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCD-----GVRSRRTSTNYSKFYDQASPVHNYKDKELS------KYYKMSTNQDDSLSNSGNNVYKCNSP------NSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILK 1086
            +NG K Q+P IR +HNELEK RRAHLR+CME LK+ L FD D VP RITML VLKKA++TI Y R++N   +   E   K R V+L  R   L+++ +  +N  ++ ++S + ER RN SECS+ TTSSDDS  D     GVR   T++    F   + P H   +  +S      + Y  S+ +   L N    +    SP      ++NS DSGFEE  + +      +   P+   T + ++S + +I K
Sbjct:   59 YNGPKRQLPNIRCTHNELEKSRRAHLRACMETLKEHLNFDND-VP-RITMLTVLKKATATIQYLRQKN-QCLETYEDSEKQRSVQLHKRRQALRKKLEEKRN-RSLKLQSWR-ERNRNCSECSINTTSSDDSEIDAHLRSGVRPELTAS----FGPSSPPRHTIGNTIISDSPVTGQTYMFSSFKH--LKNLTPPLESTRSPVGLDAFDANSSDSGFEEITITSSGAASPEET-PIVYCTPDGSLSRTSYISK 299          
BLAST of mxi-1 protein vs. TrEMBL
Match: A0A2H1BTH2 (Helix-loop-helix DNA-binding domain protein OS=Fasciola hepatica OX=6192 GN=D915_010297 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.614e-25
Identity = 98/252 (38.89%), Postives = 137/252 (54.37%), Query Frame = 1
Query:  385 HNGKKSQIP-IRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCD-----GVRSRRTSTNYSKFYDQASPVHN-----YKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSP------NSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILK 1086
            +NG K Q+P IR +HNELEK RRAHLR+CME LK+ L FD D VP RITML VLKKA++TI Y R++N   +   E   K R V+L  R   L+++ +  +N  ++ ++S + ER RN SECS+ TTSSDDS  D     GVR   T++    F   + P H        D  ++    M +N    L N    +    SP      ++NS DSGFEE  +   + G     +   + T N ++S + +I K
Sbjct:   59 YNGPKRQLPNIRCTHNELEKSRRAHLRACMETLKEHLNFDND-VP-RITMLTVLKKATATIQYLRQKN-QCLETYEDSEKQRSVQLHKRRQALRKKLEEKRN-RSLKLQSWR-ERNRNCSECSINTTSSDDSEIDAHLRSGVRPELTAS----FGPSSPPRHTINNTIISDSPVTGQTYMFSNFKH-LKNLTPPLESTRSPVGLDAFDANSSDSGFEE--ITITSSGAASPEETPIVCTPNGSLSRTSYISK 298          
BLAST of mxi-1 protein vs. TrEMBL
Match: A0A4S2LDI9 (BHLH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009533 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.905e-21
Identity = 98/283 (34.63%), Postives = 147/283 (51.94%), Query Frame = 1
Query:  253 NNGLLLLWNAAVEIEGSEIEQMIL-------QARNRRNHTLKLLKSQDLSFHNGKKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCD-GVRSRRTSTNYSKFYDQAS--PVHNYKDKELSKYYKMSTNQDDS-LSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNK-GEIKSLQPMFLTTTNSTI 1062
             +GLLLL  AA ++E  +  Q          +   R N   K +   +  ++  K+     R +HNELEK RRAHLR+CME LK+ L FD D +P RITML VLKKA++TI Y R+R    +   E   K R+ +L  R   L+++ +  K    + ++S + ER RN SECS+ TTSSDDS  D  +RS  T+++     ++    P    ++  L     +S N+  S L +S       +  +++S DSGF+E  + +  K     SL P  ++ T S I
Sbjct:    8 GDGLLLLLQAARKLESEDTIQRPCYSDGWDHRPNTRANADHKYVVQHNYGYNASKRQIAGPRCTHNELEKSRRAHLRACMETLKEHLNFDND-MP-RITMLAVLKKATTTIQYLRQRK-QCLETCEDSEKQRYAQLVKRRIALRKKLEE-KKSRFLKLQSWR-ERNRNCSECSITTTSSDDSELDLQLRSTHTASHGPSSPNRHPFDPFSRGENASLGVGCVLSNNKHVSPLGSSTRFPSGIDHFDASSSDSGFDEVTIGSSGKTSPDGSLIPYCVSETPSMI 285          
BLAST of mxi-1 protein vs. Ensembl Cavefish
Match: mxd3 (MAX dimerization protein 3 [Source:NCBI gene;Acc:103027736])

