Intraflagellar transport protein 122 homolog

Overview
NameIntraflagellar transport protein 122 homolog
Smed IDSMED30009968
Length (bp)3717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intraflagellar transport protein 122 homolog (SMED30009968) t-SNE clustered cells

Violin plots show distribution of expression levels for Intraflagellar transport protein 122 homolog (SMED30009968) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intraflagellar transport protein 122 homolog (SMED30009968) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intraflagellar transport protein 122 homolog (SMED30009968) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009968

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009968SMESG000039305.1 SMESG000039304.1 SmedASXL_016400SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009968SMESG000039305.1 SMESG000039304.1 dd_Smed_v4_11912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009968SMESG000039305.1 SMESG000039304.1 dd_Smed_v4_11912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009968SMESG000039305.1 SMESG000039304.1 dd_Smed_v4_11912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009968SMESG000039305.1 SMESG000039304.1 dd_Smed_v6_11912_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30009968SMESG000039305.1 SMESG000039304.1 OX_Smed_1.0.04741ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009968SMESG000039305.1 SMESG000039304.1 dd_Smed_v4_11912_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Human
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1287.32 bits (3330), Expect = 0.000e+0
Identity = 616/1211 (50.87%), Postives = 881/1211 (72.75%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPI-PKNSFKNDAHMIVTQN-VQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E CI D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  NDA+QC+S+NP++  LAS +  +FG+WSP+ K + K + ++++ CCSWT DGQYLALGM+NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E+ DILAV DW QK++FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C++KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKCK++VK+IAIY+NRL IQ P+K+ IY+  S+D +DM YR  +KI K F+CNL+++  NH+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SRKKL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H     G VVG+NG+K++ LH +++   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  + +F  AK AF R++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  ALEMY+D+  F+ AK      DP ETK+++ KQADWA++ KE K+AV MY+ AG+++KA+EI  ++ W DMLID+ARKLD  +++ +L CA YL +L++  YA+E Y K+GD+ ++V+L+VET+ W+EAF L +K+PEFK  IY+PY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IA+D P+ K  M+ KF  FQ  A++Y+ YH+IHR+ E+PF  H PE  FN+SR+LLH+ +  ++  GISKV ILFTLAKQ K LGA++++R+AY+KL+ L +P R +K+ + G+L+IR+KPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S++ L LVEF +E+ I+DEEA+ LI  + + PK   ++D  + +  N  Q L L +  +    +DPF+AKL   +    F PVV+ R  L+++S  ++++ +WPPPLR+QYF++++ D +IT C +CF++FH+EDYEL  LQ G CP+CR
Sbjct:    1 MRAVLTW------RDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDAIQCVSYNPITHQLASCSSSDFGLWSPEQKSVSKHKSSSKIICCSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREERNDILAVADWGQKVSFYQLSGKQ----------------------IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLSDMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLVYDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGSKIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGL-DFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQLHVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQLTNNAVAESRFNDAAYYYWMLSMQCLDIAQD-PAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNISRFLLHS-LPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYDKLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPK---RDDRQLEIANNSSQILRLVETKDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCR 1174          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Human
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1249.19 bits (3231), Expect = 0.000e+0
Identity = 608/1261 (48.22%), Postives = 875/1261 (69.39%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGT----------VIIWNSETLEGILRFIL----------------------------------------NDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPI-PKNSFKNDAHMIVTQN-VQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E CI D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD +          ++ + S ++   L   L                                        NDA+QC+S+NP++  LAS +  +FG+WSP+ K + K + ++++ CCSWT DGQYLALGM+NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E+ DILAV DW QK++FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C++KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKCK++VK+IAIY+NRL IQ P+K+ IY+  S+D +DM YR  +KI K F+CNL+++  NH+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SRKKL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H     G VVG+NG+K++ LH +++   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  ++ F  AK AF R++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  ALEMY+D+  F+ AK      DP ETK+++ KQADWA++ KE K+AV MY+ AG+++KA+EI  ++ W DMLID+ARKLD  +++ +L CA YL +L++  YA+E Y K+GD+ ++V+L+VET+ W+EAF L +K+PEFK  IY+PY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IA+  P+ K  M+ KF  FQ  A++Y+ YH+IHR+ E+PF  H PE  FN+SR+LLH+ +  ++  GISKV ILFTLAKQ K LGA++++R+AY+KL+ L +P R +K+ + G+L+IR+KPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S++ L LVEF +E+ I+DEEA+ LI  + + PK   ++D  + +  N  Q L L +  +    +DPF+AKL   +    F PVV+ R  L+++S  ++++ +WPPPLR+QYF++++ D +IT C +CF++FH+EDYEL  LQ G CP+CR
Sbjct:    1 MRAVLTW------RDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSKLEGILKYTSWSVMSSLHLHLPFLGLHKTVRVTATDKAPKGQGGRIDCLRPSVQNQPGQKHNDAIQCVSYNPITHQLASCSSSDFGLWSPEQKSVSKHKSSSKIICCSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREERNDILAVADWGQKVSFYQLSGKQ----------------------IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLSDMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLVYDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGSKIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGLD-FETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQLHVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQLTNNAVAESRFNDAAYYYWMLSMQCLDIAQADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNISRFLLHS-LPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYDKLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPK---RDDRQLEIANNSSQILRLVETKDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCR 1226          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Human
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 601/1304 (46.09%), Postives = 873/1304 (66.95%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGT----------VIIWNSETLEGILRFIL----------------------------------------NDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQN----------KSEQTDILAVGDWSQKL------TFYQLSGKRMI---------------------------YPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPI-PKNSFKNDAHMIVTQN-VQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E CI D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD +          ++ + S ++   L   L                                        NDA+QC+S+NP++  LAS +  +FG+WSP+ K + K + ++++ CCSWT DGQYLALGM+NGIISIRN+NGEEK KIER GG+L+PIWS+ WN +          ++E  + + V  + Q++        Y   G                               + + +S    S KQ      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C++KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKCK++VK+IAIY+NRL IQ P+K+ IY+  S+D +DM YR  +KI K F+CNL+++  NH+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SRKKL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H     G VVG+NG+K++ LH +++   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  + +F  AK AF R++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  ALEMY+D+  F+ AK      DP ETK+++ KQADWA++ KE K+AV MY+ AG+++KA+EI  ++ W DMLID+ARKLD  +++ +L CA YL +L++  YA+E Y K+GD+ ++V+L+VET+ W+EAF L +K+PEFK  IY+PY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IA+D P+ K  M+ KF  FQ  A++Y+ YH+IHR+ E+PF  H PE  FN+SR+LLH+ +  ++  GISKV ILFTLAKQ K LGA++++R+AY+KL+ L +P R +K+ + G+L+IR+KPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S++ L LVEF +E+ I+DEEA+ LI  + + PK   ++D  + +  N  Q L L +  +    +DPF+AKL   +    F PVV+ R  L+++S  ++++ +WPPPLR+QYF++++ D +IT C +CF++FH+EDYEL  LQ G CP+CR
Sbjct:    1 MRAVLTW------RDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSKLEGILKYTSWSVMSSLHLHLPFLGLHKTVRVTATDKAPKGQGGRIDCLRPSVQNQPGQKHNDAIQCVSYNPITHQLASCSSSDFGLWSPEQKSVSKHKSSSKIICCSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSSRWESFWMNRENEDAEDVIVNRYIQEIPSTLKSAVYSSQGSEAEEEEPEEEDDSPRDDNLEERNDILAVADWGQKVSFYQLSGKQ------IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLSDMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLVYDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGSKIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGL-DFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQLHVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQLTNNAVAESRFNDAAYYYWMLSMQCLDIAQD-PAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNISRFLLHS-LPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYDKLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPK---RDDRQLEIANNSSQILRLVETKDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCR 1284          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Human
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 578/1211 (47.73%), Postives = 835/1211 (68.95%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPI-PKNSFKNDAHMIVTQN-VQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E CI D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K                                         D V C+++             + G+WSP+ K + K + ++++ CCSWT DGQYLALGM+NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E+ DILAV DW QK++FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C++KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKCK++VK+IAIY+NRL IQ P+K+ IY+  S+D +DM YR  +KI K F+CNL+++  NH+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SRKKL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H     G VVG+NG+K++ LH +++   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  ++ F  AK AF R++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  ALEMY+D+  F+ AK      DP ETK+++ KQADWA++ KE K+AV MY+ AG+++KA+EI  ++ W DMLID+ARKLD  +++ +L CA YL +L++  YA+E Y K+GD+ ++V+L+VET+ W+EAF L +K+PEFK  IY+PY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IA+  P+ K  M+ KF  FQ  A++Y+ YH+IHR+ E+PF  H PE  FN+SR+LLH+ +  ++  GISKV ILFTLAKQ K LGA++++R+AY+KL+ L +P R +K+ + G+L+IR+KPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S++ L LVEF +E+ I+DEEA+ LI  + + PK   ++D  + +  N  Q L L +  +    +DPF+AKL   +    F PVV+ R  L+++S  ++++ +WPPPLR+QYF++++ D +IT C +CF++FH+EDYEL  LQ G CP+CR
Sbjct:    1 MRAVLTW------RDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHK-----------------------------------------DTVYCVAYA------------KDGLWSPEQKSVSKHKSSSKIICCSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREERNDILAVADWGQKVSFYQLSGKQ----------------------IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLSDMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLVYDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGSKIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGLD-FETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQLHVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQLTNNAVAESRFNDAAYYYWMLSMQCLDIAQADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNISRFLLHS-LPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYDKLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPK---RDDRQLEIANNSSQILRLVETKDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCR 1123          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Human
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1174.07 bits (3036), Expect = 0.000e+0
Identity = 577/1211 (47.65%), Postives = 827/1211 (68.29%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPI-PKNSFKNDAHMIVTQN-VQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E CI D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA D                                V C+                 G+WSP+ K + K + ++++ CCSWT DGQYLALGM+NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E+ DILAV DW QK++FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C++KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKCK++VK+IAIY+NRL IQ P+K+ IY+  S+D +DM YR  +KI K F+CNL+++  NH+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SRKKL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H     G VVG+NG+K++ LH +++   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  + +F  AK                  +E+   GE N ++ + D+++YQ  F EAAK Y  +  E  ALEMY+D+  F+ AK      DP ETK+++ KQADWA++ KE K+AV MY+ AG+++KA+EI  ++ W DMLID+ARKLD  +++ +L CA YL +L++  YA+E Y K+GD+ ++V+L+VET+ W+EAF L +K+PEFK  IY+PY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IA+  P+ K  M+ KF  FQ  A++Y+ YH+IHR+ E+PF  H PE  FN+SR+LLH+ +  ++  GISKV ILFTLAKQ K LGA++++R+AY+KL+ L +P R +K+ + G+L+IR+KPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S++ L LVEF +E+ I+DEEA+ LI  + + PK   ++D  + +  N  Q L L +  +    +DPF+AKL   +    F PVV+ R  L+++S  ++++ +WPPPLR+QYF++++ D +IT C +CF++FH+EDYEL  LQ G CP+CR
Sbjct:    1 MRAVLTW------RDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKD--------------------------------VLCIE----------------GLWSPEQKSVSKHKSSSKIICCSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREERNDILAVADWGQKVSFYQLSGKQ----------------------IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLSDMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLVYDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGSKIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGL-DFETAK------------------KERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQLHVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQLTNNAVAESRFNDAAYYYWMLSMQCLDIAQADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNISRFLLHS-LPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYDKLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPK---RDDRQLEIANNSSQILRLVETKDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCR 1110          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Celegans
Match: daf-10 (Intraflagellar transport protein 122 homolog [Source:UniProtKB/Swiss-Prot;Acc:G5EFW7])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 416/1230 (33.82%), Postives = 687/1230 (55.85%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKE-RCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIR---NRNGEEKSKIERTGGALTPIWSLQWNQNKSEQT-----------DILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQ-----PQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLR-LPD-RLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+ +L+W   + D+      CI+D  F PDG  +++A+D  V ++  ++G +++ LKG+K  VY VA++ +G+ FASG AD  VI+WN E  EG LR+   D +QC+ FNP + IL + A  EFG+WS  DK + K R   R   C+W  DG   A+G  +G I++R   N   E    I+R      PIW + ++ N++  +           +I+AV DW++ L+FY L G            +   K             L F+P  IS+  N  YLLI GSDK + +YT+ G+ L  V +   W+W    +P S    + C  DGTI+ + + F  VH +   RYA R+ MTDV + +L     + I C D+VK++++Y  +L +Q  DK+ IY+      +++    ++Y   D I+K    +LM++T  HL++C D +L  Y + GIK+R W M S + Y + +GGP  +E +++G  +G + KV++DN +PI +     +IKC+DI+ +R  L  I+++ +    ++   E L QE G +S+ +NT N+++  +   + + ++    P H     G V+GF   + + L ++ +   E+P +  +Y Y++R ++++A +IACLGV  NDW YL   AL  +  F +A+ A+ R+RD   ++++ E+++  ++GE +  IL   I AY   F EAAK +     E +A+E+++D++ FD  + +         K+++ K+A WA+   + K A  M + +G   KA  ++ +N W ++ I+++ K+D +  + + K + Y  + +    AS  +  I D+ ++V ++V   +W +AF +  ++P++ + +Y+PY+++LAE D+FEEAQ AFH+AG + EA+ VLE LT+N+V E R+ DA +YYW LS Q L+  R        ++NK KE  + AD YY Y+ +  +  +PF     E   NM+RYL     F   +D ISKV + FT+AK    +GA+K +R A ++L +LR LP   L    +  +L+IR+KPF D E +  MCYRC   NPLL   G  C++C+ PF+ SF+SF+ LPL+EF+IE DIS +EA ELI  +P                              L+DD ++  L  ++  +    ++L+RE+L  +    +I+  +PPPL  ++  NVM  + I +C  C ++F  +D+E+  L+KGHCPFCR
Sbjct:    1 MRPNLLWVDKILDENNEAGVCIYDLAFKPDGSELLLAADNKVYLFDVNEGGQMQTLKGHKDLVYTVAWSHNGELFASGGADKLVILWN-EKHEGTLRYSHTDVIQCMMFNPCNQILLTCALNEFGLWSTADKNVIKQRSVVRCCSCAWNTDGTIFAIGHGDGTITLRKGTNATEEPSIIIQRDN---EPIWGIAFSSNRTFASRDSQGNPMGIDEIMAVIDWNKTLSFYSLDG-----------TFIESKN------------LEFEPHCISYCLNGEYLLIGGSDKILKIYTRKGVLLGTVAQMDHWIWSVTVRPNSQTVAMGC-VDGTIACYNLVFSTVHCVDHARYANRKSMTDVFVQNLEYRTSSNICCHDLVKKMSLYDTKLAVQLSDKIQIYKQTGGVSKNERRKQLKYTLQDTIRKDLSFSLMVVTHGHLVVCNDEKLECYDFKGIKKRSWNMKSIVRYLRVLGGPAHRETLVLGTTDGGVYKVFIDNDYPILLDSRKTAIKCIDINANRTVLASIEDTLVCKWSDIATGETLLQEPGCYSVVFNTVNENLFAFTTNNMLHVRTLAAPGHTTRGVGYVLGFVKNRTFCLVQYNLIPLEVPYTIHLYQYIERGDFKEALRIACLGVVKNDWKYLANKALDALE-FDVARKAYKRVRDRKMLRMVWELKKMKSNGEPDA-ILRATILAYTKKFREAAKIFKENGFENRAMELFTDMRMFDDVQEVMTTASGETKKMLMRKRASWARDANQPKIAAEMLISSGDLDKAALLIIDNDWLELAIEISHKIDRSDLETMKKLSAYFIRKHEFGLASRIFQSINDMKSIVDMHVNAGHWTDAFAIADRHPKYVEDVYLPYARFLAERDRFEEAQKAFHRAGKEQEAMHVLEQLTSNSVNENRFADAGFYYWLLSQQYLD--RSQTEENLTLLNKAKEAASLADAYYAYYPVFIFCSQPFSFERNENILNMARYL----TFTPYIDNISKVFVYFTIAKIANEMGAYKSARTALDQLTNLRVLPQFELDGQIEVMTLNIRAKPFTDVESMQPMCYRCGLNNPLL--GGMSCIHCETPFIISFVSFDILPLIEFKIENDISFDEAKELIESEP-----------------------------PLSDDDYNP-LRGLK--KGIKEIILNRESLSKLEQGHVIIQTFPPPLAPKFLFNVMPSITIAQCKGCNKVFDLDDFEMACLRKGHCPFCR 1160          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Fly
Match: Oseg1 (gene:FBgn0265102 transcript:FBtr0345038)