HSP 1 Score: 53.5286 bits (127), Expect = 1.017e-7
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYK-RLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGV 789
            R  HNELEK RRA LR C+E+LK+ +    DS   R T LN+L++A          +H   +KE   + +   L +RL   Q++ + RL+ ++         ERMRN S  S +++   DS+ + V
Sbjct:   57 RSVHNELEKHRRAQLRHCLEQLKQQVPLSSDS--TRNTTLNLLRRA---------QLHIKKLKEQDERAKL--LKDRLRWEQQELRVRLQQLQG------GVERMRNDSLGSAVSSERSDSDREDV 163          
BLAST of mxi-1 protein vs. Ensembl Cavefish
Match: mxd4 (MAX dimerization protein 4 [Source:NCBI gene;Acc:103023893])

HSP 1 Score: 50.447 bits (119), Expect = 1.130e-6
Identity = 59/187 (31.55%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  256 NGLLLLWNAAVEIEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNGKKSQI----P-IRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSD---DSNCDGV 789
            N LL+L  AA  +E  + E           +   L  S + S    K +QI    P  R SHNELEK RRA LR  +E+LK+++    DS   R T L++LK+A   I    E++  ++N+KE                LQR+++ LK      +E    ER R  S  S ++T S+   D + +G+
Sbjct:    4 NSLLILLEAAEYLERRDRE-------AEHGYASVLPHSPEYSRKKSKTTQISRKAPSTRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDS--TRHTTLSLLKRARMHIKKLEEQDRRALNVKE---------------QLQREHRYLKR----RLEQLGVERTRTDSMGSTISTDSEQEVDVDIEGM 162          
BLAST of mxi-1 protein vs. Ensembl Cavefish
Match: mxi1 (MAX interactor 1, dimerization protein [Source:NCBI gene;Acc:103033352])

HSP 1 Score: 48.9062 bits (115), Expect = 6.785e-6
Identity = 48/136 (35.29%), Postives = 66/136 (48.53%), Query Frame = 1
Query:  382 FHNGKKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPC-RITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTS-SDDSNCD 783
            F N K S    R +HNELEK RRAHLR C+E+LK ++    D   C R T L +L KA +         H   ++E   K+ + +L N L   QR  +R  +         + ER+R  S  S L +  SD S+ D
Sbjct:  100 FRNKKYSSTHNRSTHNELEKNRRAHLRLCLERLKALIPLGPD---CNRHTTLGLLNKAKA---------HIKKLEEADRKSLY-QLEN-LERKQRHLRRQLDFLRGGCGHGEGERIRTDSVGSTLCSERSDRSDSD 221          
BLAST of mxi-1 protein vs. Ensembl Sea Lamprey
Match: mxd1 (MAX dimerization protein 1 [Source:ZFIN;Acc:ZDB-GENE-060526-246])

HSP 1 Score: 49.2914 bits (116), Expect = 7.572e-7
Identity = 39/123 (31.71%), Postives = 66/123 (53.66%), Query Frame = 1
Query:  421 SHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGV 789
            +HNELEK RRAHLR C+E+LK+++  + +    R T L +L KA +       +I  +  ++  A+++  +L      L+R+ ++L+   A        ERMR  S  S L++   DS+ + V
Sbjct:   70 THNELEKNRRAHLRKCLERLKEMVPLEAEC--SRHTTLGLLNKAKN-------HIKRLEEQDRRAQHQKDQLEREHRYLRRRLEQLQGAPAT------VERMRTDSLGSALSSERSDSDREEV 177          
BLAST of mxi-1 protein vs. Ensembl Medaka
Match: mxd3 (MAX dimerization protein 3 [Source:NCBI gene;Acc:101174840])

HSP 1 Score: 55.0694 bits (131), Expect = 3.322e-8
Identity = 50/150 (33.33%), Postives = 72/150 (48.00%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYK-RLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKD 861
            R  HNELEK RRA LR C+E+LKK +    DS   R T L++L++A          +H   ++E     R  +L  RL   QR+ + RL+ +E         ERMRN S  S +++   DS+ + V     S  +    D+ S  H   D
Sbjct:   59 RSVHNELEKNRRAQLRHCLEQLKKQVPLSSDS--SRNTTLSLLRQA---------QLHIKKLQEQ--DERAEQLKGRLLWEQRELRIRLEQLE------RGTERMRNNSHGSTMSSERSDSDTEDVEVDVESIVFECDSDELSITHTGAD 189          
BLAST of mxi-1 protein vs. Ensembl Medaka
Match: mxd4 (MAX dimerization protein 4 [Source:NCBI gene;Acc:101170006])

HSP 1 Score: 52.7582 bits (125), Expect = 2.093e-7
Identity = 46/128 (35.94%), Postives = 72/128 (56.25%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTI-YTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLK-NMEAMSMESTKAERMRNYSECSVLTTSSD-DSNCDGV 789
            R SHNELEK RRA LR  +E+LKK++    DS   R T L++LK+A   I    E++  ++N+KE                LQR+++ LK  +E +S+ S   ER+R  S  S ++T S+ + + +G+
Sbjct:   55 RSSHNELEKHRRAKLRLYLEQLKKLVPLGPDS--TRHTTLSLLKRAKMHIKKLEEQDKKALNVKE---------------QLQREHRYLKRRLEQLSL-SGSVERIRTDSMGSTISTDSEQEVDIEGM 164          
BLAST of mxi-1 protein vs. Ensembl Medaka
Match: mxi1 (max-interacting protein 1 [Source:NCBI gene;Acc:101164381])

HSP 1 Score: 51.9878 bits (123), Expect = 3.967e-7
Identity = 43/135 (31.85%), Postives = 69/135 (51.11%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +         H   ++E   K++     N+L +L+R+ + L+    + +   + ER+R  S  S L +   DS+ + +     ST +S
Sbjct:   59 RSTHNELEKNRRAHLRLCLERLKALIPLGPDCT--RHTTLGLLTKAKA---------HIKKLEEADRKSQ-----NQLQSLEREQRHLQLQ--LELNPGEGERIRMNSVGSTLCSDRSDSDQEEIEVDVESTEFS 175          
BLAST of mxi-1 protein vs. Ensembl Medaka
Match: mxi1 (max-interacting protein 1 [Source:NCBI gene;Acc:101164381])

HSP 1 Score: 51.9878 bits (123), Expect = 7.906e-7
Identity = 42/136 (30.88%), Postives = 67/136 (49.26%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMEST-KAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +       +I  +   +  ++N+   L     +LQ Q + L+     +  +  + ER+R  S  S L +   DS+ + +     ST +S
Sbjct:  111 RSTHNELEKNRRAHLRLCLERLKALIPLGPDCT--RHTTLGLLTKAKA-------HIKKLEEADRKSQNQLQSLEREQRHLQLQLELLRGGGGGTQSNPGEGERIRMNSVGSTLCSDRSDSDQEEIEVDVESTEFS 237          
BLAST of mxi-1 protein vs. Ensembl Medaka
Match: mxi1 (max-interacting protein 1 [Source:NCBI gene;Acc:101164381])