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 452/1203 (37.57%), Postives = 714/1203 (59.35%), Query Frame = 3
Query:   75 EKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQW-NQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEA-KSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGES-SMFIKASDYPSH-ELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEI--ARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRS--KPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPP-LRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCRCQS 3656
            E  + + C++PDG ++V+A+   ++IY  +DGS L  LK +K TV CVAY+ DGKRFASGA+D  VI+W S  LEG+L++   D++QC+SFNPVS  LAS +  +F  WS D K ++K +++ARV  CSWT DGQYL LG+ NG ISIRN+ GEEK +I+R GG  + ++S+Q    +     D + V DWSQ L+F+ LSG+                       +GKE  LGFDP  + + PN  + L+ G    +  +T++GI+L  + +   +W+W     P   +  + C QDGT++   I    VH+++R+RYAFRE M DV+I HL++ QK RIKC+D+V++IAIY+NRL +Q P++V +Y+  S +   M Y+  +KIQ+ FDC+L+++   H++LC+++RL    + G+ +REWIMDS I Y K  GGP  +EG+++G KNGQ+ +++L+N  P+ I     +++CLDI+  R K+ V+D+   L V ++  + +L+Q+ GV+S+ WNT  D M+CY   +  + ++  + P     N  G+VVG  G   + L    M  + +   + M+ +++   +++AY++ACLGVTT+DW  L + AL  + + +IA+ A+ ++R+  +++LI E+ ++         +L+ +  A+   F EAA+ ++      +ALEMY+D++ FD A+         E K ++ K+A+WA S KE ++A  + L AG+  KA++I+ E  WAD+L D+ R+L LT++D +   A  L  L     A+E + K+GD   VV+L++E R+W EAF L +  PE    ++  + QWLAE D+F EA  A+ KAG   EA  +L+ L+  A+ E+RY DASY+YW L+ Q L++  A++  +     + ++K     A VYY Y  I+ YM+EPF TH P + FN+SR++L+         G+S  ++LFTLAKQ K L A K+     ++LQSL+ P  +++      L+ ++    F+D E++L +CY+CS  +  LN   N C  C++ ++ SF+SFE LPLV+F  E DISD EA  L+    +       D+                       DPF+      E+  +  P+ LDR  L+ I    +++LK     +R  Y++N++ D+ +T C  C  LF+ ED+ELQ LQKGHCPFC   S
Sbjct:   20 EISVHNVCYAPDGSQLVVAAGDRLLIYDPNDGSLLNTLKAHKDTVNCVAYSRDGKRFASGASDKMVIVW-SPQLEGLLKYSHGDSIQCMSFNPVSHHLASCSLSDFAFWSADQKAVQKYKISARVNGCSWTNDGQYLILGLANGTISIRNKLGEEKGRIDRPGGPNSNVFSVQCCPASGPGSVDTIGVVDWSQTLSFHTLSGQM----------------------IGKERTLGFDPLCLQYFPNGEFCLVGGCTGGLHFFTREGIRLGTLGDTFDTWIWTVALHPNGQSYTIGC-QDGTLACFNIASSTVHALYRERYAFRENMCDVIIQHLISGQKVRIKCRDLVQKIAIYRNRLAVQLPERVVLYELSSGEDQPMHYKVREKIQQKFDCSLLVVCGRHIVLCQEKRLQCLDFMGVLQREWIMDSFIRYIKVTGGPVGREGLMVGLKNGQVFRIFLNNSLPLLITTAVSAVRCLDINSKRSKIAVVDDVGRLVVRDVINDTILYQDTGVNSVTWNTHLDSMLCYTHTTGGLSVRVGNLPPRAPQNMHGVVVGLCGATAFCLRGNIMHNTPLALGSTMWQFIEAGLFDEAYQVACLGVTTSDWEGLAQSALEAL-HINIARDAYVKVRNLPWLKLIGELRDQQQRSAVPKEVLLAENCAFAGKFKEAARLFLKCGQSSRALEMYTDLRMFDLAQEYIKDGTDQEKKELVRKRAEWAYSVKEPRAAAELLLSAGENQKAIDIVAEQGWADVLYDIGRRLSLTERDSLESVAQNLKTLKALPLAAEIFKKLGDEAQVVQLHIEVRDWPEAFRLAESLPELLPTVHYQHGQWLAETDQFIEAHQAYIKAGRTKEANRLLKQLSNTAIVEERYLDASYFYWLLAKQHLDVYHAKEEQNPVDHHLTEYKNHLRVAKVYYAYSVIYSYMKEPFTTHSPVSLFNVSRFILNEVEHKGVPKGVSMFSVLFTLAKQAKFLQANKLCLLINKRLQSLKPPAGVQEQIDLNFLNSKACKSGFNDPEELLPLCYKCSNYSQHLN--SNCCPTCRQDYIFSFVSFEILPLVQFYPEVDISDAEAERLL----LAPAKHAEDS-----------------------DPFN------EDVASALPLSLDRNGLRAIDPNHVLILKRRGKNVRNVYYRNILPDLQVTYCPQCLLLFYAEDFELQVLQKGHCPFCHTSS 1162          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Fly
Match: Oseg1 (gene:FBgn0265102 transcript:FBtr0076663)

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 452/1203 (37.57%), Postives = 714/1203 (59.35%), Query Frame = 3
Query:   75 EKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQW-NQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEA-KSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGES-SMFIKASDYPSH-ELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEI--ARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRS--KPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPP-LRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCRCQS 3656
            E  + + C++PDG ++V+A+   ++IY  +DGS L  LK +K TV CVAY+ DGKRFASGA+D  VI+W S  LEG+L++   D++QC+SFNPVS  LAS +  +F  WS D K ++K +++ARV  CSWT DGQYL LG+ NG ISIRN+ GEEK +I+R GG  + ++S+Q    +     D + V DWSQ L+F+ LSG+                       +GKE  LGFDP  + + PN  + L+ G    +  +T++GI+L  + +   +W+W     P   +  + C QDGT++   I    VH+++R+RYAFRE M DV+I HL++ QK RIKC+D+V++IAIY+NRL +Q P++V +Y+  S +   M Y+  +KIQ+ FDC+L+++   H++LC+++RL    + G+ +REWIMDS I Y K  GGP  +EG+++G KNGQ+ +++L+N  P+ I     +++CLDI+  R K+ V+D+   L V ++  + +L+Q+ GV+S+ WNT  D M+CY   +  + ++  + P     N  G+VVG  G   + L    M  + +   + M+ +++   +++AY++ACLGVTT+DW  L + AL  + + +IA+ A+ ++R+  +++LI E+ ++         +L+ +  A+   F EAA+ ++      +ALEMY+D++ FD A+         E K ++ K+A+WA S KE ++A  + L AG+  KA++I+ E  WAD+L D+ R+L LT++D +   A  L  L     A+E + K+GD   VV+L++E R+W EAF L +  PE    ++  + QWLAE D+F EA  A+ KAG   EA  +L+ L+  A+ E+RY DASY+YW L+ Q L++  A++  +     + ++K     A VYY Y  I+ YM+EPF TH P + FN+SR++L+         G+S  ++LFTLAKQ K L A K+     ++LQSL+ P  +++      L+ ++    F+D E++L +CY+CS  +  LN   N C  C++ ++ SF+SFE LPLV+F  E DISD EA  L+    +       D+                       DPF+      E+  +  P+ LDR  L+ I    +++LK     +R  Y++N++ D+ +T C  C  LF+ ED+ELQ LQKGHCPFC   S
Sbjct:   20 EISVHNVCYAPDGSQLVVAAGDRLLIYDPNDGSLLNTLKAHKDTVNCVAYSRDGKRFASGASDKMVIVW-SPQLEGLLKYSHGDSIQCMSFNPVSHHLASCSLSDFAFWSADQKAVQKYKISARVNGCSWTNDGQYLILGLANGTISIRNKLGEEKGRIDRPGGPNSNVFSVQCCPASGPGSVDTIGVVDWSQTLSFHTLSGQM----------------------IGKERTLGFDPLCLQYFPNGEFCLVGGCTGGLHFFTREGIRLGTLGDTFDTWIWTVALHPNGQSYTIGC-QDGTLACFNIASSTVHALYRERYAFRENMCDVIIQHLISGQKVRIKCRDLVQKIAIYRNRLAVQLPERVVLYELSSGEDQPMHYKVREKIQQKFDCSLLVVCGRHIVLCQEKRLQCLDFMGVLQREWIMDSFIRYIKVTGGPVGREGLMVGLKNGQVFRIFLNNSLPLLITTAVSAVRCLDINSKRSKIAVVDDVGRLVVRDVINDTILYQDTGVNSVTWNTHLDSMLCYTHTTGGLSVRVGNLPPRAPQNMHGVVVGLCGATAFCLRGNIMHNTPLALGSTMWQFIEAGLFDEAYQVACLGVTTSDWEGLAQSALEAL-HINIARDAYVKVRNLPWLKLIGELRDQQQRSAVPKEVLLAENCAFAGKFKEAARLFLKCGQSSRALEMYTDLRMFDLAQEYIKDGTDQEKKELVRKRAEWAYSVKEPRAAAELLLSAGENQKAIDIVAEQGWADVLYDIGRRLSLTERDSLESVAQNLKTLKALPLAAEIFKKLGDEAQVVQLHIEVRDWPEAFRLAESLPELLPTVHYQHGQWLAETDQFIEAHQAYIKAGRTKEANRLLKQLSNTAIVEERYLDASYFYWLLAKQHLDVYHAKEEQNPVDHHLTEYKNHLRVAKVYYAYSVIYSYMKEPFTTHSPVSLFNVSRFILNEVEHKGVPKGVSMFSVLFTLAKQAKFLQANKLCLLINKRLQSLKPPAGVQEQIDLNFLNSKACKSGFNDPEELLPLCYKCSNYSQHLN--SNCCPTCRQDYIFSFVSFEILPLVQFYPEVDISDAEAERLL----LAPAKHAEDS-----------------------DPFN------EDVASALPLSLDRNGLRAIDPNHVLILKRRGKNVRNVYYRNILPDLQVTYCPQCLLLFYAEDFELQVLQKGHCPFCHTSS 1162          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Fly
Match: Wdr82 (gene:FBgn0032030 transcript:FBtr0079650)

HSP 1 Score: 55.0694 bits (131), Expect = 2.228e-7
Identity = 42/128 (32.81%), Postives = 65/128 (50.78%), Query Frame = 3
Query:   51 IVYDKERCEKCIWDAC-FSPDGKRIVIASDKFVI-IYHSSDGSRLKLLKG---NKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILN----DAVQCLSFNPVSTILASGACLEFGIWSP 407
            + +   + ++C W    FS DGK I+I+++  VI +  +  G+ L+   G   NK      +++ D +   SG+ DG V IWN++T  G    +LN      VQC+ FNP   +LAS AC     W P
Sbjct:  187 VTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADT--GNKVSVLNGDHPGPVQCVQFNPKYMMLAS-ACTNMAFWLP 311          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Fly
Match: CG3909 (gene:FBgn0027524 transcript:FBtr0082172)

HSP 1 Score: 52.7582 bits (125), Expect = 1.262e-6
Identity = 31/97 (31.96%), Postives = 56/97 (57.73%), Query Frame = 3
Query:   96 CFSPDGKRIVIASDK-FVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILN-DAVQCLSFNPVSTILASGA 380
            CFSP+ + ++ ASD   + +Y  +    +  L G+ S V CVA++ DGK FAS ++D +V IW++   + +  F  + D V  + ++P +  +AS +
Sbjct:  219 CFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSPGNDKVASAS 315          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 52.373 bits (124), Expect = 1.586e-6
Identity = 35/99 (35.35%), Postives = 52/99 (52.53%), Query Frame = 3
Query:   99 FSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFD---GKRFASGAADGTVIIWNSETLEGILRFI-LNDAVQCLSFNPVSTILASGA 380
            FSP+GK I+ A+ D  + ++  S G  LK   G+K+  YC+   F    GK   SG+ D  V IWN ++ E + +     D V C + +P   I+AS A
Sbjct:  249 FSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAA 347          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Zebrafish
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:NCBI gene;Acc:777721])

HSP 1 Score: 55.4546 bits (132), Expect = 3.694e-7
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  129 ASDKFVIIYHSSDGSRLKL--LKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSET--LEGILRFILNDAVQCLSFNPVSTILASGACL-EFGIWSPDDKGIKKIRVA--ARVTCCSWTPDGQYLALGMYNGIISIRNRN 530
            ++DK + +Y S D S L    L G+   V+C  ++  G+  AS + D T ++W+ +T  +E +L       V+  +F+P S+ L SG       +W    + +++  V     +  CS+TP GQ    G   G + + + N
Sbjct:   29 SADKSICVYSSRDFSELPFSPLSGHGYGVHCCCFSACGQYLASCSTDATTMVWSMDTGEIEAVLEHPGRSPVRVCAFSPDSSHLVSGGSDGSIALWDFTSRTLRRTGVVNDTSIVACSFTPCGQMFITGSTYGDLRLWDLN 169          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Zebrafish
Match: apaf1 (apoptotic peptidase activating factor 1 [Source:NCBI gene;Acc:58131])

HSP 1 Score: 53.5286 bits (127), Expect = 1.890e-6
Identity = 40/156 (25.64%), Postives = 74/156 (47.44%), Query Frame = 3
Query:   81 CIWDACFSPDGKRIV-IASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVST----ILASGACLEFG---IWSPDDKGIKKIRVA--ARVTCCSWTPDGQYLALGMYNGIISI 518
             ++ ACFS DG +I    + K + ++ S+ G +L  L+ ++  V C A++ D +  A+ A+D  V +WN E    I  F +    Q       +T    +LA+ +  +F    +W+P+ K  +         V  C ++P+  YLA    +G + +
Sbjct:  619 AVYYACFSKDGSKIASCGASKALRVFKSTSGEKLLELQAHEEDVLCCAFSPDDRHIATCASDKKVKLWNVERGVLIREFEVEHEEQINHCQFTNTGRRVLLATCSNDKFTNTKLWNPNKKTSQNTMFGHMEPVNHCCFSPNDLYLATSSSDGSLKL 774          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 52.7582 bits (125), Expect = 2.655e-6
Identity = 37/170 (21.76%), Postives = 81/170 (47.65%), Query Frame = 3
Query:  111 GKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVA-----ARVTCCSWTPDGQYLALGMYNGIISIR--NRNGEEKSKIERTGGALTPIWSLQWN 599
            G+ ++I + K  ++  S +G  + + +G+   ++ +       +F +   D  + +W+S++ + I    L D+ Q   F+P    +A G  ++ G W   D   K +         +++   ++PDG +LA+G ++  I I     NG++ S++ +  G  + I  L W+
Sbjct:  508 GETVLIGTTKNYVLQGSLNGEFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVG--MQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWS 675          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 52.7582 bits (125), Expect = 2.664e-6
Identity = 37/170 (21.76%), Postives = 81/170 (47.65%), Query Frame = 3
Query:  111 GKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVA-----ARVTCCSWTPDGQYLALGMYNGIISIR--NRNGEEKSKIERTGGALTPIWSLQWN 599
            G+ ++I + K  ++  S +G  + + +G+   ++ +       +F +   D  + +W+S++ + I    L D+ Q   F+P    +A G  ++ G W   D   K +         +++   ++PDG +LA+G ++  I I     NG++ S++ +  G  + I  L W+
Sbjct:  516 GETVLIGTTKNYVLQGSLNGEFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVG--MQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWS 683          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 52.7582 bits (125), Expect = 2.871e-6
Identity = 37/170 (21.76%), Postives = 81/170 (47.65%), Query Frame = 3
Query:  111 GKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVA-----ARVTCCSWTPDGQYLALGMYNGIISIR--NRNGEEKSKIERTGGALTPIWSLQWN 599
            G+ ++I + K  ++  S +G  + + +G+   ++ +       +F +   D  + +W+S++ + I    L D+ Q   F+P    +A G  ++ G W   D   K +         +++   ++PDG +LA+G ++  I I     NG++ S++ +  G  + I  L W+
Sbjct:  512 GETVLIGTTKNYVLQGSLNGEFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVG--MQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWS 679          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Xenopus
Match: ift122 (intraflagellar transport 122 [Source:NCBI gene;Acc:100127681])

HSP 1 Score: 1353.96 bits (3503), Expect = 0.000e+0
Identity = 626/1211 (51.69%), Postives = 885/1211 (73.08%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V+D+++ E+ I+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+ WN +K +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLI++ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   + + + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:    1 MRAVPTWVDKVHDRDKLEQSIYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSICWNPSKDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGLD-FETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIEIARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLEISKDKEEKQDAMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSGDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1181          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Xenopus
Match: ift122 (intraflagellar transport 122 [Source:NCBI gene;Acc:100127681])

HSP 1 Score: 1350.11 bits (3493), Expect = 0.000e+0
Identity = 623/1198 (52.00%), Postives = 879/1198 (73.37%), Query Frame = 3
Query:   63 KERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            +E+ + CI+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+ WN +K +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLI++ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   + + + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:   12 EEKAQMCIYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSICWNPSKDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGLD-FETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIEIARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLEISKDKEEKQDAMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSGDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1179          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Xenopus
Match: ift122 (intraflagellar transport 122 [Source:NCBI gene;Acc:100127681])

HSP 1 Score: 1327.77 bits (3435), Expect = 0.000e+0
Identity = 619/1191 (51.97%), Postives = 869/1191 (72.96%), Query Frame = 3
Query:   84 IWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            I+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+ WN +K +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  + +F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+        ML+ LARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   + + + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:   24 IYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSICWNPSKDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGL-DFETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIEL--------MLLTLARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLEISKDKEEKQDAMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSGDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1176          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Xenopus
Match: ift122 (intraflagellar transport 122 [Source:NCBI gene;Acc:100127681])

HSP 1 Score: 1304.27 bits (3374), Expect = 0.000e+0
Identity = 614/1213 (50.62%), Postives = 864/1213 (71.23%), Query Frame = 3
Query:  126 IASDKFVI-IYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSL----------------------QWN--------------QNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            + + KF + +Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+                       WN              + + +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLI++ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   ++ + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:   11 VVTSKFSLQVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSIFTIYWAGLWLFGLLCTSNVQVDLWNYHVKTHLFVYPTDKEREDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGLD-FETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIEIARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLEISKDKEEKQDAMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1193          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Xenopus
Match: ift122 (intraflagellar transport 122 [Source:NCBI gene;Acc:100127681])

HSP 1 Score: 1302.35 bits (3369), Expect = 0.000e+0
Identity = 617/1227 (50.29%), Postives = 870/1227 (70.90%), Query Frame = 3
Query:   84 IWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSL----------------------QWN--------------QNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            I+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+                       WN              + + +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  + +F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLI++ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQ  E  +D+      M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   + + + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:   24 IYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSIFTIYWAGLWLFGLLCTSNVQVDLWNYHVKTHLFVYPTDKEREDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGL-DFETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIEIARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQYKEEKQDA------MLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSGDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1214          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Mouse
Match: Ift122 (intraflagellar transport 122 [Source:MGI Symbol;Acc:MGI:1932386])

HSP 1 Score: 1294.64 bits (3349), Expect = 0.000e+0
Identity = 611/1209 (50.54%), Postives = 875/1209 (72.37%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E+CI+D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K + ++++TCCSWT DGQYLALGM NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E  DILAV DW QKL+FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C+ KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  S+D  DM YR  +KI K F+CNL+++  +H+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SR KL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  +  F  A+ AFTR++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  AL+MY+D+  F+ AK      DP ETK+++ KQADWA++  E K+AV MY+ AG++ KA+EI   + W DMLID+ARKLD  +++ +L CA Y  +L++  YA+E Y KIGD+ ++V+LYV+T+ W+EAF L +K+PEFK  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL++A+  P+ K  M++KF  FQ+ A++Y+ Y +IHRY EEPF   +PE  FN+S++LLH+      L GISKV  LFTLAKQ K LGA+K++R+AY+KL+ L++P R++K+ + G+L+IRSKPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S+E L LVEF +E+ I+DEEA+ LI  +  P++  +       + N Q+L L++ ++    DDPF+AKL   +    F PVV++R  L+++S  ++++ +WPPPL++QYF++++ D +IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:    1 MRAVLTW------RDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKSSSKITCCSWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREEHNDILAVADWGQKLSFYQLSGKQ----------------------IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEKIVKKFECNLLVVCADHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQSAPMYQYLDRKMFKEAYQIACLGVTDADWRELAMEALEGLE-FETARKAFTRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALDMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAKAIEISGSHGWVDMLIDIARKLDKAEREPLLMCACYFKKLDSPGYAAETYLKIGDLKSLVQLYVDTKRWDEAFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLDMAQADPAQKDAMLDKFHHFQHLAELYHGYQTIHRYTEEPFSFDLPETLFNISKFLLHSLTKATPL-GISKVNTLFTLAKQSKALGAYKLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYEVLHLVEFYLEEGITDEEAVALIDLEA-PRHKREGKWRETSSNNSQTLKLDETMDSIGEDDPFTAKLSFEQGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHACCPYCR 1175          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Mouse
Match: Ift122 (intraflagellar transport 122 [Source:MGI Symbol;Acc:MGI:1932386])

HSP 1 Score: 1292.72 bits (3344), Expect = 0.000e+0
Identity = 612/1209 (50.62%), Postives = 876/1209 (72.46%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E+CI+D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K + ++++TCCSWT DGQYLALGM NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E  DILAV DW QKL+FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C+ KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  S+D  DM YR  +KI K F+CNL+++  +H+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SR KL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  +  F  A+ AFTR++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  AL+MY+D+  F+ AK      DP ETK+++ KQADWA++  E K+AV MY+ AG++ KA+EI   + W DMLID+ARKLD  +++ +L CA Y  +L++  YA+E Y KIGD+ ++V+LYV+T+ W+EAF L +K+PEFK  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL++A+D P+ K  M++KF  FQ+ A++Y+ Y +IHRY EEPF   +PE  FN+S++LLH+      L GISKV  LFTLAKQ K LGA+K++R+AY+KL+ L++P R++K+ + G+L+IRSKPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S+E L LVEF +E+ I+DEEA+ LI  +  P++  +       + N Q+L L++ ++    DDPF+AKL   +    F PVV++R  L+++S  ++++ +WPPPL++QYF++++ D +IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:    1 MRAVLTW------RDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKSSSKITCCSWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREEHNDILAVADWGQKLSFYQLSGKQ----------------------IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEKIVKKFECNLLVVCADHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQSAPMYQYLDRKMFKEAYQIACLGVTDADWRELAMEALEGL-EFETARKAFTRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALDMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAKAIEISGSHGWVDMLIDIARKLDKAEREPLLMCACYFKKLDSPGYAAETYLKIGDLKSLVQLYVDTKRWDEAFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLDMAQD-PAQKDAMLDKFHHFQHLAELYHGYQTIHRYTEEPFSFDLPETLFNISKFLLHSLTKATPL-GISKVNTLFTLAKQSKALGAYKLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYEVLHLVEFYLEEGITDEEAVALIDLEA-PRHKREGKWRETSSNNSQTLKLDETMDSIGEDDPFTAKLSFEQGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHACCPYCR 1174          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Mouse
Match: Ift122 (intraflagellar transport 122 [Source:MGI Symbol;Acc:MGI:1932386])

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 611/1268 (48.19%), Postives = 873/1268 (68.85%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPI----------WSLQW-------------------------------------------------NQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E+CI+D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K + ++++TCCSWT DGQYLALGM NGIISIRN+NGEEK KIER GG+L+PI          W   W                                                 + N  E  DILAV DW QKL+FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C+ KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  S+D  DM YR  +KI K F+CNL+++  +H+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SR KL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  +  F  A+ AFTR++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  AL+MY+D+  F+ AK      DP ETK+++ KQADWA++  E K+AV MY+ AG++ KA+EI   + W DMLID+ARKLD  +++ +L CA Y  +L++  YA+E Y KIGD+ ++V+LYV+T+ W+EAF L +K+PEFK  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL++A+D P+ K  M++KF  FQ+ A++Y+ Y +IHRY EEPF   +PE  FN+S++LLH+      L GISKV  LFTLAKQ K LGA+K++R+AY+KL+ L++P R++K+ + G+L+IRSKPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S+E L LVEF +E+ I+DEEA+ LI  +  P++  +       + N Q+L L++ ++    DDPF+AKL   +    F PVV++R  L+++S  ++++ +WPPPL++QYF++++ D +IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:    1 MRAVLTW------RDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKSSSKITCCSWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSSRWETIWMSRENEDAEDVIVNKYVQEIPSILKSTVYNSQGSEAEEEEQEEEDDSPRDGNSEEHNDILAVADWGQKLSFYQLSGKQ----------------------IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEKIVKKFECNLLVVCADHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQSAPMYQYLDRKMFKEAYQIACLGVTDADWRELAMEALEGL-EFETARKAFTRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALDMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAKAIEISGSHGWVDMLIDIARKLDKAEREPLLMCACYFKKLDSPGYAAETYLKIGDLKSLVQLYVDTKRWDEAFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLDMAQD-PAQKDAMLDKFHHFQHLAELYHGYQTIHRYTEEPFSFDLPETLFNISKFLLHSLTKATPL-GISKVNTLFTLAKQSKALGAYKLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYEVLHLVEFYLEEGITDEEAVALIDLEA-PRHKREGKWRETSSNNSQTLKLDETMDSIGEDDPFTAKLSFEQGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHACCPYCR 1233          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Mouse
Match: Ift122 (intraflagellar transport 122 [Source:MGI Symbol;Acc:MGI:1932386])

HSP 1 Score: 143.665 bits (361), Expect = 2.153e-38
Identity = 69/145 (47.59%), Postives = 108/145 (74.48%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCC 458
            M+  L W      +++ E+CI+D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K + ++++TCC
Sbjct:    1 MRAVLTW------RDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKSSSKITCC 138          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 62.7734 bits (151), Expect = 1.301e-9
Identity = 40/124 (32.26%), Postives = 63/124 (50.81%), Query Frame = 3
Query:  159 SSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFI-LNDAVQCLSFNPVSTILASGACLE-FGIWSPDDKGIKKIRVA--ARVTCCSWTPDGQYLALGMYNGIISI 518
            S D S  +  KG++  V CV ++ + K  ASG+ D T++IW+ +      RF    DAV C++F+P   +LASG+  +   IW P+ KG   +  A  A V    +  DGQ L     +  + +
Sbjct:    5 SQDPSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKV 128          
BLAST of Intraflagellar transport protein 122 homolog vs. UniProt/SwissProt
Match: sp|A8WGF4|IF122_XENTR (Intraflagellar transport protein 122 homolog OS=Xenopus tropicalis OX=8364 GN=ift122 PE=2 SV=1)

HSP 1 Score: 1353.96 bits (3503), Expect = 0.000e+0
Identity = 626/1211 (51.69%), Postives = 885/1211 (73.08%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V+D+++ E+ I+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+ WN +K +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLI++ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   + + + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:    1 MRAVPTWVDKVHDRDKLEQSIYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSICWNPSKDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGLD-FETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIEIARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLEISKDKEEKQDAMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSGDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1181          
BLAST of Intraflagellar transport protein 122 homolog vs. UniProt/SwissProt
Match: sp|Q6NYH1|IF122_DANRE (Intraflagellar transport protein 122 homolog OS=Danio rerio OX=7955 GN=ift122 PE=2 SV=1)

HSP 1 Score: 1300.8 bits (3365), Expect = 0.000e+0
Identity = 590/1209 (48.80%), Postives = 866/1209 (71.63%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V+D+++ E+CI+D  F PDG ++++A+   V++Y ++DG+ ++ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM NG++SIRN+NGEEK KIER GG+ +P+WS+ WN +K E  DILAV DW QKL+FYQLSGK+                      +GK+  L FDPC +S+     Y+++CGSD++  LYT+DG++L  + E  +W+W C+ KP  D+ +V+ G QDGTI+F Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIY++RL IQ P+K+ IY+  SDD  DM YR  +KI + F+CNL+++ + H+ILC+++RL    ++ +++REW+M+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK   S++CLD+S +R +L V+DE N   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKA  +P H+    G VVG+NG++++ LH ++M   E+PQSA MY YL+R  +++AY IACLGVT +DW  L   AL  ++ F  AK AF RIRD  Y++LI+ IEE+   GE +  + + D++AYQ  F EAAK Y  +  + +AL MY+D++ FD AK      DP +TK+++ KQADWAK+++E ++A  MYL AG+++KA++I+ E+ W DMLID+ R+LD  ++  + +CA++L QL    YA+E Y K+GD+ A+++L+V   +W+EAF L++K+P+F+  +YVPY+QWLAE+D+FEEAQ AFHKAG Q EAV VLE LT NAV E R++DASYYYW LSMQCL+IAR+    KQEM+ KF  FQ+ A++Y+VYHS+HRYM EPF +++PE  FN+SR+L HN   +  + GISKV  L+ LAKQ K LGA+K+SR+A+EKLQSL++P R + + +  SL++RSKP+ DNED++ MCYRCST NPLLN+ GN C+NC++PF+ S  S+E LPLVEF +++ ISDEEA+ LI  + +P+         + +   Q L L D  +    D  F+AKL   +    F PV + R  L+++S  ++++ +WP PL +QY+++++ DV+IT C +CF++FH+EDYEL  LQ   CPFCR
Sbjct:    1 MRAVPTWIDKVHDRDKVEQCIYDLAFRPDGSQLIVAAGNRVLVYDTADGTLIQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVSKHKVSSKITCCGWTNDGQYLALGMMNGVVSIRNKNGEEKVKIERPGGSSSPVWSIAWNPSKDEHNDILAVADWGQKLSFYQLSGKQ----------------------IGKDRSLTFDPCCVSFFSKGEYMVLCGSDRQAALYTRDGVRLGSIAEQNAWVWTCRVKP--DSNYVVVGCQDGTIAFFQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYRSRLAIQLPEKILIYELLSDDSADMHYRVKEKICRRFECNLLVVCSQHIILCQEKRLQCLSFTALRQREWLMESLIRYIKVIGGPAGREGLLVGLKNGAILKIFVDNPFPITLLKQNTSVRCLDMSSNRSRLAVVDEHNTCLVYDIHTRELLFQEPNANSVAWNTQCEDMLCFSGGGFLNIKACSFPVHQQKLQGFVVGYNGSRIFCLHVYSMAAVEVPQSAPMYQYLERRMFQQAYNIACLGVTDSDWRDLATEALEGLD-FHTAKKAFIRIRDLRYLELISSIEERKKRGETDNQLFLADVFAYQGKFHEAAKLYRRSGQDGRALSMYTDLRMFDYAKDFLGSADPKDTKLLMKKQADWAKNSREPRAAAEMYLSAGEHLKAIQIIGEHGWVDMLIDVGRRLDKAERAALSRCAVFLQQLQQHGYAAELYSKMGDLRALLQLHVHATHWDEAFSLVEKHPQFRDDVYVPYAQWLAEHDRFEEAQRAFHKAGRQAEAVRVLEQLTHNAVVESRFSDASYYYWMLSMQCLDIAREDSEQKQEMLKKFHSFQHLAELYHVYHSVHRYMSEPFSSNMPEILFNISRFLFHNLSTHTPM-GISKVDTLYALAKQSKLLGAYKVSRHAFEKLQSLKIPARYQDSVELSSLTVRSKPYRDNEDLIPMCYRCSTNNPLLNNQGNSCINCRQPFIFSASSYEVLPLVEFYLDQGISDEEAVSLIDLE-VPRVEKNKSWQEMSSGESQCLKLEDGPDDPEDDP-FTAKLSFEQGGSVFVPVRVSRAVLRSMSRRDVLIKRWPAPLSWQYYRSLLPDVSITMCPSCFQMFHSEDYELLVLQHSCCPFCR 1180          
BLAST of Intraflagellar transport protein 122 homolog vs. UniProt/SwissProt
Match: sp|Q6NWV3|IF122_MOUSE (Intraflagellar transport protein 122 homolog OS=Mus musculus OX=10090 GN=Ift122 PE=1 SV=1)

HSP 1 Score: 1292.72 bits (3344), Expect = 0.000e+0
Identity = 612/1209 (50.62%), Postives = 876/1209 (72.46%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E+CI+D  F PDG ++++A+   +++Y +SDG+ L+ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K + ++++TCCSWT DGQYLALGM NGIISIRN+NGEEK KIER GG+L+PIWS+ WN ++ E  DILAV DW QKL+FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C+ KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  S+D  DM YR  +KI K F+CNL+++  +H+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SR KL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  +  F  A+ AFTR++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  AL+MY+D+  F+ AK      DP ETK+++ KQADWA++  E K+AV MY+ AG++ KA+EI   + W DMLID+ARKLD  +++ +L CA Y  +L++  YA+E Y KIGD+ ++V+LYV+T+ W+EAF L +K+PEFK  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL++A+D P+ K  M++KF  FQ+ A++Y+ Y +IHRY EEPF   +PE  FN+S++LLH+      L GISKV  LFTLAKQ K LGA+K++R+AY+KL+ L++P R++K+ + G+L+IRSKPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S+E L LVEF +E+ I+DEEA+ LI  +  P++  +       + N Q+L L++ ++    DDPF+AKL   +    F PVV++R  L+++S  ++++ +WPPPL++QYF++++ D +IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:    1 MRAVLTW------RDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKSSSKITCCSWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSREEHNDILAVADWGQKLSFYQLSGKQ----------------------IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEKIVKKFECNLLVVCADHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQSAPMYQYLDRKMFKEAYQIACLGVTDADWRELAMEALEGL-EFETARKAFTRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALDMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAKAIEISGSHGWVDMLIDIARKLDKAEREPLLMCACYFKKLDSPGYAAETYLKIGDLKSLVQLYVDTKRWDEAFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLDMAQD-PAQKDAMLDKFHHFQHLAELYHGYQTIHRYTEEPFSFDLPETLFNISKFLLHSLTKATPL-GISKVNTLFTLAKQSKALGAYKLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYEVLHLVEFYLEEGITDEEAVALIDLEA-PRHKREGKWRETSSNNSQTLKLDETMDSIGEDDPFTAKLSFEQGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHACCPYCR 1174          
BLAST of Intraflagellar transport protein 122 homolog vs. UniProt/SwissProt
Match: sp|Q9HBG6|IF122_HUMAN (Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 557/1273 (43.75%), Postives = 820/1273 (64.41%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSS----------------------DGSRLKLLKGNKSTVY------------------CVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDK-GIKKIRVA------ARVTCCSWTPDGQYLALGM----YNGIISIRNRNGEE-----KSKIERTGGALTPIWSLQW------NQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPI-PKNSFKNDAHMIVTQN-VQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+  L W      +++ E CI D  F PDG ++++A+   +++Y +S                      DG R      +KS +                   CV+Y     + AS  +     +W+ E          +  + C S+      LA G  +  GI S  +K G +K+++       + +    W P  ++ +  M     +    I NR  +E     KS +  + G+       +       + N  E+ DILAV DW QK++FYQLSGK+                      +GK+  L FDPC IS+     Y+L+ GSDK+V L+TKDG++L  V E  SW+W C++KP  D+ +V+ G QDGTISF+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKCK++VK+IAIY+NRL IQ P+K+ IY+  S+D +DM YR  +KI K F+CNL+++  NH+ILC+++RL    +SG+KEREW M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   +++CLD+S SRKKL V+DE++   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS +P H     G VVG+NG+K++ LH +++   E+PQSA MY YL R  +++AY+IACLGVT  DW  L   AL  + +F  AK AF R++D  Y++LI+ IEE+   GE N ++ + D+++YQ  F EAAK Y  +  E  ALEMY+D+  F+ AK      DP ETK+++ KQADWA++ KE K+AV MY+ AG+++KA+EI  ++ W DMLID+ARKLD  +++ +L CA YL +L++  YA+E Y K+GD+ ++V+L+VET+ W+EAF L +K+PEFK  IY+PY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IA+D P+ K  M+ KF  FQ  A++Y+ YH+IHR+ E+PF  H PE  FN+SR+LLH+ +  ++  GISKV ILFTLAKQ K LGA++++R+AY+KL+ L +P R +K+ + G+L+IR+KPFHD+E+++ +CYRCST NPLLN+ GN+C+NC++PF+ S  S++ L LVEF +E+ I+DEEA+ LI  + + PK   ++D  + +  N  Q L L +  +    +DPF+AKL   +    F PVV+ R  L+++S  ++++ +WPPPLR+QYF++++ D +IT C +CF++FH+EDYEL  LQ G CP+CR
Sbjct:    1 MRAVLTW------RDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSKLEGILKYTHNDAIQCVSYNPITHQLAS-CSSSDFGLWSPEQKSVSKHKSSSKII-CCSWTNDGQYLALG--MFNGIISIRNKNGEEKVKIERPGGSLSPIWSICWNPSSRWESFWMNRENEDAEDVIVNRYIQEIPSTLKSAVYSSQGSEAEEEEPEEEDDSPRDDNLEERNDILAVADWGQKVSFYQLSGKQ----------------------IGKDRALNFDPCCISYFTKGEYILLGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCQAKP--DSNYVVVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLSDMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLVYDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGSKIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGL-DFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQLHVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQLTNNAVAESRFNDAAYYYWMLSMQCLDIAQD-PAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNISRFLLHS-LPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYDKLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPK---RDDRQLEIANNSSQILRLVETKDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCR 1233          
BLAST of Intraflagellar transport protein 122 homolog vs. UniProt/SwissProt
Match: sp|G5EFW7|IF122_CAEEL (Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1)