HSP 1 Score: 50.8322 bits (120), Expect = 1.073e-6
Identity = 42/136 (30.88%), Postives = 67/136 (49.26%), Query Frame = 1
Query:  415 RHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMEST-KAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYS 819
            R +HNELEK RRAHLR C+E+LK ++    D    R T L +L KA +       +I  +   +  ++N+   L     +LQ Q + L+     +  +  + ER+R  S  S L +   DS+ + +     ST +S
Sbjct:   59 RSTHNELEKNRRAHLRLCLERLKALIPLGPDCT--RHTTLGLLTKAKA-------HIKKLEEADRKSQNQLQSLEREQRHLQLQLELLRGGGGGTQSNPGEGERIRMNSVGSTLCSDRSDSDQEEIEVDVESTEFS 185          
BLAST of mxi-1 protein vs. Planmine SMEST
Match: SMESG000047681.1 (SMESG000047681.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 294/296 (99.32%), Postives = 295/296 (99.66%), Query Frame = 1
Query:  244 MADNNGLLLLWNAAVEIEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNGKKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHALLAV 1131
            MADNNGLLLLWNAAVEIEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNGKKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQ SPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHA+LAV
Sbjct:    1 MADNNGLLLLWNAAVEIEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNGKKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQTSPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHMNNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHAMLAV 296          
BLAST of mxi-1 protein vs. Planmine SMEST
Match: SMESG000060394.1 (SMESG000060394.1)