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 416/1230 (33.82%), Postives = 687/1230 (55.85%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKE-RCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIR---NRNGEEKSKIERTGGALTPIWSLQWNQNKSEQT-----------DILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQ-----PQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLR-LPD-RLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+ +L+W   + D+      CI+D  F PDG  +++A+D  V ++  ++G +++ LKG+K  VY VA++ +G+ FASG AD  VI+WN E  EG LR+   D +QC+ FNP + IL + A  EFG+WS  DK + K R   R   C+W  DG   A+G  +G I++R   N   E    I+R      PIW + ++ N++  +           +I+AV DW++ L+FY L G            +   K             L F+P  IS+  N  YLLI GSDK + +YT+ G+ L  V +   W+W    +P S    + C  DGTI+ + + F  VH +   RYA R+ MTDV + +L     + I C D+VK++++Y  +L +Q  DK+ IY+      +++    ++Y   D I+K    +LM++T  HL++C D +L  Y + GIK+R W M S + Y + +GGP  +E +++G  +G + KV++DN +PI +     +IKC+DI+ +R  L  I+++ +    ++   E L QE G +S+ +NT N+++  +   + + ++    P H     G V+GF   + + L ++ +   E+P +  +Y Y++R ++++A +IACLGV  NDW YL   AL  +  F +A+ A+ R+RD   ++++ E+++  ++GE +  IL   I AY   F EAAK +     E +A+E+++D++ FD  + +         K+++ K+A WA+   + K A  M + +G   KA  ++ +N W ++ I+++ K+D +  + + K + Y  + +    AS  +  I D+ ++V ++V   +W +AF +  ++P++ + +Y+PY+++LAE D+FEEAQ AFH+AG + EA+ VLE LT+N+V E R+ DA +YYW LS Q L+  R        ++NK KE  + AD YY Y+ +  +  +PF     E   NM+RYL     F   +D ISKV + FT+AK    +GA+K +R A ++L +LR LP   L    +  +L+IR+KPF D E +  MCYRC   NPLL   G  C++C+ PF+ SF+SF+ LPL+EF+IE DIS +EA ELI  +P                              L+DD ++  L  ++  +    ++L+RE+L  +    +I+  +PPPL  ++  NVM  + I +C  C ++F  +D+E+  L+KGHCPFCR
Sbjct:    1 MRPNLLWVDKILDENNEAGVCIYDLAFKPDGSELLLAADNKVYLFDVNEGGQMQTLKGHKDLVYTVAWSHNGELFASGGADKLVILWN-EKHEGTLRYSHTDVIQCMMFNPCNQILLTCALNEFGLWSTADKNVIKQRSVVRCCSCAWNTDGTIFAIGHGDGTITLRKGTNATEEPSIIIQRDN---EPIWGIAFSSNRTFASRDSQGNPMGIDEIMAVIDWNKTLSFYSLDG-----------TFIESKN------------LEFEPHCISYCLNGEYLLIGGSDKILKIYTRKGVLLGTVAQMDHWIWSVTVRPNSQTVAMGC-VDGTIACYNLVFSTVHCVDHARYANRKSMTDVFVQNLEYRTSSNICCHDLVKKMSLYDTKLAVQLSDKIQIYKQTGGVSKNERRKQLKYTLQDTIRKDLSFSLMVVTHGHLVVCNDEKLECYDFKGIKKRSWNMKSIVRYLRVLGGPAHRETLVLGTTDGGVYKVFIDNDYPILLDSRKTAIKCIDINANRTVLASIEDTLVCKWSDIATGETLLQEPGCYSVVFNTVNENLFAFTTNNMLHVRTLAAPGHTTRGVGYVLGFVKNRTFCLVQYNLIPLEVPYTIHLYQYIERGDFKEALRIACLGVVKNDWKYLANKALDALE-FDVARKAYKRVRDRKMLRMVWELKKMKSNGEPDA-ILRATILAYTKKFREAAKIFKENGFENRAMELFTDMRMFDDVQEVMTTASGETKKMLMRKRASWARDANQPKIAAEMLISSGDLDKAALLIIDNDWLELAIEISHKIDRSDLETMKKLSAYFIRKHEFGLASRIFQSINDMKSIVDMHVNAGHWTDAFAIADRHPKYVEDVYLPYARFLAERDRFEEAQKAFHRAGKEQEAMHVLEQLTSNSVNENRFADAGFYYWLLSQQYLD--RSQTEENLTLLNKAKEAASLADAYYAYYPVFIFCSQPFSFERNENILNMARYL----TFTPYIDNISKVFVYFTIAKIANEMGAYKSARTALDQLTNLRVLPQFELDGQIEVMTLNIRAKPFTDVESMQPMCYRCGLNNPLL--GGMSCIHCETPFIISFVSFDILPLIEFKIENDISFDEAKELIESEP-----------------------------PLSDDDYNP-LRGLK--KGIKEIILNRESLSKLEQGHVIIQTFPPPLAPKFLFNVMPSITIAQCKGCNKVFDLDDFEMACLRKGHCPFCR 1160          
BLAST of Intraflagellar transport protein 122 homolog vs. TrEMBL
Match: R7V7Z8 (WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_164190 PE=4 SV=1)

HSP 1 Score: 1355.89 bits (3508), Expect = 0.000e+0
Identity = 620/1212 (51.16%), Postives = 878/1212 (72.44%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLT---DDPFSAKLLSME-NEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V+D+E+ E+CIWD CF PDG ++++A+   V++Y ++DG+ ++ LKG+K TV+CVAYA DGKRFASG+AD +VIIW S+ LEGIL++  NDA+QCL++NP +  L+S + L+FG+WSP+ K + K +V +R+T C+WT DGQYLALG++NG+ISIRN+ G+EK KIER G   +PIWSL W+ +K E  DILAV DW+Q+L+F+QLSGK+                      + K+ +LGFDPC++SW     Y++I GSDK   L+TK+G+KL  + + KSW+WC + KP S N   +  QDGTI+++Q+ F  VH +++DRYAFR+ MTD++I HL+T+QK RIKC+D+VK+IAIY++RL +Q PDK+ +Y+  SDD  DM YR  +KI K FDCNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K +GGP   EG+L+G KNGQI K+++DN FPI +LK   SI+CLD+S +R K+ V+DE N L VY++   E+LFQE   +S+AWNT  +DM+C++G   + IKAS++P H+    G VVGF G++++ LH + M + E+PQSA MY YL++  ++ AY++ACLGVT +DW  L   A+  ++ F  AK AF R RD  +++LI  IEE+   GE +  + +GD +AYQ  F EAAK Y  +  E +A+ MY+D++ FD AK      + G+ K+++ KQADWA++  E K+A  MY+ AG+Y+KA+EI+ ++ WA+M+ID+ RKLD   ++ + KCA YL +++   YASE Y K+GDI ++V L+VE R+WEEAF L +K+PEFK  ++VPY+Q+LAEND+FEEAQ AFHKAG+Q  AV VLE LT NAV E R+NDA YY+W LSMQCL+IA D P  +++M++KF +FQ KA++YYVYHSI RY +EPF +H+PEA FNMSRYLLH+   +  + G+SKVA L++LAKQ K LGA+K++RYA+EKLQSLR P R ++A   GS++IRSKPFHD ED+L MCYRCSTTNPLLN+ GN C+NC++PFVHSF+SFE LPLVEF +E+ I D+EAL L+  +P+      +      T   Q+L +ND+   +     DDPF+A+L+S E     F PV+ +R  LK++S  ++I+ KWP PL+ QY+K +M DV+ITKC +C +LFHT+DYEL  LQKG+CP+CR
Sbjct:    1 MRAVPTWVDKVHDREKVEQCIWDLCFRPDGSQLIVAAGHRVLVYDTNDGTLIQPLKGHKDTVFCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDAIQCLAYNPTTHQLSSCSVLDFGLWSPEQKNVSKHKVPSRITSCAWTNDGQYLALGLFNGLISIRNKTGDEKVKIERLG---SPIWSLAWSPSKDEAYDILAVADWNQRLSFFQLSGKQ----------------------INKDRVLGFDPCTVSWFSKGEYVIIGGSDKLCSLHTKEGVKLGVIGDQKSWVWCAQVKPDS-NYVAVGTQDGTIAYYQLIFSTVHGLYKDRYAFRDNMTDIIIQHLITEQKVRIKCRDLVKKIAIYRHRLAVQLPDKIVVYELYSDDNTDMHYRVKEKINKKFDCNLLVVCSHHIILCQEKRLQCLSFQGVKEREWLMESLIRYIKVVGGPPNCEGLLVGLKNGQIMKIFVDNPFPIPLLKQNTSIRCLDMSSTRSKIAVVDEHNTLLVYDVTSKELLFQEPNANSVAWNTNYEDMLCFSGGGLLNIKASNFPVHQQKLQGFVVGFTGSRIFCLHVYAMSSVEVPQSAPMYQYLEKKLFKDAYRVACLGVTDSDWEALAHQAMEGLD-FETAKKAFIRTRDLRFLELIASIEERQRRGENDLQVYLGDAFAYQSKFGEAAKLYKKSGNESRAMNMYTDLRMFDLAKEFVGSHEGGDKKMLMTKQADWARNINEPKAAAEMYITAGEYIKAIEIIGDHGWAEMMIDIGRKLDKADREALQKCAAYLKKMDQFAYASEIYLKLGDIKSLVALHVEARHWEEAFVLAEKHPEFKNDVHVPYAQYLAENDRFEEAQQAFHKAGLQEPAVRVLEQLTHNAVIENRFNDAGYYFWKLSMQCLDIASDEPEKEKQMLSKFHDFQRKAEMYYVYHSIQRYTDEPFTSHLPEALFNMSRYLLHSISGDIPM-GVSKVATLYSLAKQSKNLGAYKLARYAFEKLQSLRSPVRFQEAIDLGSITIRSKPFHDGEDMLPMCYRCSTTNPLLNNQGNFCINCRQPFVHSFVSFEVLPLVEFFLEEGIDDDEALFLLESEPVKSERDTSKWKEDNTDTAQTLRMNDDYGFNENTEEDDPFAARLMSFEQGGTEFQPVIANRAVLKSLSRPDVIICKWPKPLKSQYYKTLMPDVSITKCSSCNKLFHTDDYELLVLQKGYCPYCR 1183          
BLAST of Intraflagellar transport protein 122 homolog vs. TrEMBL
Match: A0A5G3KXU7 (Intraflagellar transport protein 122 homolog OS=Xenopus tropicalis OX=8364 GN=ift122 PE=4 SV=1)

HSP 1 Score: 1350.11 bits (3493), Expect = 0.000e+0
Identity = 623/1198 (52.00%), Postives = 879/1198 (73.37%), Query Frame = 3
Query:   63 KERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGD--LTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            +E+ + CI+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+ WN +K +  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D++AYQ  F EAAK Y  A  E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLI++ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ L+  +  P++S K D+   + + + Q+L L+D   GD  +T DPF+AKL   +    F PVV++R  L+ +S  ++++ +WP PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:   12 EEKAQMCIYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSICWNPSKDDHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGLD-FETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVFAYQGKFHEAAKLYKKAGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIEIARKLDKAEREPLLKCAYYFKKLQHHGYAAETYMKIGDLKALVRLYVETQRWEEAFALVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGRQDEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLEISKDKEEKQDAMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELIPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLVDLEA-PRSSSKADSWREMSSGDTQTLRLDD---GDDMMTYDPFTAKLSFEQGGSEFVPVVVNRAVLRTMSRRDVLIKRWPLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1179          
BLAST of Intraflagellar transport protein 122 homolog vs. TrEMBL
Match: A0A1L8GPM1 (WD_REPEATS_REGION domain-containing protein OS=Xenopus laevis OX=8355 GN=ift122 PE=1 SV=1)

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 622/1209 (51.45%), Postives = 880/1209 (72.79%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V+D+++ E+ I+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD +VIIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GGAL+PIWS+ WN +K E  DILAV DW QKL+FYQLSGK+                      VGK+ +LGFDPC +S+     Y+++ GSDK+V L+TKDG++L  + E  SW+W C+ KP S N  VI  QDGT++F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIYKNRL IQ P+K+ IY+  SDD NDM YR  +KI K F+CNL+++ ++H+ILC+++RL    + G+KEREW+M+S I Y K IGG   +EG+L+G KNGQI K+++DN F I +LK   S++CLD+S SR KL V+DE N   VY++   ++LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  + +AY+IACLGVT  DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   G+ N N+ + D+ AYQ  F +AAK Y     E +AL+MY+D++ F+ AK      DP +TK ++ KQADWA++ +E ++A  MYL AG+ MKA+E+  ++ W DMLID+ARKLD  +++ +LKCA Y  +L +  YA+E Y KIGD+ A+V+LYVET+ WEEAF L++K PE+K  +Y+PY+QWLAE+D+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCLEI++D    +  M+ KF  FQ+ A++Y+VYHSIHRY +EPF +H+PE  FN+SR+LLH+ +  ES  GISKV  LFTLAKQ K LGA+K++R  YE+LQ LR+P R  ++ + GS++IRSKPFHD+E+++ MCYRCST NP LN+ GN+C+NC++ FV S  S+E LPLVEF +E  ISDEEA+ LI  +  P++S K D    + + + Q+L ++DE +  +  DPF+AKL   +    F PVV++R  L+++S  ++++ +W  PL++QYF++++ DV+IT C +CF++FHTEDYEL  LQ   CP+CR
Sbjct:    1 MRAVPTWVDRVHDRDKLEQSIYDLAFKPDGTQLIVAAGNRVLVYDTSDGTMIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSSDFGLWSPEQKSVSKHKVSSKITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGGALSPIWSICWNPSKDEHNDILAVADWGQKLSFYQLSGKQ----------------------VGKDRVLGFDPCCVSYFSKGEYIIVSGSDKQVSLFTKDGVRLGPIGEQNSWVWTCRVKPDS-NYVVIGCQDGTLAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYKNRLAIQMPEKILIYELFSDDVNDMHYRVKEKIVKKFECNLLVVCSHHIILCQEKRLQCLSFKGVKEREWMMESLIRYIKVIGGSAGREGLLVGLKNGQILKIFVDNPFAITLLKQATSVRCLDMSASRNKLAVVDEHNTCLVYDITTKDLLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLERKMFREAYQIACLGVTDLDWKELAMEALEGLD-FETAKKAFIRVRDLRYLELINSIEERKKRGDANDNLFLADVCAYQGKFHDAAKLYKQVGQESRALDMYTDLRMFEFAKEFLGSGDPKDTKTLITKQADWARNIREPRTAAEMYLSAGENMKAIELSGDHGWVDMLIDIARKLDKAEREPLLKCAHYFKKLQHHGYAAETYMKIGDLKALVQLYVETQRWEEAFTLVEKNPEYKDEVYIPYAQWLAEHDRFEEAQKAFHKAGQQDEAVRVLEQLTHNAVVESRFNDATYYYWMLSMQCLEISKDKEEKRDVMLQKFYHFQHLAELYHVYHSIHRYTDEPFSSHLPETLFNISRFLLHS-LTKESPLGISKVNTLFTLAKQSKALGAYKLARQVYERLQGLRIPSRFLESIELGSITIRSKPFHDSEELVPMCYRCSTNNPFLNNLGNVCINCRQRFVFSASSYEVLPLVEFYLEDGISDEEAVSLIDLEA-PRSSSKTDNWREMSSGDTQTLRMDDE-DDMMNYDPFTAKLSFEQGGSEFVPVVVNRAVLRSMSRRDVLIKRWTLPLKWQYFRSLLPDVSITMCPSCFQMFHTEDYELLVLQHNCCPYCR 1181          
BLAST of Intraflagellar transport protein 122 homolog vs. TrEMBL
Match: A0A210R4J6 (Intraflagellar transport 122-like protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11655 PE=4 SV=1)

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 623/1214 (51.32%), Postives = 881/1214 (72.57%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIAR--DSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFD-PIPKNSFKN--DAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSME-NEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V D+++ E+CIWD CF PDG ++++A+   V++Y ++DG+ ++ LKG+K TVYCV YA DGKRFASG+AD +VIIW ++ LEGIL++  NDA+QCLS+NP++  LAS A  +FG+W+ + K + K +V +R+TCCSWT DGQYLALG+YNG++SIRN+ GEEK KIER   A +P+WSLQWN ++ E  D+LAV DW Q+L+FYQLSGK+                      +GK+  LG+DPC++SW     Y++I G++K+  L+TK+G+KL  + +  SW+W    KP S+   V C QDGTI ++Q+ F  VH +++DRYA+R+ MTDV+I HL+TDQK RIKC+D+VK+IAIY++RL +Q PDK+ IY+  SDD  DM Y+  +KI + FDCNL+++ + ++ILC+D+RL ++ + GIKE+EW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN FPI +LK   S++CLD+S SR KL V+DE +   VY++   E+LFQE   +S+AWNT  +DM+C++G   + IKAS++P H+    G VVGF+G+K++ LH ++M + ++PQSA+MY YL++  ++ AYK+ACLGVT  DW  L   AL  + +F  AK AF RIRD  Y++LI+ IEE+   GE++T + +GD+Y YQ  F E AK Y  +N E+KA+ MY+D++ FD AK      DP + K+++ KQADWAKS+ E K+A  MY+ AG++ KA++I+ ++ WADM+ID+ARKLD   ++ + + A +L ++    YA+E Y K+GDI +++ L+VE ++W++AF L++K+PE+K+ +YVPY+QWLAENDKFEEAQ AFHKAG+Q EAV VLE LT NAV E R+NDA YY+W LSMQCL+IA+  D P  K+EM+NKF ++Q KAD+YY YHSI RY +EPF +H+PEA FN+SRYLLH    N    GISKV  L+ LAKQ K LGA+K++RYAYEKLQSLR+P R  +    GS+ IRSKPFHD +D+L MCYRCSTTNPLLN++G+ C+NC++PF+HSF+SFE LPLVEF +E  I+DEEA+ ++    P  K   KN  ++ M      Q+L L D+   +  DDPFSAKL++ E    +F PVV+ +  L+++S +E+ +LKW  PLRYQ+F++++ DV IT+C  C +LFHT+D+ELQ LQKG CPFCR
Sbjct:    1 MRAVPTWVDKVQDRDKLEQCIWDLCFRPDGSQLIVAAGNRVLVYDTNDGTLIQPLKGHKDTVYCVTYARDGKRFASGSADKSVIIWTNK-LEGILKYTHNDAIQCLSYNPLTHQLASCAVSDFGLWTAEQKNVSKHKVNSRITCCSWTNDGQYLALGLYNGLVSIRNKGGEEKVKIERPNAATSPVWSLQWNPSRDETYDVLAVADWGQRLSFYQLSGKQ----------------------IGKDRNLGYDPCTVSWFSKGEYVVIGGANKQCTLHTKEGVKLGVIGDQASWVWGAAVKPDSNYVAVGC-QDGTIGYYQLIFSTVHGLYKDRYAYRDNMTDVIIQHLITDQKVRIKCRDLVKKIAIYRHRLAVQLPDKIVIYELYSDDAADMHYKVKEKINRKFDCNLLVVCSQNIILCQDKRLQSFSFQGIKEKEWVMESLIRYIKVIGGPPGREGLLVGLKNGQIMKIFVDNPFPIMLLKQATSVRCLDVSASRTKLAVVDEHSTCLVYDINTKELLFQEPNANSVAWNTHYEDMLCFSGNGLLNIKASNFPVHQQKLQGFVVGFSGSKIFCLHVYSMSSVDVPQSASMYQYLEKKFFKDAYKVACLGVTDGDWEVLAHEALEGL-DFDTAKKAFIRIRDLRYLELIHNIEERKKRGEQDTMVFLGDVYGYQGKFHEGAKLYKKSNHEHKAMNMYTDLRMFDYAKEYIGSGDPLDKKMLITKQADWAKSSNEPKAAAEMYISAGEFCKAIDIIGDHGWADMMIDVARKLDKADREALSRAAAHLAKMEQYPYAAEVYSKMGDIKSLINLHVEAKHWDDAFTLVEKHPEYKEEVYVPYAQWLAENDKFEEAQQAFHKAGLQTEAVKVLEQLTHNAVLESRFNDAGYYFWKLSMQCLDIAKVIDDPDKKEEMLNKFHDYQRKADMYYAYHSIQRYTDEPFTSHLPEALFNISRYLLHMMQANVP-HGISKVGTLYALAKQSKNLGAYKLARYAYEKLQSLRVPSRFLETVDLGSIMIRSKPFHDGDDLLPMCYRCSTTNPLLNNNGDCCINCRQPFIHSFVSFEVLPLVEFVLEDGITDEEAVLVLDLSIPKQKKEEKNWQESRM---GPAQTLRLGDDPPEEEDDDPFSAKLMTFEQGGTDFKPVVVTKSVLQSMSRSEVYILKWQKPLRYQFFRSLLPDVTITQCHTCQKLFHTDDFELQYLQKGSCPFCR 1185          
BLAST of Intraflagellar transport protein 122 homolog vs. TrEMBL
Match: A0A3B3SPH2 (Intraflagellar transport 122 OS=Paramormyrops kingsleyae OX=1676925 GN=IFT122 PE=4 SV=1)

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 615/1214 (50.66%), Postives = 885/1214 (72.90%), Query Frame = 3
Query:   15 KFKMKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHM--IVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            K  M+    W   V+D+++ E+CI+D  F PDG ++++A+   V++Y +SDG+ ++ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+++NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM NG++SIRN+NGEEK KIER GG+ +PIWS+ WN +K E  DILAV DW Q+L+FYQLSGK+                      +GK+ IL +DPC +S+     Y+++ GSDK+  LYTKDG++L  + E  SW+W C+ KP  D+ +V+ G QDGTI+F+Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIY+NRL IQ P+K+ IY+  SDD +DM YR  +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EW+M+S I Y K IGGP  +EG+L+G KNG I K+++DN F I +LK + S++CLD+S SR KL V+DE N   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG++G+K++ LH ++M   E+PQSA MY YL+R  Y++AY+IACLGVT +DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   GE N+ + + D+YAYQ  F EAAK Y     E +AL MY+D++ F+ AK      DP +T+++++KQADWA++  E ++A  MYL AG+++KAV+I+ E+ W DMLID ARKLD  +++ + KCA +  +L +  YA+E Y K+GD+ A+V L+VET +W+EAF L++K+P+FK  +YVPY+QWLAEND+FEEAQ AFHKAG Q+EAV VLE LT NAV E R+NDA+YYYW LSMQCL+IAR++ S K +M+ KF+ FQ+ A++Y+VYHSI RY +EPF +H+PE  FN+SR+LLHN      L GISKV  L+ LAKQ K LGAFK++R+AYEKLQ LR+P R +++ + GSL++RSKPFHDNED++ MCYRCST NPLLN  GN+C+NC++PF+ S  S+E LPLVEF +E+ ISDEEA+ LI  + +P+   ++ A    + +   QSL L+  ++ D  DDPF AKL   +    F PVV++R  L+++S  ++++ +WP PL +QY+++++ DV+IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:   19 KHIMRAVPTWIDKVHDRDKVEQCIYDLTFKPDGNQLIVAAGNRVLVYDTSDGTLIQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVAYNPVTHQLASCSSGDFGLWSPEQKSVSKHKVSSKITCCGWTNDGQYLALGMVNGVVSIRNKNGEEKVKIERPGGSSSPIWSITWNPSKDEHNDILAVADWGQRLSFYQLSGKQ----------------------IGKDRILNYDPCCVSYFSKGEYIVMGGSDKQASLYTKDGVRLGTIGEQNSWVWTCRVKP--DSNYVVLGCQDGTIAFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYRNRLAIQLPEKILIYELYSDDSSDMHYRVKEKINRRFECNLLVVCSQHIILCQEKRLQCLSFNSVKEKEWLMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFAITLLKQSTSVRCLDMSASRSKLAVVDEHNTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGSGHLNIKASNFPVHQQKLQGFVVGYSGSKIFCLHVYSMSAVEVPQSAPMYQYLERKLYKEAYQIACLGVTDSDWRDLATEALEGLD-FDTAKKAFIRVRDLRYLELINSIEERKKRGESNSELFLADVYAYQGKFHEAAKLYKKTGNEGRALSMYTDLRMFEYAKDFLGSADPKDTRMLISKQADWARNINEPRAAAEMYLSAGEHVKAVDIIGEHGWVDMLIDFARKLDKAEREPLAKCAGHFKRLKHHGYAAEVYSKMGDLRALVLLHVETCHWDEAFELVEKHPQFKNDVYVPYAQWLAENDRFEEAQKAFHKAGWQDEAVKVLEQLTHNAVVESRFNDAAYYYWMLSMQCLDIARETESKKDDMLKKFQRFQHLAELYHVYHSIQRYTDEPFSSHLPETLFNISRFLLHNLTKEVPL-GISKVNTLYALAKQSKALGAFKLARHAYEKLQGLRVPARFQESMELGSLTVRSKPFHDNEDLVPMCYRCSTNNPLLNIQGNVCINCRQPFIFSASSYEVLPLVEFYLEEGISDEEAVSLIDLE-VPRAEQRSPAQWQEMSSGESQSLKLDTGMD-DPEDDPFMAKLSFEQGGSEFVPVVVNRAVLRSMSRRDVLIKRWPRPLSWQYYRSLLPDVSITMCPSCFQMFHSEDYELLVLQHNCCPYCR 1203          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Cavefish
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 578/1131 (51.11%), Postives = 825/1131 (72.94%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGDLTDDPFSAKL 3410
            M+    W   V+D+++ E+CI+D  F PDG ++++A+   V++Y ++DG+ ++ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM +G++SIRN+NGEEK KIER GG+ +PIWS+ WN +K E  DILAV DW Q+L+FYQLSGK+                      +GK+  L FDPC +S+     Y++I GSDK+  LYTKDG++L  + E  SW+W C+ KP  D+ +V+ G QDGTI+F Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIY++RL IQ P+K+ IY+  SDD +DM YR  +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EWIM+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK   S++CLD+S SR KL V+DE N   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  +++AY+IACLGVT +DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   GE N+ + + D+YAYQ  F EAAK Y  +  + +AL MY+D++ F+ AK   A  DP +TK+++ KQADWAK++KE ++A  MYL AG+ MKA+EI+ E+ W DMLIDLARKLD  +++ + +CA +  +LN+  YA+E Y K+GD+ A+V+L+V+ R+W+EAF L++K+P++K  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDASYYYW LSMQCL+IARD+   K+EM+ KF  FQ+ A++Y+VYHSIHRYM EPF +++PE  FN+SR+L HN   +  L GISKV  L+ LAKQ K LGA+K++R+A+EKLQ L++P R +++ +   L++RSKP+HDNE+++ MCYRCST NPLLN+ GN CVNC++PF+ S  S+E LPLVEF +E+ I+DEEA+ LI  + +P+   K      + +   QSL L+++       DPF+AKL
Sbjct:    1 MRAVPTWIDKVHDRDKVEQCIYDLAFKPDGSQLIVAAGNRVLVYDTADGTLIQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVSKHKVSSKITCCGWTNDGQYLALGMMSGVVSIRNKNGEEKVKIERPGGSSSPIWSIAWNPSKDEHHDILAVADWGQRLSFYQLSGKQ----------------------IGKDRQLNFDPCCVSYFSKGEYIVIGGSDKQASLYTKDGVRLGTIGEQNSWVWTCRVKP--DSNYVVVGCQDGTIAFFQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYRSRLAIQLPEKILIYELYSDDSSDMHYRVKEKICRRFECNLLVVCSQHIILCQEKRLQCLSFTSVKEKEWIMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFPITLLKQNTSVRCLDMSTSRSKLAVVDEHNTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGSGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMAAVEVPQSAPMYQYLERRMFKEAYQIACLGVTDSDWRDLATEALEGLD-FDTAKKAFIRVRDLRYLELINSIEERKKRGENNSELFLADVYAYQGKFHEAAKLYKRSGYDNRALTMYTDLRMFEYAKDFLASADPKDTKLLMKKQADWAKNSKEPRAAADMYLTAGENMKAIEIIGEHGWVDMLIDLARKLDKAEREPLSRCAEFFQKLNHHGYAAETYSKMGDLKALVQLHVQARHWDEAFSLVEKHPQYKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQAEAVKVLEQLTHNAVVESRFNDASYYYWMLSMQCLDIARDNEEKKEEMLKKFHCFQHLAELYHVYHSIHRYMVEPFSSNMPETLFNLSRFLFHNLTKDIPL-GISKVYTLYALAKQSKALGAYKVARHAFEKLQGLKIPARFQESMELSCLTVRSKPYHDNEELIPMCYRCSTNNPLLNNQGNACVNCRQPFIFSASSYEVLPLVEFYLEEGITDEEAVSLIDLE-VPRVDRKTSRWQEMSSGESQSLKLDEDDVERPEMDPFTAKL 1103          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Cavefish
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1220.3 bits (3156), Expect = 0.000e+0
Identity = 578/1162 (49.74%), Postives = 825/1162 (71.00%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQN-------------------------------KSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDA-HMIVTQNVQSLALNDELNGDLTDDPFSAKL 3410
            M+    W   V+D+++ E+CI+D  F PDG ++++A+   V++Y ++DG+ ++ LKG+K TVYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM +G++SIRN+NGEEK KIER GG+ +PIWS+ WN +                               K E  DILAV DW Q+L+FYQLSGK+                      +GK+  L FDPC +S+     Y++I GSDK+  LYTKDG++L  + E  SW+W C+ KP  D+ +V+ G QDGTI+F Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIY++RL IQ P+K+ IY+  SDD +DM YR  +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EWIM+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK   S++CLD+S SR KL V+DE N   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  +++AY+IACLGVT +DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   GE N+ + + D+YAYQ  F EAAK Y  +  + +AL MY+D++ F+ AK   A  DP +TK+++ KQADWAK++KE ++A  MYL AG+ MKA+EI+ E+ W DMLIDLARKLD  +++ + +CA +  +LN+  YA+E Y K+GD+ A+V+L+V+ R+W+EAF L++K+P++K  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDASYYYW LSMQCL+IARD+   K+EM+ KF  FQ+ A++Y+VYHSIHRYM EPF +++PE  FN+SR+L HN   +  L GISKV  L+ LAKQ K LGA+K++R+A+EKLQ L++P R +++ +   L++RSKP+HDNE+++ MCYRCST NPLLN+ GN CVNC++PF+ S  S+E LPLVEF +E+ I+DEEA+ LI  + +P+   K      + +   QSL L+++       DPF+AKL
Sbjct:    1 MRAVPTWIDKVHDRDKVEQCIYDLAFKPDGSQLIVAAGNRVLVYDTADGTLIQPLKGHKDTVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVSKHKVSSKITCCGWTNDGQYLALGMMSGVVSIRNKNGEEKVKIERPGGSSSPIWSIAWNPSNAQVEPSGGVCGDGAEETLADHNVIIGSGTGKDEHHDILAVADWGQRLSFYQLSGKQ----------------------IGKDRQLNFDPCCVSYFSKGEYIVIGGSDKQASLYTKDGVRLGTIGEQNSWVWTCRVKP--DSNYVVVGCQDGTIAFFQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYRSRLAIQLPEKILIYELYSDDSSDMHYRVKEKICRRFECNLLVVCSQHIILCQEKRLQCLSFTSVKEKEWIMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFPITLLKQNTSVRCLDMSTSRSKLAVVDEHNTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGSGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMAAVEVPQSAPMYQYLERRMFKEAYQIACLGVTDSDWRDLATEALEGLD-FDTAKKAFIRVRDLRYLELINSIEERKKRGENNSELFLADVYAYQGKFHEAAKLYKRSGYDNRALTMYTDLRMFEYAKDFLASADPKDTKLLMKKQADWAKNSKEPRAAADMYLTAGENMKAIEIIGEHGWVDMLIDLARKLDKAEREPLSRCAEFFQKLNHHGYAAETYSKMGDLKALVQLHVQARHWDEAFSLVEKHPQYKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQAEAVKVLEQLTHNAVVESRFNDASYYYWMLSMQCLDIARDNEEKKEEMLKKFHCFQHLAELYHVYHSIHRYMVEPFSSNMPETLFNLSRFLFHNLTKDIPL-GISKVYTLYALAKQSKALGAYKVARHAFEKLQGLKIPARFQESMELSCLTVRSKPYHDNEELIPMCYRCSTNNPLLNNQGNACVNCRQPFIFSASSYEVLPLVEFYLEEGITDEEAVSLIDLE-VPRVDRKTSRWQEMSSGESQSLKLDEDDVERPEMDPFTAKL 1134          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Cavefish
Match: IFT122 (intraflagellar transport 122 [Source:HGNC Symbol;Acc:HGNC:13556])

HSP 1 Score: 1189.87 bits (3077), Expect = 0.000e+0
Identity = 566/1160 (48.79%), Postives = 815/1160 (70.26%), Query Frame = 3
Query:  171 SRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            S+L +  GN+  VY               ADGT+I    + L+G       D V C+++             + G+WSP+ K + K +V++++TCC WT DGQYLALGM +G++SIRN+NGEEK KIER GG+ +PIWS+ WN +K E  DILAV DW Q+L+FYQLSGK+                      +GK+  L FDPC +S+     Y++I GSDK+  LYTKDG++L  + E  SW+W C+ KP  D+ +V+ G QDGTI+F Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RIKC+++VK+IAIY++RL IQ P+K+ IY+  SDD +DM YR  +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EWIM+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK   S++CLD+S SR KL V+DE N   VY++   E+LFQE   +S+AWNT+ +DM+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  +++AY+IACLGVT +DW  L   AL  ++ F  AK AF R+RD  Y++LIN IEE+   GE N+ + + D+YAYQ  F EAAK Y  +  + +AL MY+D++ F+ AK   A  DP +TK+++ KQADWAK++KE ++A  MYL AG+ MKA+EI+ E+ W DMLIDLARKLD  +++ + +CA +  +LN+  YA+E Y K+GD+ A+V+L+V+ R+W+EAF L++K+P++K  +YVPY+QWLAEND+FEEAQ AFHKAG Q EAV VLE LT NAV E R+NDASYYYW LSMQCL+IARD+   K+EM+ KF  FQ+ A++Y+VYHSIHRYM EPF +++PE  FN+SR+L HN   +  L GISKV  L+ LAKQ K LGA+K++R+A+EKLQ L++P R +++ +   L++RSKP+HDNE+++ MCYRCST NPLLN+ GN CVNC++PF+ S  S+E LPLVEF +E+ I+DEEA+ LI  + +P+   K      ++++ QSL L+++       DPF+AKL   +    F PV++ R  L+++S  ++++ +WP PL +QY+++++ DV+IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:    1 SQLIVAAGNRVLVY-------------DTADGTLI----QPLKG-----HKDTVYCVAYA------------KDGLWSPEQKSVSKHKVSSKITCCGWTNDGQYLALGMMSGVVSIRNKNGEEKVKIERPGGSSSPIWSIAWNPSKDEHHDILAVADWGQRLSFYQLSGKQ----------------------IGKDRQLNFDPCCVSYFSKGEYIVIGGSDKQASLYTKDGVRLGTIGEQNSWVWTCRVKP--DSNYVVVGCQDGTIAFFQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCRELVKKIAIYRSRLAIQLPEKILIYELYSDDSSDMHYRVKEKICRRFECNLLVVCSQHIILCQEKRLQCLSFTSVKEKEWIMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFPITLLKQNTSVRCLDMSTSRSKLAVVDEHNTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGSGYLNIKASNFPVHQQKLQGFVVGYNGSKIFCLHVYSMAAVEVPQSAPMYQYLERRMFKEAYQIACLGVTDSDWRDLATEALEGLD-FDTAKKAFIRVRDLRYLELINSIEERKKRGENNSELFLADVYAYQGKFHEAAKLYKRSGYDNRALTMYTDLRMFEYAKDFLASADPKDTKLLMKKQADWAKNSKEPRAAADMYLTAGENMKAIEIIGEHGWVDMLIDLARKLDKAEREPLSRCAEFFQKLNHHGYAAETYSKMGDLKALVQLHVQARHWDEAFSLVEKHPQYKDDVYVPYAQWLAENDRFEEAQKAFHKAGRQAEAVKVLEQLTHNAVVESRFNDASYYYWMLSMQCLDIARDNEEKKEEMLKKFHCFQHLAELYHVYHSIHRYMVEPFSSNMPETLFNLSRFLFHNLTKDIPL-GISKVYTLYALAKQSKALGAYKVARHAFEKLQGLKIPARFQESMELSCLTVRSKPYHDNEELIPMCYRCSTNNPLLNNQGNACVNCRQPFIFSASSYEVLPLVEFYLEEGITDEEAVSLIDLE-VPRVDRKTSRWQEMSKS-QSLKLDEDDVERPEMDPFTAKLSFEQGGSEFVPVLVSRAVLRSMSRRDVLIKRWPKPLSWQYYRSLLPDVSITMCPSCFQMFHSEDYELLVLQHNCCPYCR 1098          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Cavefish
Match: apaf1 (apoptotic peptidase activating factor 1 [Source:NCBI gene;Acc:58131])

HSP 1 Score: 56.9954 bits (136), Expect = 1.351e-7
Identity = 78/395 (19.75%), Postives = 155/395 (39.24%), Query Frame = 3
Query:   75 EKCIWDACFSPDGKRIV-IASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQ-----CLSFNPVSTIL----ASGACLEFGIWSPDDKGIKKIRVA--ARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGS-----------------------------VGKEII-----LGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIA 1121
            +  ++ +CFS DG +I    + K + ++ S+ G +L+ +  +   V C A++ D +  A+ ++D  V +WN E  +G L  +L D  +     C   N    +L    ++   +   +W+ + +G +         V  C ++PD  Y+A    +G + +     E  S  E     ++ ++S   N +  +   I+    WS   +    + K  ++   ++     L+ R  R S                               K+I      L + PC + + PN S LL C  D+ + L+  +     +VH + +               V   +D  + F Q    +V +  ++R   R G+    +      QK+RI+C  I ++ +
Sbjct:  617 QNSLYYSCFSRDGSKIASCGASKTLRVFKSNSGEKLQEIPAHDDEVLCCAFSPDDRHIATCSSDRKVKVWNVE--KGTLLRVLEDEHEEQINHCQFTNTNRRVLLATCSNDTFMNAKLWNLNKRGSQNTMFGHLQPVNHCCFSPDDTYIATSSNDGSMKL----FEVLSANEYKSFDISSLFSENDNNDDGKTGVIVKCSTWSSDGSRIFCAAKNTVFMFNVASEDMLLEIRTSRMSTVQYCHACPNSQLIALALSHYTVELWDFEANKKIAECSGHLSWIPC-VQFSPNGSLLLSCSDDQTIRLWETE-----RVHTSSA---------------VALKRDFDVDFSQDGITVVAADSKNRLQVRSGLAGTPVFE-SEKQKSRIRCTCICRQAS 983          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Cavefish
Match: apaf1 (apoptotic peptidase activating factor 1 [Source:NCBI gene;Acc:58131])