HSP 1 Score: 146.747 bits (369), Expect = 8.459e-40
Identity = 97/252 (38.49%), Postives = 154/252 (61.11%), Query Frame = 1
Query:  244 MADNNGLLLLWNAAVEIEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNGKKSQIP-----IRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVLKKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEAMSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASPVHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEE 984
            M  ++ LLLLW AAV +EGSE+++ I++ARN+R H LKL+K       NG +  +      I++SHNE+E+ RRAHLR+CME+LK+ L F  +    RITML++L+KA+STI ++E++I ++  +E   K++  ++  RL  +++Q + L +  +M ME    +R RN+SECS+ TTSS++S  D            +F+ +A  ++           K++ N+ D+   S   V KCNSP S S DSGF++
Sbjct:    1 MIQSDRLLLLWQAAVTLEGSELDKKIVEARNKRFHNLKLIK-------NGCEKTVQNSNNVIKNSHNEVERSRRAHLRNCMEELKRKLVFSNECHLNRITMLHILRKATSTIKSKEKSIRNLYKRECEVKSQNAQIKQRLMYMEKQQQLLCSKYSMYME----KRNRNFSECSINTTSSEESQLDD-----------RFHSKALLIN-----------KLNINKIDNQLKSI-IVSKCNSPISTSSDSGFDD 218          
The following BLAST results are available for this feature:
BLAST of mxi-1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MXI18.516e-731.85MAX interactor 1, dimerization protein [Source:HGN... [more]
MXI18.516e-731.85MAX interactor 1, dimerization protein [Source:HGN... [more]
MXI18.516e-731.85MAX interactor 1, dimerization protein [Source:HGN... [more]
MXI18.516e-731.85MAX interactor 1, dimerization protein [Source:HGN... [more]
MXI18.516e-731.85MAX interactor 1, dimerization protein [Source:HGN... [more]
back to top
BLAST of mxi-1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of mxi-1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of mxi-1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mxd47.378e-834.72MAX dimerization protein 4 [Source:ZFIN;Acc:ZDB-GE... [more]
mxd32.023e-734.92MAX dimerization protein 3 [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of mxi-1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mxi19.708e-831.39MAX interactor 1, dimerization protein [Source:NCB... [more]
mxi11.010e-731.39MAX interactor 1, dimerization protein [Source:NCB... [more]
mxd49.725e-735.16MAX dimerization protein 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of mxi-1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mxd12.140e-733.61MAX dimerization protein 1 [Source:MGI Symbol;Acc:... [more]
Mxd13.602e-733.59MAX dimerization protein 1 [Source:MGI Symbol;Acc:... [more]
Mxi16.014e-731.85MAX interactor 1, dimerization protein [Source:MGI... [more]
Mxi16.014e-731.85MAX interactor 1, dimerization protein [Source:MGI... [more]
Mxi16.014e-731.85MAX interactor 1, dimerization protein [Source:MGI... [more]
back to top
BLAST of mxi-1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50538|MAD1_MOUSE2.296e-633.59Max dimerization protein 1 OS=Mus musculus OX=1009... [more]
sp|O09015|MXI1_RAT4.869e-631.85Max-interacting protein 1 OS=Rattus norvegicus OX=... [more]
sp|Q7SX95|MAD3_DANRE6.059e-634.13Max dimerization protein 3 OS=Danio rerio OX=7955 ... [more]
sp|Q14582|MAD4_HUMAN6.872e-633.60Max dimerization protein 4 OS=Homo sapiens OX=9606... [more]
sp|P50540|MXI1_MOUSE8.321e-631.85Max-interacting protein 1 OS=Mus musculus OX=10090... [more]
back to top
BLAST of mxi-1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YTN75.892e-146100.00Mxi-1 protein (Fragment) OS=Schmidtea mediterranea... [more]
U5YR791.809e-2836.86Mxi-2 protein (Fragment) OS=Schmidtea mediterranea... [more]
A0A504YVA08.899e-2638.34Max dimerization protein 1 OS=Fasciola gigantica O... [more]
A0A2H1BTH21.614e-2538.89Helix-loop-helix DNA-binding domain protein OS=Fas... [more]
A0A4S2LDI92.905e-2134.63BHLH domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of mxi-1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mxd31.017e-734.13MAX dimerization protein 3 [Source:NCBI gene;Acc:1... [more]
mxd41.130e-631.55MAX dimerization protein 4 [Source:NCBI gene;Acc:1... [more]
mxi16.785e-635.29MAX interactor 1, dimerization protein [Source:NCB... [more]