HSP 1 Score: 56.6102 bits (135), Expect = 1.684e-7
Identity = 78/395 (19.75%), Postives = 155/395 (39.24%), Query Frame = 3
Query:   75 EKCIWDACFSPDGKRIV-IASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQ-----CLSFNPVSTIL----ASGACLEFGIWSPDDKGIKKIRVA--ARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGS-----------------------------VGKEII-----LGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIA 1121
            +  ++ +CFS DG +I    + K + ++ S+ G +L+ +  +   V C A++ D +  A+ ++D  V +WN E  +G L  +L D  +     C   N    +L    ++   +   +W+ + +G +         V  C ++PD  Y+A    +G + +     E  S  E     ++ ++S   N +  +   I+    WS   +    + K  ++   ++     L+ R  R S                               K+I      L + PC + + PN S LL C  D+ + L+  +     +VH + +               V   +D  + F Q    +V +  ++R   R G+    +      QK+RI+C  I ++ +
Sbjct:  617 QNSLYYSCFSRDGSKIASCGASKTLRVFKSNSGEKLQEIPAHDDEVLCCAFSPDDRHIATCSSDRKVKVWNVE--KGTLLRVLEDEHEEQINHCQFTNTNRRVLLATCSNDTFMNAKLWNLNKRGSQNTMFGHLQPVNHCCFSPDDTYIATSSNDGSMKL----FEVLSANEYKSFDISSLFSENDNNDDGKTGVIVKCSTWSSDGSRIFCAAKNTVFMFNVASEDMLLEIRTSRMSTVQYCHACPNSQLIALALSHYTVELWDFEANKKIAECSGHLSWIPC-VQFSPNGSLLLSCSDDQTIRLWETE-----RVHTSSA---------------VALKRDFDVDFSQDGITVVAADSKNRLQVRSGLAGTPVFE-SEKQKSRIRCTCICRQAS 983          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001650.1 (pep scaffold:Pmarinus_7.0:GL479694:6763:31385:-1 gene:ENSPMAG00000001469.1 transcript:ENSPMAT00000001650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 548/1128 (48.58%), Postives = 790/1128 (70.04%), Query Frame = 3
Query:  321 NDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINE----IEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQ---IAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIP-----------KNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            ND +Q +++NPVS  LAS +  +FG+WSP+ K ++K + ++R+TCCSWT DGQYLALGM+NG++SIRN+NGEEK KIER GG   P+WS+ W+ ++ +  D LA+ DW QKL+FYQLSGK+                      +GK+  LGFDPC +S+     Y+++CGS  +  LYT++G+ L  V E  +W+W C+ KP  D+++V  G QDGT+S+ Q+ F  VH +++DRYAFRE MTDV++ HL+T+QK RI+CK++VK+IAIY++RL IQ P+K+ IY+  SDD  DMQYR   KI + FDCNL+++ + H+ILC+++RL    + G+KEREW+M+S I Y K IGGP  +EG+L+G KNGQI K+++DN FPI +LK   S++CLD+S SR KL V+DE N+  VY+L+  E+LFQE   +S+AWNT+ +DM+C++G   + IKASD P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL+R  Y++AY+IACLGVT  DW  L   AL  + +F  AK AF R+RD  Y++LI       EE+   GE    + + D++A++  F +AAK Y  A  E +AL MYSD++ FD AK   A  DP +T++++ KQADWA++ K+ ++A  MYL AG+ +KA+EI+ +N W DML+++AR++D   ++ +  CA +L +L    YA+E Y K+GD  A+++L+VETR+W+EAF L +++PE +   +VPY++WLAEND+FEEAQ    AFHKAG + EAV VLETLT NAV E R NDA+YYYW LS QCL+IA    +  +EM+ KF++FQ+ A++YY YHSI RY +EPF +H+PE+ FN++R+LLH+ +  +S  GISKV  L+ LAKQ + LGA+K++R+ +E+L +LR+P RL++A   GS++IRSKPF D+E+++ MCYRCST NPLL   GN CVNC++PFV+SF SFE LPLV F +E  + DEEAL LI+ +  P           + S    A M+V +       N E  G+  +DPF+A+L   ++   F PVVL+R  L+++S  +++V +WP PLR+Q+++++M DV IT C +CF++FH+EDYEL  LQ   CP+CR
Sbjct:    2 NDVIQSVAYNPVSHQLASCSSSDFGLWSPEQKSVQKHKASSRITCCSWTNDGQYLALGMFNGVVSIRNKNGEEKVKIERPGG--HPVWSICWSPSREDHHDTLAISDWGQKLSFYQLSGKQ----------------------IGKDRTLGFDPCCVSYFSKGEYVVVCGSGGRAHLYTREGVPLGPVGEHPAWVWSCRVKP--DSEYVALGSQDGTVSYFQLVFSTVHGLYKDRYAFRENMTDVIVQHLITEQKVRIRCKELVKKIAIYQHRLAIQLPEKIVIYELVSDDTADMQYRVKQKIGRRFDCNLLVVCSKHIILCQEKRLQCLTFGGLKEREWVMESLIRYIKVIGGPAGREGLLVGLKNGQILKIFVDNLFPIVLLKQATSVRCLDMSTSRNKLAVVDEHNVCLVYDLRTRELLFQEPNANSVAWNTQCEDMLCFSGGGLLNIKASDLPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQSAPMYQYLERGLYQQAYQIACLGVTETDWRQLALEALEGL-DFDTAKKAFIRVRDLRYLELIYSSSTWPEERRRRGESAQELFLADVHAHRGRFHDAAKLYKRAGHESRALTMYSDLRMFDCAKEFVASGDPKDTRLLMRKQADWAQAVKDPRAAADMYLAAGENVKAIEIIGQNGWVDMLVEVARRMDKADRESLALCAQHLQRLGQHGYAAEAYGKMGDWAALLRLHVETRHWDEAFALAERHPELRDGTFVPYARWLAENDRFEEAQKGPTAFHKAGRRGEAVHVLETLTHNAVAESRSNDAAYYYWMLSTQCLDIAGSDTAQAEEMLKKFEQFQHLAELYYAYHSIQRYTDEPFTSHLPESIFNIARFLLHS-LGRDSPPGISKVNTLYALAKQSRALGAYKLARHCFERLLALRVPPRLQEAVMLGSITIRSKPFQDSEELIPMCYRCSTNNPLLGGRGNACVNCRQPFVYSFSSFEVLPLVGFSLEDGVGDEEALSLINLEGPPASAGQRGDTRWRESRAGKADMMVME-------NSEEAGEEANDPFAARLSFEQDGAEFVPVVLNRAALRSLSRRQVLVKRWPSPLRWQFYRSLMPDVPITVCSSCFQMFHSEDYELLVLQHNRCPYCR 1094          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005742.1 (pep scaffold:Pmarinus_7.0:GL478452:1315:31647:1 gene:ENSPMAG00000005164.1 transcript:ENSPMAT00000005742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.705e-7
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:   84 IWDACFSPDGKRIV-IASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSET--LEGILRFILNDAVQCL---SFN-PVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYL 485
            ++ A FS  G+ +   A D ++  ++S  G  L     +   V C A+A +G+  A+G+AD TV +WN+++  L G  R    +   C    +F+ P+    +  + ++   W    KG   +  +  V CC ++PD Q L
Sbjct:  124 VYHAAFSRSGEYVASCAGDGYLKKWNSRTGEELMATYAHDEPVLCCAFAPNGRVIATGSADHTVKLWNAQSGRLLGPHRAHDGEVQHCTFAHAFHKPLLATCSQDSSIKLWEWKEQGKGSALLGHSGPVRCCCFSPDDQRL 264          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 51.9878 bits (123), Expect = 8.744e-7
Identity = 32/97 (32.99%), Postives = 53/97 (54.64%), Query Frame = 3
Query:   99 FSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWN--SETLEGILRFILNDAVQCLSFNPVSTILASGA 380
            F P+G  +   S D+ V ++ +  GS  +L  G++  V  +A++  G+  ASG  D  V +W+  S  +   LR   +D + CLSF+P  + LASG+
Sbjct:  435 FHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSDD-ITCLSFSPDGSALASGS 530          

HSP 2 Score: 50.447 bits (119), Expect = 2.634e-6
Identity = 37/118 (31.36%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  177 LKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILN-DAVQCLSFNPVSTILASGACLE-FGIWSPDDKGI-KKIRVAAR-VTCCSWTPDGQYLALGMYNGIISI 518
            L++  G+ S V  V +  +G   A+G+AD TV +W+++       F  +  AV  L+F+P   +LASG   +   +W      I K++R  +  +TC S++PDG  LA G  +G + +
Sbjct:  420 LRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSDDITCLSFSPDGSALASGSSDGSVRV 537          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 48.9062 bits (115), Expect = 5.011e-6
Identity = 49/142 (34.51%), Postives = 68/142 (47.89%), Query Frame = 3
Query:   81 CIWDACFSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAA-DGTVIIWNSETLEGILRFILNDAVQCLS--FNPVS-TILASGACLEFGIWS-PDDKGIKKIRVAA-RVTCCSWTPDGQYL 485
             I D  +S DG  I  +S DK V ++ S  G R+K LKG+ S V     A  G +    A+ DGTV +W++     +  F   +  QCLS  FN  S  IL+ G      +W    +K I  ++     VT  S +PDG YL
Sbjct:  102 AILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSF--QNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYL 241          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Sea Lamprey
Match: wsb2 (WD repeat and SOCS box containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-26])

HSP 1 Score: 48.521 bits (114), Expect = 8.696e-6
Identity = 33/104 (31.73%), Postives = 56/104 (53.85%), Query Frame = 3
Query:   84 IWDACFSPDGKRIVIAS--DKFVIIYH-SSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSE--TLEGILRFILNDAVQCLSFNPVSTILASGA 380
            + D  F+PDG  +++++  DK + ++    DG+ +K+LKG+   V   A++ D     S  A  +V++W  E  TL   L   LND V C  F+P   +LA+ +
Sbjct:  182 VQDLTFAPDGSLMLVSASRDKTLRVWDLKDDGNMVKVLKGHHKWVNASAFSLDASMLCSVGAGKSVLLWEMEHFTLLRRLEGHLNDVVAC-EFSPDGALLATAS 284          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 51.9878 bits (123), Expect = 5.209e-7
Identity = 52/197 (26.40%), Postives = 97/197 (49.24%), Query Frame = 3
Query:   81 CIWDACFSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFI--LNDAVQCLSFNPVSTILASGA----CLEFGIWSPDDKGIKKIRV----AARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVG 638
             ++   FSPD K ++  S DK V ++     + L   KG+   V+ V+++  G  FA+ + D T  +W+ + +  +  F   LND V C+SF+P    + +G+    C  + + + D      +R+     A V   +  PDG++L+ G  +GII++ +    ++ K  R G     I+SL +    S++ ++L  G
Sbjct:  527 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD-----SVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMR-GHGKNAIYSLSY----SKEGNVLISG 712          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 51.6026 bits (122), Expect = 7.024e-7
Identity = 28/91 (30.77%), Postives = 48/91 (52.75%), Query Frame = 3
Query:   84 IWDACFSPDGKRIVI-ASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNP 353
            I   CFSPDGK +   A D+ + I+   +   + +L+G++  +Y + Y   G +  SG+ D TV IW+  T +  L   + D V  ++ +P
Sbjct:  446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSP 536          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Yeast
Match: HIR1 (Subunit of the HIR complex; HIR is a nucleosome assembly complex involved in regulation of histone gene transcription; contributes to nucleosome formation, heterochromatic gene silencing, and formation of functional kinetochores [Source:SGD;Acc:S000000104])

HSP 1 Score: 48.9062 bits (115), Expect = 4.657e-6
Identity = 33/120 (27.50%), Postives = 56/120 (46.67%), Query Frame = 3
Query:  189 KGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSK 548
            +  K  +Y V  + DGKR A+G  DG + IW   +++ ILR        C+    ++  +     L+  + S         R    +TC  ++PDG+YLA G  + I+ I   + E+ S+
Sbjct:   14 ESRKYEIYTVDVSHDGKRLATGGLDGKIRIW---SIDSILR--------CMELESLTPEIPLPQDLQMPLCS-------MSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQ 115          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 48.9062 bits (115), Expect = 5.027e-6
Identity = 53/192 (27.60%), Postives = 77/192 (40.10%), Query Frame = 3
Query:   96 CFSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIW------NSETLEGILRFILN--------------------------------DA-------VQCLSFNPVSTILASGA-CLEFGIWS--PDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRN 524
             +SPDG R+V AS D  + ++  + G  L   + + S+V  V +A  G+   S + DGTV  W      N  T  G  R   N                                DA       V CLSF+  +++LAS +      IWS     + ++ I V + V   S  PDG+ +A+    G ISI N
Sbjct:  352 AYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQISIFN 543          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Nematostella
Match: EDO39045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB90])

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 619/1218 (50.82%), Postives = 871/1218 (71.51%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICG-QDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQ-----EMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQ---NVQSLALNDELNGDLTDDPFSAKLLSME-NEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            M+    W   V+DK++ E+CI+D  F PDG ++++A+   V++Y ++DG+ +  LKG+K TV+CVAYA DGKRFASG AD +V+IW S+ LEGIL++  ND++QCL++NPV+  LAS    +FG+WSP+ K + K +V++RVTCCSWT DGQYLALG+++G +SIRN+ GEEK K+ER GG  +P+W++QWN +K E  DILA+GDW+Q+L+FYQLSGK+                      VGK+  LG+DPCS+ +     YL++ GSD++  L+TK+G+KL  + E +SW+WCCK +P  D  FV  G QDGTI+++Q+ F  VH +++DRYAFR+ MTDV+I HL T+QK RIKC+D+VK+IAIY++RL +Q PDKV IY+  +DD +DM YR  +KI K  +CNL+++ +NH+ILC+++RL    ++G KEREW+M+S I Y K IGGP  KEG+L+G KNGQI K++++N FP+ +LK   S++CLD+   R KL V+DE++   VY+L   E+LFQE   +S+AWNT N DM+C++G   + IKAS++P H+    G VVGF+G+K++ LH +TM   E+PQSA MY YL++  Y  AY +ACLGVT  DW  L   AL  + +F  AK AF R+RD  Y++LI+ IEE+   GE +    + D+YAYQ  F +AAK Y   + E KA+EM+SD++QF+ AK      DP   K ++ KQA W ++T + K+A  M+L AG+ MKA+EI+ EN W D L+D+ R L+    + I +CA +  QL+   YA+E Y K+GD  A+V+L+V+TR+W+EAF L++K+PEFK  +YVPY+ WLAEND+F+EAQ AFHKAG +++AV VLE L  NAV E R++DA YYYW LSMQCL++A+ SP          M+ KF E+Q KA++YY+YHS+HRY +EPF +H+PE  FN++RYLLH  +  ++  G+S+VA LF LAKQ K LGAFKM+R A++KLQ+L++P R ++A   GS++IRSKPFHDNE++L MCYRCSTTNPLLN+ GN C+NC++PFV+SF SFE LPLVEF +E DISDEEA++LI  +P   N  + D     T    NVQ+L+L+D    +  DDPF+AKL+S E     F PV + R TL +++  E+I+ +WP PL++QY++++M DV+IT CD+C R+FHT+DYEL  LQK  CPFCR
Sbjct:    1 MRAVPTWVDKVHDKDKVEQCIYDLAFRPDGSQLIVAAGNRVLVYDTNDGTLIDSLKGHKETVFCVAYARDGKRFASGGADKSVVIWTSK-LEGILKYTHNDSIQCLAYNPVTQQLASCTANDFGLWSPEQKSVSKHKVSSRVTCCSWTNDGQYLALGLFSGYVSIRNKAGEEKVKLERPGG--SPVWTIQWNPSKDEPYDILAIGDWNQRLSFYQLSGKQ----------------------VGKDRHLGYDPCSLGYFSKGEYLILGGSDRQCSLHTKEGVKLTTIGEQQSWVWCCKVRP--DANFVALGCQDGTIAYYQLIFSTVHGLYKDRYAFRDNMTDVIIQHLSTEQKVRIKCRDLVKKIAIYRHRLAVQLPDKVIIYELNTDDTSDMHYRVKEKIDKKLECNLLVVCSNHIILCQEKRLQCLSFAGNKEREWVMESVIRYIKVIGGPSGKEGLLVGLKNGQIMKIFVNNPFPVSLLKQETSVRCLDLCARRTKLAVVDENSTCLVYDLNTKELLFQEPNANSVAWNTHNADMLCFSGGGMLNIKASNFPVHQQKLQGFVVGFSGSKIFCLHVYTMSAVEVPQSAPMYQYLEKKMYRDAYNVACLGVTEGDWRALALDALEGL-DFETAKKAFIRVRDLRYLELIHNIEERKKRGETDDQAFLADVYAYQGKFHDAAKLYKKTSNEEKAMEMFSDLRQFEYAKEFLGASDPKNVKQLIKKQAQWCETTNDPKAAADMFLTAGENMKAIEIIGENGWIDKLLDVGRNLNKADTECIGRCAHFFKQLDQHAYAAEMYVKMGDTKALVQLHVDTRHWDEAFELVEKHPEFKDNVYVPYANWLAENDRFDEAQEAFHKAGRRDDAVHVLEVLCRNAVIEHRFHDAGYYYWKLSMQCLDLAKGSPETTNGEPDIGMLEKFHEYQEKAEIYYLYHSVHRYTDEPFTSHLPETLFNIARYLLH-MLIRDTPIGVSRVATLFALAKQSKNLGAFKMARTAFDKLQALKIPTRFQEAIDLGSVTIRSKPFHDNEELLPMCYRCSTTNPLLNNKGNQCINCRQPFVYSFSSFEVLPLVEFVLEDDISDEEAIKLIEAEPT--NQRRKDLSKWQTTDMGNVQTLSLSDPPPSNDDDDPFTAKLMSFEQGGSEFVPVRVGRATLHSMNRNEVIIKRWPVPLKHQYYRSLMPDVSITLCDSCNRVFHTDDYELMVLQKNSCPFCR 1187          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Nematostella
Match: EDO37328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG41])

HSP 1 Score: 56.6102 bits (135), Expect = 1.301e-8
Identity = 53/205 (25.85%), Postives = 91/205 (44.39%), Query Frame = 3
Query:   99 FSPDGKRIVIASDK-FVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFIL---NDAVQCLSFNPVSTILASGACLEFG-IWSPDDKGIKKIRVAAR--VTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIY 692
            FSPD  R+V   D   V I+ S  G  L  L+ +   + CV ++ DGK FAS A D  V++W + T  G   F L     +V+   F+P    L SG+      IWS  +     +    R  +  C+++ D + +A G ++  + + +   E    ++   G  + + SL + +N      +LA G W   +  +      +I+
Sbjct:    7 FSPDWTRVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVWEAAT--GKQVFCLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHRNVIQTCAFSHDSKTVATGSWDCTVRLWHLV-EGDMAVKCLDGHKSNVHSLAFAKNH-----MLASGSWDMTIRLWDSKTGELIH 203          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Nematostella
Match: EDO37614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFB4])

HSP 1 Score: 56.225 bits (134), Expect = 6.061e-8
Identity = 30/82 (36.59%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   39 IWSGIVYDKERCEKCIWDACFSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIW 281
            I S  V D+ + +  +WD CFSP+GK +  AS DK VI+++  +G  L  + G+   V C +++ DGK  A+ + D T+ +W
Sbjct:  239 IASRCVLDQHQSQ--VWDCCFSPNGKILASASGDKTVILWNPLNGVALHTITGHSRYVTCCSFSPDGKWLATASGDRTLRLW 318          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 55.0694 bits (131), Expect = 1.094e-7
Identity = 37/99 (37.37%), Postives = 54/99 (54.55%), Query Frame = 3
Query:   99 FSPDGKRIVIAS-DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFD---GKRFASGAADGTVIIWNSETLEGILRFI-LNDAVQCLSFNPVSTILASGA 380
            FSP+GK I+ A+ D  + ++  S G  LK   G+K+  YCV   F    GK   SG+ D  V IWN ++ E + +    +D V C + +P   I+ASGA
Sbjct:  242 FSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVVLCCACHPTENIIASGA 340          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Nematostella
Match: EDO47633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM8])

HSP 1 Score: 52.7582 bits (125), Expect = 1.171e-6
Identity = 40/136 (29.41%), Postives = 66/136 (48.53%), Query Frame = 3
Query:   99 FSPDGKRIV-IASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFI--LNDAVQCLSFNPVST-ILASGACLEFGIWSPDDKGIKKIRVAAR--VTCCSWTPDGQYLA 488
            FS D  ++V   +D  V ++ S  G +L  + G+   V C A++ D  R  S +AD TV IW++ + EG+L F+    +   C SF+P  T  ++  A     +W         + +A    V  C ++PDG  +A
Sbjct:  615 FSSDSSKVVSCGTDNHVKVWDSQSGRQLLSISGHGDVVNCCAFSHDDSRIISCSADQTVKIWDASSGEGVLCFVGHTQEVFSC-SFSPDDTKAVSCSADRTVKVWDSKTGVCYHVYMAHTDIVRWCCFSPDGGKVA 749          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Medaka
Match: IFT122 (intraflagellar transport 122 [Source:NCBI gene;Acc:101171743])

HSP 1 Score: 1286.55 bits (3328), Expect = 0.000e+0
Identity = 589/1200 (49.08%), Postives = 864/1200 (72.00%), Query Frame = 3
Query:   54 VYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDIL--LMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCR 3647
            V+  + CE+ ++D  F PDG ++++A+   V++Y ++DG+ ++ LKG+K  VYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM NG++SIRN+NGEEK KIER GG+ +PIWS+ WN +K E  DILAV DW QKL+FYQLSGK+                      +G +  L +DPC +S+     Y+++ GSDK+V LYTKDG++L  + E  SW+W C+ KP S N  V+  QDGTI+ +Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RI+C+++VK+IAIY++RL IQ P+++ IY+ +SDD +DM Y S +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EW+M+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK + S++CLD+S  RKKL V+DE N L VY++   E+LFQE   +S+AWNT+ ++M+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL++  Y++AY+IACLGVT +DW  L   AL  ++ F  AK AF RIRD  Y+ LI+ IEE+   GE +  + + D+YA+Q  F EAAK Y     E +AL MY+D++ F+ AK      D   +++++AKQADWAKS+ E ++A  MYL AG++MKA++I+ E+ W DMLID+ARKLD  +++ + KCA++L +L +  YASE Y K+GD+ A+++L+V+++NWEEA  L++K+P+FK  ++VPY+QWLAEND+FEEAQ AFHKAG Q+ AV VLE LT NAV E R++DA YYYW LSMQCL+IARD    + EM+ KFK FQ+ A++Y+VYHSI RY +EPF + IPE  FN+ R+LL+N +  E L GISKV IL+TLA+Q + LGA++++R  YEKL  L +P R + A + GS+ IR+KP HD+ED+   +MCYRCS  NPLL++ G++C+NCK+PF++S  S+E LPLV+F +E+ ISD+EAL LI  +    +  K     +    +Q+L +ND+L+ D  D PF+AK+   +    F PV + R  L+++S  ++++ +WP PLR++YF++++ DV+IT C  CF++F +EDYEL  LQ   CP+CR
Sbjct:    6 VWQDKICER-VYDVAFKPDGSQLIVAAGLRVLVYDAADGANIQPLKGHKDIVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVNKHKVSSKITCCGWTNDGQYLALGMMNGVVSIRNKNGEEKVKIERPGGSSSPIWSIAWNPSKDEHNDILAVADWGQKLSFYQLSGKQ----------------------IGADRTLNYDPCCVSYFSKGEYIVMGGSDKQVSLYTKDGMRLGTIGEQNSWVWTCRVKPES-NCVVLGCQDGTIACYQLTFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIRCRELVKKIAIYRSRLAIQLPERILIYELRSDDSSDMHYHSKEKICQKFECNLLVVCSQHIILCQEKRLQCLSFTSVKEKEWVMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFPITLLKLSTSVRCLDMSAYRKKLAVVDEHNTLLVYDINSKELLFQEPNANSVAWNTQCENMLCFSGNGYLNIKASNFPVHQQKMQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLEKKHYKEAYQIACLGVTDSDWRDLATEALEGLD-FETAKKAFIRIRDLRYLDLISSIEERKKRGENDNELFLADVYAFQGKFHEAAKLYKRTGHESRALSMYTDLRMFEYAKEFVGTTDVKSSRMLMAKQADWAKSSNEPRAAAEMYLSAGEHMKAIDIIGEHGWVDMLIDIARKLDKAEREPLTKCALHLKRLKHHGYASEIYSKMGDLKALLQLHVDSKNWEEALSLVEKHPQFKCDVFVPYAQWLAENDRFEEAQKAFHKAGRQDSAVKVLEQLTHNAVVENRFSDAGYYYWMLSMQCLDIARDYEEQRDEMLTKFKRFQHLAELYHVYHSIQRYTDEPFISDIPETLFNICRFLLNN-LTKEILQGISKVKILYTLAQQSQKLGAYRLARSCYEKLLELHIPSRFQAAIERGSMVIRAKPCHDSEDLTEAMMCYRCSNNNPLLSNQGSMCINCKQPFIYSASSYEVLPLVQFYLEEGISDDEALSLIDLEVPHTDQGKAQEQDMNNSELQTLKINDDLD-DEGDHPFTAKISFEQGGSTFVPVKVSRSVLRSMSRRDVLIKRWPAPLRWEYFRSLLPDVSITMCPTCFKMFQSEDYELLVLQHNCCPYCR 1177          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Medaka
Match: IFT122 (intraflagellar transport 122 [Source:NCBI gene;Acc:101171743])

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 561/1136 (49.38%), Postives = 818/1136 (72.01%), Query Frame = 3
Query:   54 VYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDIL--LMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKL-LSMENEENFNPVVL 3452
            V+  + CE+ ++D  F PDG ++++A+   V++Y ++DG+ ++ LKG+K  VYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM NG++SIRN+NGEEK KIER GG+ +PIWS+ WN +K E  DILAV DW QKL+FYQLSGK+                      +G +  L +DPC +S+     Y+++ GSDK+V LYTKDG++L  + E  SW+W C+ KP S N  V+  QDGTI+ +Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RI+C+++VK+IAIY++RL IQ P+++ IY+ +SDD +DM Y S +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EW+M+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK + S++CLD+S  RKKL V+DE N L VY++   E+LFQE   +S+AWNT+ ++M+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL++  Y++AY+IACLGVT +DW  L   AL  ++ F  AK AF RIRD  Y+ LI+ IEE+   GE +  + + D+YA+Q  F EAAK Y     E +AL MY+D++ F+ AK      D   +++++AKQADWAKS+ E ++A  MYL AG++MKA++I+ E+ W DMLID+ARKLD  +++ + KCA++L +L +  YASE Y K+GD+ A+++L+V+++NWEEA  L++K+P+FK  ++VPY+QWLAEND+FEEAQ AFHKAG Q+ AV VLE LT NAV E R++DA YYYW LSMQCL+IARD    + EM+ KFK FQ+ A++Y+VYHSI RY +EPF + IPE  FN+ R+LL+N +  E L GISKV IL+TLA+Q + LGA++++R  YEKL  L +P R + A + GS+ IR+KP HD+ED+   +MCYRCS  NPLL++ G++C+NCK+PF++S  S+E LPLV+F +E+ ISD+EAL LI  +    +  K     +    +Q+L +ND+L+ D  D PF+AK+   M   E++  +VL
Sbjct:    6 VWQDKICER-VYDVAFKPDGSQLIVAAGLRVLVYDAADGANIQPLKGHKDIVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVNKHKVSSKITCCGWTNDGQYLALGMMNGVVSIRNKNGEEKVKIERPGGSSSPIWSIAWNPSKDEHNDILAVADWGQKLSFYQLSGKQ----------------------IGADRTLNYDPCCVSYFSKGEYIVMGGSDKQVSLYTKDGMRLGTIGEQNSWVWTCRVKPES-NCVVLGCQDGTIACYQLTFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIRCRELVKKIAIYRSRLAIQLPERILIYELRSDDSSDMHYHSKEKICQKFECNLLVVCSQHIILCQEKRLQCLSFTSVKEKEWVMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFPITLLKLSTSVRCLDMSAYRKKLAVVDEHNTLLVYDINSKELLFQEPNANSVAWNTQCENMLCFSGNGYLNIKASNFPVHQQKMQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLEKKHYKEAYQIACLGVTDSDWRDLATEALEGLD-FETAKKAFIRIRDLRYLDLISSIEERKKRGENDNELFLADVYAFQGKFHEAAKLYKRTGHESRALSMYTDLRMFEYAKEFVGTTDVKSSRMLMAKQADWAKSSNEPRAAAEMYLSAGEHMKAIDIIGEHGWVDMLIDIARKLDKAEREPLTKCALHLKRLKHHGYASEIYSKMGDLKALLQLHVDSKNWEEALSLVEKHPQFKCDVFVPYAQWLAENDRFEEAQKAFHKAGRQDSAVKVLEQLTHNAVVENRFSDAGYYYWMLSMQCLDIARDYEEQRDEMLTKFKRFQHLAELYHVYHSIQRYTDEPFISDIPETLFNICRFLLNN-LTKEILQGISKVKILYTLAQQSQKLGAYRLARSCYEKLLELHIPSRFQAAIERGSMVIRAKPCHDSEDLTEAMMCYRCSNNNPLLSNQGSMCINCKQPFIYSASSYEVLPLVQFYLEEGISDDEALSLIDLEVPHTDQGKAQEQDMNNSELQTLKINDDLD-DEGDHPFTAKISFEMFQSEDYELLVL 1113          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Medaka
Match: IFT122 (intraflagellar transport 122 [Source:NCBI gene;Acc:101171743])

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 545/1080 (50.46%), Postives = 790/1080 (73.15%), Query Frame = 3
Query:   54 VYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDIL--LMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFD 3287
            V+  + CE+ ++D  F PDG ++++A+   V++Y ++DG+ ++ LKG+K  VYCVAYA DGKRFASG+AD ++IIW S+ LEGIL++  ND++QC+S+NPV+  LAS +  +FG+WSP+ K + K +V++++TCC WT DGQYLALGM NG++SIRN+NGEEK KIER GG+ +PIWS+ WN +K E  DILAV DW QKL+FYQLSGK+                      +G +  L +DPC +S+     Y+++ GSDK+V LYTKDG++L  + E  SW+W C+ KP S N  V+  QDGTI+ +Q+ F  VH +++DRYA+R+ MTDV++ HL+T+QK RI+C+++VK+IAIY++RL IQ P+++ IY+ +SDD +DM Y S +KI + F+CNL+++ + H+ILC+++RL    ++ +KE+EW+M+S I Y K IGGP  +EG+L+G KNG I K+++DN FPI +LK + S++CLD+S  RKKL V+DE N L VY++   E+LFQE   +S+AWNT+ ++M+C++G   + IKAS++P H+    G VVG+NG+K++ LH ++M   E+PQSA MY YL++  Y++AY+IACLGVT +DW  L   AL  ++ F  AK AF RIRD  Y+ LI+ IEE+   GE +  + + D+YA+Q  F EAAK Y     E +AL MY+D++ F+ AK      D   +++++AKQADWAKS+ E ++A  MYL AG++MKA++I+ E+ W DMLID+ARKLD  +++ + KCA++L +L +  YASE Y K+GD+ A+++L+V+++NWEEA  L++K+P+FK  ++VPY+QWLAEND+FEEAQ AFHKAG Q+ AV VLE LT NAV E R++DA YYYW LSMQCL+IARD    + EM+ KFK FQ+ A++Y+VYHSI RY +EPF + IPE  FN+ R+LL+N +  E L GISKV IL+TLA+Q + LGA++++R  YEKL  L +P R + A + GS+ IR+KP HD+ED+   +MCYRCS  NPLL++ G++C+NCK+PF++S  S+E LPLV+F +E+ ISD+EAL LI  +
Sbjct:    6 VWQDKICER-VYDVAFKPDGSQLIVAAGLRVLVYDAADGANIQPLKGHKDIVYCVAYAKDGKRFASGSADKSIIIWTSK-LEGILKYTHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVNKHKVSSKITCCGWTNDGQYLALGMMNGVVSIRNKNGEEKVKIERPGGSSSPIWSIAWNPSKDEHNDILAVADWGQKLSFYQLSGKQ----------------------IGADRTLNYDPCCVSYFSKGEYIVMGGSDKQVSLYTKDGMRLGTIGEQNSWVWTCRVKPES-NCVVLGCQDGTIACYQLTFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIRCRELVKKIAIYRSRLAIQLPERILIYELRSDDSSDMHYHSKEKICQKFECNLLVVCSQHIILCQEKRLQCLSFTSVKEKEWVMESLIRYIKVIGGPPGREGLLVGLKNGAILKIFVDNPFPITLLKLSTSVRCLDMSAYRKKLAVVDEHNTLLVYDINSKELLFQEPNANSVAWNTQCENMLCFSGNGYLNIKASNFPVHQQKMQGFVVGYNGSKIFCLHVYSMSAVEVPQSAPMYQYLEKKHYKEAYQIACLGVTDSDWRDLATEALEGLD-FETAKKAFIRIRDLRYLDLISSIEERKKRGENDNELFLADVYAFQGKFHEAAKLYKRTGHESRALSMYTDLRMFEYAKEFVGTTDVKSSRMLMAKQADWAKSSNEPRAAAEMYLSAGEHMKAIDIIGEHGWVDMLIDIARKLDKAEREPLTKCALHLKRLKHHGYASEIYSKMGDLKALLQLHVDSKNWEEALSLVEKHPQFKCDVFVPYAQWLAENDRFEEAQKAFHKAGRQDSAVKVLEQLTHNAVVENRFSDAGYYYWMLSMQCLDIARDYEEQRDEMLTKFKRFQHLAELYHVYHSIQRYTDEPFISDIPETLFNICRFLLNN-LTKEILQGISKVKILYTLAQQSQKLGAYRLARSCYEKLLELHIPSRFQAAIERGSMVIRAKPCHDSEDLTEAMMCYRCSNNNPLLSNQGSMCINCKQPFIYSASSYEVLPLVQFYLEEGISDDEALSLIDLE 1058          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Medaka
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:101164214])

HSP 1 Score: 53.1434 bits (126), Expect = 1.745e-6
Identity = 38/112 (33.93%), Postives = 58/112 (51.79%), Query Frame = 3
Query:  165 DGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFI-LNDAVQCLSFNPVSTILASGAC-LEFGIWSPDDKG---IKKIRVAARVTCCSWTPDGQYL 485
            D +  +  KG+K+ V CV +  + K+ ASG+AD TV+IWN       LRF    DAV  + F+P    +AS +      +W+P  KG   + +   AA V   +++ DG  L
Sbjct:    7 DPALERHFKGHKNAVTCVHFNPNNKQLASGSADKTVMIWNLAPKGRALRFFGHQDAVTGVQFSPSGKRVASSSKDRTVRLWTPSMKGECAVFRAHTAA-VRSVAFSADGLRL 117          
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Medaka
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:101161074])

HSP 1 Score: 51.9878 bits (123), Expect = 2.874e-6
Identity = 49/184 (26.63%), Postives = 88/184 (47.83%), Query Frame = 3
Query:    3 TILNKFKMKVDLIWSG-IVYDKERCEKCIWDACFSPDGKRIVIAS--DKFVIIYH-SSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSE--TLEGILRFILNDAVQCLSFNPVSTILASGA---------------CLEFGIWSPDDKGIKKIRVAAR-VTCCSWTPDGQYLA 488
            T LN  ++K+  +++G ++ +       + D  F+PDG  +++++  DK + ++    DG+ +K+L+G+++ VY  A++ D     S  A   V +WN +  TL   L    ND V C  F+P   +LA+ +                LE G   P    I       R V   S++PDG+++A
Sbjct:  150 TGLNNGRIKIWDVYTGKLLLNLMDHTDVVRDLTFAPDGSLMLVSASRDKSLRVWDLKDDGNMVKVLRGHQNWVYSSAFSPDSSILCSVGAGKAVFLWNMDKYTLIQKLEGHHNDVVSC-EFSPDGALLATASYDTRVIVWDHHNATILLELGHLFPPPSPIFAGGANDRWVRSVSFSPDGRHIA 332          
BLAST of Intraflagellar transport protein 122 homolog vs. Planmine SMEST
Match: SMESG000039304.1 (SMESG000039304.1)

HSP 1 Score: 2287.69 bits (5927), Expect = 0.000e+0
Identity = 1096/1096 (100.00%), Postives = 1096/1096 (100.00%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK 3311
            MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK
Sbjct:    1 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK 1096          
BLAST of Intraflagellar transport protein 122 homolog vs. Planmine SMEST
Match: SMESG000039304.1 (SMESG000039304.1)