back to top
BLAST of mxi-1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mxd17.572e-731.71MAX dimerization protein 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of mxi-1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of mxi-1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of mxi-1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxd33.322e-833.33MAX dimerization protein 3 [Source:NCBI gene;Acc:1... [more]
mxd42.093e-735.94MAX dimerization protein 4 [Source:NCBI gene;Acc:1... [more]
mxi13.967e-731.85max-interacting protein 1 [Source:NCBI gene;Acc:10... [more]
mxi17.906e-730.88max-interacting protein 1 [Source:NCBI gene;Acc:10... [more]
mxi11.073e-630.88max-interacting protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of mxi-1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000047681.10.000e+099.32SMESG000047681.1[more]
SMESG000060394.18.459e-4038.49SMESG000060394.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009973
GenBankAGZ94930.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009973 ID=SMED30009973|Name=mxi-1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1876bp
CAAGTTTAATCAGCCCCGTTATTCTATAATTCCAAAGAAATTCTAAGATA
TTCAATACACGTAGTCAGGGCGGCCAGTAAAGAGATTTTGCTAGCAGCGT
GGCAAAAATTTAATCATCTGATTATCGATTGCTTTTCTAATTGGCCAATC
AGAGTTGAGCAACGTCATTCTATAAATATTAATGCAATGTGATTTCAGCA
TTATTTCCTTATCGAAATTATTTTGCATTTGAATTTGAAAAGTATGGCAG
ATAATAATGGTTTATTATTGTTATGGAATGCTGCAGTTGAAATTGAAGGT
TCTGAAATTGAGCAAATGATTTTACAAGCCAGAAATCGAAGAAATCATAC
TCTAAAATTACTTAAATCGCAAGATTTATCTTTTCATAATGGAAAAAAAT
CTCAAATTCCAATAAGACATTCGCACAATGAATTAGAAAAATGCAGACGA
GCACACCTAAGATCATGCATGGAAAAATTGAAGAAAGTCTTACGATTTGA
CCAAGATTCCGTACCCTGTCGAATTACAATGCTCAATGTTCTTAAAAAAG
CTTCTAGCACGATTTATACACGTGAACGCAACATTCATTCAATGAACATG
AAAGAAACGATGGCTAAAAATCGTTTTGTTGAATTGACAAATAGATTGAA
CAATTTGCAGCGACAATATAAACGATTGAAAAATATGGAAGCCATGTCTA
TGGAATCAACGAAAGCAGAACGAATGCGAAATTATTCGGAATGTTCAGTG
TTAACTACTTCTTCAGATGACTCAAATTGTGATGGAGTGAGATCTCGAAG
AACGTCAACAAATTATTCAAAATTTTACGATCAAGCTAGTCCGGTGCATA
ACTATAAAGACAAAGAGCTTTCCAAGTATTATAAAATGTCAACAAATCAA
GATGATTCACTATCAAACTCTGGTAACAATGTATATAAATGTAATTCTCC
AAATAGCAACAGCTGTGATTCTGGATTTGAAGAAAGTCATATGAATAATA
AAAATAAAGGCGAAATCAAATCTTTGCAACCAATGTTTCTAACCACAACA
AACTCTACTATTTCTAACAGTAAATTTATTCTCAAAGATCCTGGATCAAT
TATCGAAACCGATCATGCTTTGTTAGCTGTATGATAATTATTAAAACAAA
CAAACAAAACACTGCGTTCATATTGGATACTCCATTAGTTAGTTTTTGAC
TTTGTGGACTTAAACAGAGTACATAAAAACAATTCTATAATTAGTTTGTC
GTCTGTTCGAAATTTTTCTATAGTGAAAAAAAAATCCAAAAAAAATCTGG
AAAAATCAATGACAGACTGGGCTTTCTAAAAAAATATTATTTCGTTATTG
TTCAAACGTTATATATCGTCGTTACCTGCTACTGGATCCTGTGTTTACAT
TTATGCCTGGATTTGTTGTGTAAATTATCGCCATCACTCAATTTTATCAG
ATAATAATATATTGTAAAGCTAAAGAATTATTATTAATGAATATTTGGAT
GTTTTGTAAATAAATTTCAGTATAAACGATTAATTGGCTATTATCTCTCG
CTCTCTCTCTCTCTCTCTCTTGTCTATCCAATCACGATTTCACCGAACGC
TACTCAATGCGTGCCGCGGTTTTTCTCTTCTGTAGTTCAATGTGCAATTT
ATTTCTCTTTGATTTTTATGCCGCTATTATTTATTTTGACAGTGAATAAT
AATTCTGTCACACCGATATGTTCGGATTTTTTATTTGTCATTTCTACAGC
TGGAACTTTGGATACCTGTGCCATTCGCTGCCAGATATCCATCCAATCAT
GTGCAACTTGTCTATGGGTTTCATGGAATTGTGAAATCGATTTATAAATG
CCAATACATTTGTGTTTTTGGATTCG
back to top

protein sequence of SMED30009973-orf-1

>SMED30009973-orf-1 ID=SMED30009973-orf-1|Name=SMED30009973-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=297bp
MADNNGLLLLWNAAVEIEGSEIEQMILQARNRRNHTLKLLKSQDLSFHNG
KKSQIPIRHSHNELEKCRRAHLRSCMEKLKKVLRFDQDSVPCRITMLNVL
KKASSTIYTRERNIHSMNMKETMAKNRFVELTNRLNNLQRQYKRLKNMEA
MSMESTKAERMRNYSECSVLTTSSDDSNCDGVRSRRTSTNYSKFYDQASP
VHNYKDKELSKYYKMSTNQDDSLSNSGNNVYKCNSPNSNSCDSGFEESHM
NNKNKGEIKSLQPMFLTTTNSTISNSKFILKDPGSIIETDHALLAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 121..148
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 58..84
e-value: 1.9E-5
score: 24.5
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 56..110
score: 9.445
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 58..103
e-value: 1.90596E-4
score: 36.8083
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 57..149
e-value: 5.5E-9
score: 38.0
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 58..135