HSP 1 Score: 2283.83 bits (5917), Expect = 0.000e+0
Identity = 1096/1097 (99.91%), Postives = 1096/1097 (99.91%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKR-MIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK 3311
            MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKR MIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK
Sbjct:    1 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRQMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK 1097          
BLAST of Intraflagellar transport protein 122 homolog vs. Planmine SMEST
Match: SMESG000039304.1 (SMESG000039304.1)

HSP 1 Score: 2228.37 bits (5773), Expect = 0.000e+0
Identity = 1074/1096 (97.99%), Postives = 1074/1096 (97.99%), Query Frame = 3
Query:   24 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSVGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK 3311
            MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKR                      VGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK
Sbjct:    1 MKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVTCCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQNKSEQTDILAVGDWSQKLTFYQLSGKR----------------------VGKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSWLWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDVVIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDMQYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSSICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDISLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAGESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMYIYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRDPYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYKALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMYLEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNALYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQWLAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNLSMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHIPEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAYEKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNHSGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKNSFK 1074          
BLAST of Intraflagellar transport protein 122 homolog vs. Planmine SMEST
Match: SMESG000039305.1 (SMESG000039305.1)

HSP 1 Score: 177.563 bits (449), Expect = 4.325e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 3
Query: 3417 MENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCRCQSLE 3662
            MENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCRCQSLE
Sbjct:    1 MENEENFNPVVLDRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTEDYELQALQKGHCPFCRCQSLE 82          
BLAST of Intraflagellar transport protein 122 homolog vs. Planmine SMEST
Match: SMESG000076568.1 (SMESG000076568.1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.255e-7
Identity = 43/159 (27.04%), Postives = 67/159 (42.14%), Query Frame = 3
Query:   87 WDAC--FSPDGKRIVIAS---DKFVIIYHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEGILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGI----------KKIRVAARVTCCSWTPDGQYLALGMYNGIISI 518
            W +C  FSP  +   I S   DK V +++ S+        G+   +  VA + DG   ASG  DG  ++W+      +      D +  L F+P    L +       IW  ++K +           K +  A VTC SW+ DGQ L  G  + +I +
Sbjct:  150 WVSCVRFSPTSENPSIVSCGWDKVVKVWNLSNCKLRTNHFGHNGYLNTVAVSPDGSLCASGGKDGQAMLWDLSEGRHLYTLEGGDIINALIFSPNRYWLCAATGSSIKIWDLENKVLVGDLKAEVIDNKSKATAEVTCLSWSQDGQTLFAGYSDNVIRV 308          
The following BLAST results are available for this feature:
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT1220.000e+050.87intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
IFT1220.000e+048.22intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
IFT1220.000e+046.09intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
IFT1220.000e+047.73intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
IFT1220.000e+047.65intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
daf-100.000e+033.82Intraflagellar transport protein 122 homolog [Sou... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oseg10.000e+037.57gene:FBgn0265102 transcript:FBtr0345038[more]
Oseg10.000e+037.57gene:FBgn0265102 transcript:FBtr0076663[more]
Wdr822.228e-732.81gene:FBgn0032030 transcript:FBtr0079650[more]
CG39091.262e-631.96gene:FBgn0027524 transcript:FBtr0082172[more]
wds1.586e-635.35gene:FBgn0040066 transcript:FBtr0308566[more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdsub13.694e-726.95WD repeat, sterile alpha motif and U-box domain co... [more]
apaf11.890e-625.64apoptotic peptidase activating factor 1 [Source:NC... [more]
eml12.655e-621.76EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml12.664e-621.76EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml12.871e-621.76EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift1220.000e+051.69intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
ift1220.000e+052.00intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
ift1220.000e+051.97intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
ift1220.000e+050.62intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
ift1220.000e+050.29intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ift1220.000e+050.54intraflagellar transport 122 [Source:MGI Symbol;Ac... [more]
Ift1220.000e+050.62intraflagellar transport 122 [Source:MGI Symbol;Ac... [more]
Ift1220.000e+048.19intraflagellar transport 122 [Source:MGI Symbol;Ac... [more]
Ift1222.153e-3847.59intraflagellar transport 122 [Source:MGI Symbol;Ac... [more]
Poc1a1.301e-932.26POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8WGF4|IF122_XENTR0.000e+051.69Intraflagellar transport protein 122 homolog OS=Xe... [more]
sp|Q6NYH1|IF122_DANRE0.000e+048.80Intraflagellar transport protein 122 homolog OS=Da... [more]
sp|Q6NWV3|IF122_MOUSE0.000e+050.62Intraflagellar transport protein 122 homolog OS=Mu... [more]
sp|Q9HBG6|IF122_HUMAN0.000e+043.75Intraflagellar transport protein 122 homolog OS=Ho... [more]
sp|G5EFW7|IF122_CAEEL0.000e+033.82Intraflagellar transport protein 122 homolog OS=Ca... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V7Z80.000e+051.16WD_REPEATS_REGION domain-containing protein OS=Cap... [more]
A0A5G3KXU70.000e+052.00Intraflagellar transport protein 122 homolog OS=Xe... [more]
A0A1L8GPM10.000e+051.45WD_REPEATS_REGION domain-containing protein OS=Xen... [more]
A0A210R4J60.000e+051.32Intraflagellar transport 122-like protein OS=Mizuh... [more]
A0A3B3SPH20.000e+050.66Intraflagellar transport 122 OS=Paramormyrops king... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT1220.000e+051.11intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
IFT1220.000e+049.74intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
IFT1220.000e+048.79intraflagellar transport 122 [Source:HGNC Symbol;A... [more]
apaf11.351e-719.75apoptotic peptidase activating factor 1 [Source:NC... [more]
apaf11.684e-719.75apoptotic peptidase activating factor 1 [Source:NC... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001650.10.000e+048.58pep scaffold:Pmarinus_7.0:GL479694:6763:31385:-1 g... [more]
ENSPMAT00000005742.11.705e-726.95pep scaffold:Pmarinus_7.0:GL478452:1315:31647:1 ge... [more]
taf5l8.744e-732.99TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
snrnp405.011e-634.51small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
wsb28.696e-631.73WD repeat and SOCS box containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TAF55.209e-726.40Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
TUP17.024e-730.77General repressor of transcription; forms complex ... [more]
HIR14.657e-627.50Subunit of the HIR complex; HIR is a nucleosome as... [more]
PWP25.027e-627.60Conserved 90S pre-ribosomal component; essential f... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO390450.000e+050.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373281.301e-825.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376146.061e-836.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332971.094e-737.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476331.171e-629.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT1220.000e+049.08intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
IFT1220.000e+049.38intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
IFT1220.000e+050.46intraflagellar transport 122 [Source:NCBI gene;Acc... [more]
poc1b1.745e-633.93POC1 centriolar protein B [Source:NCBI gene;Acc:10... [more]
wsb12.874e-626.63WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
back to top
BLAST of Intraflagellar transport protein 122 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039304.10.000e+0100.00SMESG000039304.1[more]
SMESG000039304.10.000e+099.91SMESG000039304.1[more]
SMESG000039304.10.000e+097.99SMESG000039304.1[more]
SMESG000039305.14.325e-52100.00SMESG000039305.1[more]
SMESG000076568.14.255e-727.04SMESG000076568.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009968 ID=SMED30009968|Name=Intraflagellar transport protein 122 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=3717bp
CGACAATACTAAACAAATTTAAAATGAAAGTTGATTTGATTTGGAGTGGA
ATCGTATATGATAAAGAAAGATGCGAAAAATGTATCTGGGATGCATGCTT
TAGTCCTGATGGAAAACGAATTGTTATAGCTTCAGATAAATTCGTCATTA
TATATCATTCATCTGATGGATCACGCTTAAAACTTTTAAAAGGTAACAAA
AGCACAGTTTATTGTGTCGCATATGCTTTTGATGGTAAAAGATTTGCAAG
TGGAGCTGCTGATGGAACAGTTATAATTTGGAATAGTGAAACACTTGAAG
GAATTTTGAGATTTATATTAAATGATGCAGTTCAATGTTTATCTTTTAAC
CCTGTGTCGACAATACTTGCCAGTGGAGCTTGTTTGGAATTTGGTATTTG
GTCACCTGATGATAAAGGCATAAAGAAAATTAGAGTTGCAGCTAGAGTAA
CTTGCTGCAGTTGGACACCAGATGGCCAGTATTTAGCATTAGGAATGTAT
AACGGAATAATTAGTATACGAAACAGAAATGGTGAAGAAAAATCTAAAAT
AGAAAGAACTGGTGGTGCTTTGACTCCAATTTGGTCACTTCAATGGAATC
AGAATAAGTCAGAGCAAACCGATATTTTAGCTGTTGGAGATTGGAGTCAG
AAACTGACCTTTTATCAATTATCCGGAAAGAGAATGATTTATCCGGAAGG
AATTTCGGAAATATATTTTTCATTAAAACAAAGACCCATTCGTGGATCTG
TTGGAAAGGAAATAATTTTGGGATTTGATCCCTGTTCAATATCTTGGTTG
CCTAATACGAGTTATTTGTTGATTTGTGGCTCTGATAAAAAAGTCTTTTT
ATACACAAAAGATGGAATTAAATTAAATCAAGTTCATGAAGCAAAGTCAT
GGCTATGGTGCTGCAAATCTAAACCTGGATCTGATAATCAGTTTGTCATT
TGTGGCCAAGACGGTACGATAAGTTTTCACCAAATCCAATTTTATATGGT
CCACAGCATTTTTCGGGATAGATACGCTTTCAGAGAAGGAATGACAGATG
TTGTAATACATCACCTCGTTACTGACCAAAAGGCTCGAATCAAGTGCAAA
GACATTGTAAAACGGATAGCGATTTATAAAAATCGATTGGGGATCCAATT
TCCCGATAAAGTAACAATCTACCAGCCTCAAAGCGATGATCCAAATGACA
TGCAATATCGGTCAGCGGATAAAATTCAGAAATCATTTGATTGCAACTTG
ATGATCATTACAACAAATCATTTGATTTTATGCGAAGATCGCCGACTGAC
CGCATACGGATACTCGGGCATTAAAGAACGTGAATGGATAATGGATTCCT
CAATTTGCTACACTAAAACAATCGGAGGACCTCAATTCAAAGAAGGAATT
TTAATCGGTCAAAAGAATGGACAAATCACCAAAGTTTACTTGGATAACCA
TTTTCCAATTCAAATATTGAAAGGCACTGGCAGTATTAAATGTTTGGATA
TCAGTCTCAGTAGGAAGAAATTGGGAGTTATTGATGAATCGAATATTCTG
ACAGTGTATAACTTGAAGGGCAATGAAGTTCTGTTTCAAGAAAATGGAGT
CCACAGTTTGGCTTGGAATACTAAAAATGATGACATGATTTGTTACGCTG
GTGAATCGAGCATGTTTATCAAAGCGTCGGATTATCCTTCACATGAATTG
AATGAAACTGGATTAGTTGTAGGATTTAATGGAACAAAAGTCTACACTTT
GCATGAATGGACAATGAAAACAAGTGAGATACCCCAGAGTGCTGCCATGT
ACATTTACCTTCAAAGAAATGAATATGAAAAAGCATACAAAATTGCTTGT
CTTGGAGTCACAACAAACGATTGGTTATATTTGGGAGAAATTGCCTTATG
CAAAATGAATAATTTCTCTATTGCAAAAGCCGCTTTTACTCGTATACGAG
ATCCGTATTATATCCAATTAATTAATGAAATAGAGGAGAAAATGAATTCC
GGAGAAAGAAATACGAATATCCTAATCGGCGATATCTATGCCTATCAGTG
CAACTTTGCGGAAGCAGCGAAAAGTTACATTTCAGCAAATGCTGAATACA
AAGCGTTGGAAATGTATTCCGACATCAAGCAATTTGATCAAGCTAAAAGT
ATCGCTGCGAAGGTCGATCCCGGTGAAACTAAAGTAATATTAGCAAAACA
AGCGGACTGGGCCAAAAGTACCAAGGAACACAAATCGGCTGTTGCTATGT
ATTTGGAAGCTGGACAATACATGAAGGCCGTCGAAATTATGAAGGAAAAT
CAATGGGCGGACATGCTCATTGATTTAGCACGCAAATTAGATCTGACTCA
AAAAGATGTCATTCTAAAATGTGCTATTTATCTGCATCAACTTAACAATG
CGCTTTACGCCTCGGAGTGCTACTATAAAATCGGTGACATTCCTGCCGTC
GTGAAACTGTACGTGGAAACAAGGAATTGGGAGGAAGCATTTGGATTATT
GAAAAAATATCCCGAATTCAAGAAAGCAATTTACGTGCCATATTCACAAT
GGCTAGCGGAAAATGATAAATTTGAAGAAGCACAAATCGCCTTCCATAAA
GCCGGTATGCAAAATGAAGCGGTCGTTGTGTTGGAAACTTTAACGACCAA
CGCAGTGACAGAGCAACGGTACAATGATGCGAGTTATTACTATTGGAATC
TATCTATGCAATGCCTAGAAATCGCTAGAGATTCTCCATCAAACAAGCAG
GAAATGATTAACAAGTTTAAAGAATTCCAAAACAAGGCAGATGTGTACTA
TGTTTATCATTCCATTCATAGATATATGGAGGAGCCATTCAAAACCCACA
TACCAGAGGCATATTTCAATATGTCTCGATATCTTCTCCATAATTTTATG
TTCAACGAATCTTTGGATGGCATTTCAAAAGTTGCTATCTTATTTACATT
GGCCAAACAAGGTAAGGGCCTGGGTGCGTTCAAAATGTCAAGATATGCAT
ACGAAAAACTTCAATCGTTGAGACTGCCTGACCGTTTGAAAAAGGCTGCT
CAATTTGGATCTTTGAGCATCAGATCAAAACCGTTTCATGACAATGAAGA
TATTTTGCTCATGTGTTACCGATGTTCCACTACAAATCCCTTACTGAATC
ATTCGGGAAATATTTGTGTCAATTGCAAAGAACCTTTTGTTCATTCTTTT
ATTTCATTCGAAACATTGCCACTTGTCGAATTTCAGATTGAAAAAGATAT
TTCTGACGAGGAAGCCCTAGAATTAATATCTTTTGATCCAATTCCAAAAA
ATAGTTTCAAAAACGATGCGCATATGATTGTGACACAGAACGTACAAAGT
TTGGCTCTTAATGATGAACTTAATGGGGACTTAACCGATGACCCTTTCAG
TGCTAAATTGTTAAGCATGGAAAATGAAGAAAACTTTAACCCGGTTGTCC
TTGATCGGGAAACCCTTAAGAATATATCAAATACAGAAATAATTGTTTTA
AAATGGCCCCCTCCATTGCGATATCAATATTTCAAAAATGTGATGTCAGA
TGTTGCAATCACAAAGTGTGACAATTGCTTTAGACTTTTCCACACAGAAG
ATTATGAATTGCAAGCTCTACAGAAAGGGCACTGCCCTTTTTGTCGATGC
CAATCACTGGAATGATATATTATTATTATTATAAAGTTTGTTATTTAATA
AAACTGTTTCTATCTCG
back to top

protein sequence of SMED30009968-orf-1

>SMED30009968-orf-1 ID=SMED30009968-orf-1|Name=SMED30009968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1221bp
TILNKFKMKVDLIWSGIVYDKERCEKCIWDACFSPDGKRIVIASDKFVII
YHSSDGSRLKLLKGNKSTVYCVAYAFDGKRFASGAADGTVIIWNSETLEG
ILRFILNDAVQCLSFNPVSTILASGACLEFGIWSPDDKGIKKIRVAARVT
CCSWTPDGQYLALGMYNGIISIRNRNGEEKSKIERTGGALTPIWSLQWNQ
NKSEQTDILAVGDWSQKLTFYQLSGKRMIYPEGISEIYFSLKQRPIRGSV
GKEIILGFDPCSISWLPNTSYLLICGSDKKVFLYTKDGIKLNQVHEAKSW
LWCCKSKPGSDNQFVICGQDGTISFHQIQFYMVHSIFRDRYAFREGMTDV
VIHHLVTDQKARIKCKDIVKRIAIYKNRLGIQFPDKVTIYQPQSDDPNDM
QYRSADKIQKSFDCNLMIITTNHLILCEDRRLTAYGYSGIKEREWIMDSS
ICYTKTIGGPQFKEGILIGQKNGQITKVYLDNHFPIQILKGTGSIKCLDI
SLSRKKLGVIDESNILTVYNLKGNEVLFQENGVHSLAWNTKNDDMICYAG
ESSMFIKASDYPSHELNETGLVVGFNGTKVYTLHEWTMKTSEIPQSAAMY
IYLQRNEYEKAYKIACLGVTTNDWLYLGEIALCKMNNFSIAKAAFTRIRD
PYYIQLINEIEEKMNSGERNTNILIGDIYAYQCNFAEAAKSYISANAEYK
ALEMYSDIKQFDQAKSIAAKVDPGETKVILAKQADWAKSTKEHKSAVAMY
LEAGQYMKAVEIMKENQWADMLIDLARKLDLTQKDVILKCAIYLHQLNNA
LYASECYYKIGDIPAVVKLYVETRNWEEAFGLLKKYPEFKKAIYVPYSQW
LAENDKFEEAQIAFHKAGMQNEAVVVLETLTTNAVTEQRYNDASYYYWNL
SMQCLEIARDSPSNKQEMINKFKEFQNKADVYYVYHSIHRYMEEPFKTHI
PEAYFNMSRYLLHNFMFNESLDGISKVAILFTLAKQGKGLGAFKMSRYAY
EKLQSLRLPDRLKKAAQFGSLSIRSKPFHDNEDILLMCYRCSTTNPLLNH
SGNICVNCKEPFVHSFISFETLPLVEFQIEKDISDEEALELISFDPIPKN
SFKNDAHMIVTQNVQSLALNDELNGDLTDDPFSAKLLSMENEENFNPVVL
DRETLKNISNTEIIVLKWPPPLRYQYFKNVMSDVAITKCDNCFRLFHTED
YELQALQKGHCPFCRCQSLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0036064ciliary basal body
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0030991intraciliary transport particle A
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0042073intraciliary transport
GO:0007275multicellular organism development
GO:0030030cell projection organization
GO:0035721intraciliary retrograde transport
GO:0045879negative regulation of smoothened signaling pathway
GO:0060271cilium morphogenesis
GO:0061512protein localization to cilium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR011659PD40
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding