Lysosomal acid phosphatase

Overview
NameLysosomal acid phosphatase
Smed IDSMED30009962
Length (bp)1526
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysosomal acid phosphatase (SMED30009962) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysosomal acid phosphatase (SMED30009962) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysosomal acid phosphatase (SMED30009962) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysosomal acid phosphatase (SMED30009962) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009962SMESG000074242.1 SMESG000074232.1 dd_Smed_v4_6931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009962SMESG000074242.1 SMESG000074232.1 dd_Smed_v4_6931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009962SMESG000074242.1 SMESG000074232.1 dd_Smed_v4_6931_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysosomal acid phosphatase vs. Ensembl Human
Match: ACP2 (acid phosphatase 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:123])

HSP 1 Score: 194.126 bits (492), Expect = 7.994e-56
Identity = 116/370 (31.35%), Postives = 192/370 (51.89%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWE----VMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIAL 1254
            + L  V +LYRHGDR+P+  YP D  +E++WP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L+ +  +TG  +L     W++ DT+FCE+++ L +  W + +  + L+ +   ++     +    E  +L  G L+ +I + L+   + +       K+++YS HDT +  +   L V +  Q  Y SC + ELY+    S  + V++ ++N +D +     P++ +PGC    CPL  FL+L E   +  K++   C        T  IV +A+
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP----KLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQ--EDSGNFSVEMYFRNESDKA---PWPLS-LPGCPHR-CPLQDFLRLTEP--VVPKDWQQECQLASGPADTEVIVALAV 387          
BLAST of Lysosomal acid phosphatase vs. Ensembl Human
Match: ACP2 (acid phosphatase 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:123])

HSP 1 Score: 193.741 bits (491), Expect = 8.438e-56
Identity = 116/370 (31.35%), Postives = 192/370 (51.89%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWE----VMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIAL 1254
            + L  V +LYRHGDR+P+  YP D  +E++WP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L+ +  +TG  +L     W++ DT+FCE+++ L +  W + +  + L+ +   ++     +    E  +L  G L+ +I + L+   + +       K+++YS HDT +  +   L V +  Q  Y SC + ELY+    S  + V++ ++N +D +     P++ +PGC    CPL  FL+L E   +  K++   C        T  IV +A+
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP----KLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQ--EDSGNFSVEMYFRNESDKA---PWPLS-LPGCPHR-CPLQDFLRLTEP--VVPKDWQQECQLASGPADTEVIVALAV 387          
BLAST of Lysosomal acid phosphatase vs. Ensembl Human
Match: ACP2 (acid phosphatase 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:123])

HSP 1 Score: 193.741 bits (491), Expect = 8.438e-56
Identity = 116/370 (31.35%), Postives = 192/370 (51.89%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWE----VMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIAL 1254
            + L  V +LYRHGDR+P+  YP D  +E++WP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L+ +  +TG  +L     W++ DT+FCE+++ L +  W + +  + L+ +   ++     +    E  +L  G L+ +I + L+   + +       K+++YS HDT +  +   L V +  Q  Y SC + ELY+    S  + V++ ++N +D +     P++ +PGC    CPL  FL+L E   +  K++   C        T  IV +A+
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP----KLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQ--EDSGNFSVEMYFRNESDKA---PWPLS-LPGCPHR-CPLQDFLRLTEP--VVPKDWQQECQLASGPADTEVIVALAV 387          
BLAST of Lysosomal acid phosphatase vs. Ensembl Human
Match: ACP2 (acid phosphatase 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:123])

HSP 1 Score: 191.045 bits (484), Expect = 4.172e-55
Identity = 114/362 (31.49%), Postives = 188/362 (51.93%), Query Frame = 1
Query:  190 LYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWE----VMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIAL 1254
            LYRHGDR+P+  YP D  +E++WP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L+ +  +TG  +L     W++ DT+FCE+++ L +  W + +  + L+ +   ++     +    E  +L  G L+ +I + L+   + +       K+++YS HDT +  +   L V +  Q  Y SC + ELY+    S  + V++ ++N +D +     P++ +PGC    CPL  FL+L E   +  K++   C        T  IV +A+
Sbjct:   11 LYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP----KLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQ--EDSGNFSVEMYFRNESDKA---PWPLS-LPGCPHR-CPLQDFLRLTEP--VVPKDWQQECQLASGPADTEVIVALAV 359          
BLAST of Lysosomal acid phosphatase vs. Ensembl Human
Match: ACPP (acid phosphatase, prostate [Source:HGNC Symbol;Acc:HGNC:125])

HSP 1 Score: 183.726 bits (465), Expect = 2.019e-52
Identity = 110/344 (31.98%), Postives = 178/344 (51.74%), Query Frame = 1
Query:  154 SAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVING-LRWHPFPIQTQSKKYDIL--LSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWS-IIDTIFCEKSNNLSIDDWVTKEVWKN----LTLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLM 1161
            S   K+L  V +++RHGDR+PI  +PTD  +E  WP G G+LT  G++QH++LG ++R+RY  FL +   +  +Y+RSTD DR LMSA +NLA LF      + N  L W P P+ T     D L  L   +CP F+ ++     ++ F+ +  PY++ +  L + +G    +    WS + D ++CE  +N ++  W T++          L     + +    E  +L  G L+  I  ++        YK    K+++YS HDT V+ +   L V +   P Y SC + ELY       ++ V++ Y+N T        P+ ++PGC S  CPL +F +L+
Sbjct:   29 SVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYK----KLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELY---FEKGEYFVEMYYRNETQHE---PYPL-MLPGC-SPSCPLERFAELV 360          
BLAST of Lysosomal acid phosphatase vs. Ensembl Celegans
Match: pho-5 (Putative acid phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q10944])

HSP 1 Score: 194.126 bits (492), Expect = 2.774e-56
Identity = 120/349 (34.38%), Postives = 179/349 (51.29%), Query Frame = 1
Query:  130 INYKFCHCSAADKQLIHVHILYRHGDRAPI-IIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDI-LLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNL-TLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEK 1167
            + YK     A    L +VH ++RHGDR P  +++P D     KWP GLGELT QG  Q + LG WL+RRY  +LG+  N + IY+RS+D +R LMSA++N+AGL F     +  GL W P P+ T SK  D  L    SCP         + +       + +   L F  +K    N+    +W I D +FCEK NN++   W+   +++ +  L N+++    +   L +L  G L++ I    S   S +    K  K   YS HD+ +A + + LGV  +  P Y +C++IE++KL N +    ++V +KN TD     E     IPGCD   C L K    ++K
Sbjct:   17 VVYKEVPIQANTDTLEYVHTVWRHGDRTPAELLFPDDIT---KWPEGLGELTEQGAAQQYRLGQWLKRRYGSWLGEKFNRNAIYIRSSDYNRTLMSAQANMAGL-FPPKYPIAGGLMWQPIPVHTISKPTDKELYEEASCPTAEIEMNAQWKSTKANGIRKKFARELSFFSQKLNLPNMELKATWRIFDNLFCEKQNNITWPSWMNSSIFERVDQLYNEVSQLEFHTDTLRRLRGGTLLEEIFHRFSDKASGSL--GKEAKFYAYSAHDSTIAALLATLGVFYDIYPKYATCLLIEMHKLANETRL--IRVFHKNETDIDRLIEYS---IPGCDDP-CTLQKLGDDLKK 353          
BLAST of Lysosomal acid phosphatase vs. Ensembl Celegans
Match: pho-5 (Putative acid phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q10944])

HSP 1 Score: 194.126 bits (492), Expect = 2.774e-56
Identity = 120/349 (34.38%), Postives = 179/349 (51.29%), Query Frame = 1
Query:  130 INYKFCHCSAADKQLIHVHILYRHGDRAPI-IIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDI-LLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNL-TLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEK 1167
            + YK     A    L +VH ++RHGDR P  +++P D     KWP GLGELT QG  Q + LG WL+RRY  +LG+  N + IY+RS+D +R LMSA++N+AGL F     +  GL W P P+ T SK  D  L    SCP         + +       + +   L F  +K    N+    +W I D +FCEK NN++   W+   +++ +  L N+++    +   L +L  G L++ I    S   S +    K  K   YS HD+ +A + + LGV  +  P Y +C++IE++KL N +    ++V +KN TD     E     IPGCD   C L K    ++K
Sbjct:   17 VVYKEVPIQANTDTLEYVHTVWRHGDRTPAELLFPDDIT---KWPEGLGELTEQGAAQQYRLGQWLKRRYGSWLGEKFNRNAIYIRSSDYNRTLMSAQANMAGL-FPPKYPIAGGLMWQPIPVHTISKPTDKELYEEASCPTAEIEMNAQWKSTKANGIRKKFARELSFFSQKLNLPNMELKATWRIFDNLFCEKQNNITWPSWMNSSIFERVDQLYNEVSQLEFHTDTLRRLRGGTLLEEIFHRFSDKASGSL--GKEAKFYAYSAHDSTIAALLATLGVFYDIYPKYATCLLIEMHKLANETRL--IRVFHKNETDIDRLIEYS---IPGCDDP-CTLQKLGDDLKK 353          
BLAST of Lysosomal acid phosphatase vs. Ensembl Celegans
Match: pho-14 (Intestinal acid PHOsphatase [Source:UniProtKB/TrEMBL;Acc:O17373])

HSP 1 Score: 140.584 bits (353), Expect = 2.080e-36
Identity = 110/363 (30.30%), Postives = 178/363 (49.04%), Query Frame = 1
Query:  169 QLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRY------NDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSK--EVINGLR----WHPFPIQTQSKKYDILLSG-DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-------ELPKLIAGYL----MKRITEYLSSFPSNNWYKN----KGLKMVIYSGHDTDVAPISSLLG----VNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGC--DSTLCPLSKFLQ 1155
            +L+   +++RHGDRAP   YPTD ++E+ WPNG GELT  G++Q + LG  L ++Y      +  L    N   +Y+RSTD +R L+SA +NLAG+F N ++  +  +  R    W P PI T ++K D + +    C     + +  Y    F+      QE L+F+  K+G   +   + + + D  F EK  N+S  +W+T +V   L  ++Q++   + +G       EL +L  G L    M ++ + LS    NN  ++      LK   YS HDT V    +  G    V +   P YT+ + +EL+ L N      V+V++ +    +    +   +  GC  +S  CPL  F Q
Sbjct:   52 ELLLSQVVWRHGDRAPTGTYPTDPHKEEAWPNGWGELTQLGMRQQYALGRLLYKKYVNSTGPSKLLSSSYNSKEVYIRSTDVNRTLVSALANLAGMFENGNRGADYPDSKRWPTNWTPIPIHTLAEKDDPVGNVFAPCARAEELTRQIYAGSGFQKFVAENQEFLDFVSEKSGK-KVIMPEIYMVNDVHFIEKLYNMSQPEWITDDVEIKLRNLSQVSTRFL-FGIGDPYIPELIRLRGGPLLRAMMDKMNQKLSCLAKNNEGEDCSWIGKLKYHAYSAHDTTVYAFLTTFGDEERVIEGGMPHYTASVAVELWNLKNGGP--SVRVLFHSAFHHN--YHVITHLAKGCPHNSEFCPLKTFEQ 408          
BLAST of Lysosomal acid phosphatase vs. Ensembl Celegans
Match: pho-6 (Intestinal acid PHOsphatase [Source:UniProtKB/TrEMBL;Acc:Q20662])

HSP 1 Score: 130.568 bits (327), Expect = 1.970e-33
Identity = 107/350 (30.57%), Postives = 169/350 (48.29%), Query Frame = 1
Query:  172 LIHVHILYRHGDRAP-IIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVING--LR-WHPFPIQTQSKKYDILL--SGDSCPLFRTMQKNFYNNDYFRPKF----QPYQETLEFLKRKTGCINLNFMDSWSIID--TIFCEKSNNLSIDDWVTKEVWKNLTLINQLNW-------EVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            LI +  ++RHGDRAP  + YP DK  E  WP G  +LTN+GI Q  +LG+WLR+RY   +    +   +++ S+D +RA+ +A+   AGLF  +   V     LR W P PIQT     D LL  +   CP +     +  N     P        Y +   +L+  TG  +++F   W+I D   I  E  +N+    W+  +V+   T+++ +         +  N     K   G L+ +  + +    +N   KN     ++YS HD  ++ +   L V+++    YT+ ++ ELY      D   VQ+ YKN T ++ P       IPGC   +CP S+FLQL+E
Sbjct:   19 LIIMQAIWRHGDRAPGDLPYPKDKYNETFWPRGWDQLTNKGIWQAVELGIWLRQRYGATVLPIFDKDKVFILSSDSERAIETAQGVSAGLFPPVDDRVWESSYLRYWQPTPIQTAYGTIDALLRPTKVKCPNY-----DLANEQEEAPIATQINNEYGQMFNWLQNITGMESIDF---WNINDLYDIQRELDHNMPQPQWL-NQVFNGTTIMDHIRELKRITRNQEFNSPTKAKFRGGMLVNQFLQNMEDLKANKTTKNA----MMYSSHDGTLSALLYALNVSNDQLVPYTATVLFELY------DDNTVQLFYKNTTSTAYP-----MTIPGCQQ-ICPYSQFLQLLE 343          
BLAST of Lysosomal acid phosphatase vs. Ensembl Celegans
Match: pho-7 (Intestinal acid PHOsphatase [Source:UniProtKB/TrEMBL;Acc:Q22630])

HSP 1 Score: 130.568 bits (327), Expect = 2.507e-33
Identity = 120/402 (29.85%), Postives = 191/402 (47.51%), Query Frame = 1
Query:  136 YKFC-----HCSAADKQLIHVHILYRHGDRAPI-IIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLR---WHPFPIQTQSKKYDILL-SGDSCPLFRTMQKNFYNNDYFRPKFQP-----YQETLEFLKRKTGCINL--NFMDSWSIIDTIFCEKSNNLSIDDWVTKEV-----WKNLTLINQL-NWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEK-KTMSKKEYNDLC---YPKPNILFTIQIVFIALTV 1260
            Y FC      C+A  + L+ V   +RHGDRAP  + YP+D + E  WP G  +LTN GI Q   LG +LRRRY   +    +   I +RS+D DRA+ +A+S    LF     +V N  +   W P PI+T  K   +L  S   CP ++ +          R K +      Y+  LE +   T       N  D +++I     E  N L   +W+ ++V        +  I ++   ++ N     K +AGYL+   TE L    S +    K L   +YS HD  ++ +   LG++++    YT+CIMIEL+   N      V++ ++N T +  P ++    +PGC ST C LSKF++ +   +  S +   D+C   + + + L    I+F+ L +
Sbjct:    5 YLFCCSLLLPCAAEIEFLLAV---WRHGDRAPENLPYPSDPHNETFWPRGWNQLTNVGIDQATKLGKFLRRRYQGSVLPVFDRKKISIRSSDADRAIETAQSVATALFPPDGLQVWNEEKFRFWQPIPIRTNGKPDPMLRPSKIQCPAYQRIVAE------ERKKIESEINVKYKRELEIISNHTSHQTKYGNIKDVYNVI----LEHYNGLPFPNWIDEKVNGKSLLDTIAEIRRIARLQLFNSRAKAKFMAGYLINSWTESL-VLASQHISPKKAL---LYSSHDGTLSALMYGLGISNHQLIPYTACIMIELHTGNN------VKIYFRN-TTTENPDDVHEMFVPGC-STDCHLSKFIKSVNGVRVKSLEHLEDICESAFSRQSTLI-FAIIFVMLLI 380          
BLAST of Lysosomal acid phosphatase vs. Ensembl Fly
Match: Acph-1 (gene:FBgn0000032 transcript:FBtr0085609)

HSP 1 Score: 190.66 bits (483), Expect = 8.403e-55
Identity = 119/338 (35.21%), Postives = 190/338 (56.21%), Query Frame = 1
Query:  169 QLIHVHILYRHGDRAPIIIYPTDKNREDK-WPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSGDS-CPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVW--KNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            QL  VH++YRHGDR P+  YPTD   + K WP G G+LTN G ++H+DLG WLR RY++ L    +   IYV+STD DR LMSA+SNLAGL+    +++ N  + W P PI T  ++ D +L+  + CP +     +  ++  F+   + ++    +L  K G     F+D+  + +T+F E   N+++  W TK V+  + LT ++   + + +Y  +L +L AG L+K I +      S +   ++   M +YS HDT VA + + L + + + P YT+CIM+EL    + ++   V + YKN T    P +     IPGC  + CPL+K + + E
Sbjct:   47 QLKFVHVIYRHGDRTPVDPYPTDPWGDRKFWPTGWGDLTNLGKQEHYDLGKWLRNRYSNLLPPIYSNENIYVQSTDVDRTLMSAQSNLAGLYEPQGEDIWNTDINWQPIPIHTSPEREDPILAAKAPCPAYDYELASLESSPEFKALTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLPKW-TKMVYGREELTYVSNFAFAISSYTRKLARLKAGPLLKDIFQRFKEKSSGSLKPDRS--MWVYSAHDTTVASVLNALKLFELHSPPYTACIMMEL--RVDETNTPLVSIFYKNTTAEPLPLD-----IPGCGPS-CPLTKLMNIYE 373          
BLAST of Lysosomal acid phosphatase vs. Ensembl Fly
Match: Acph-1 (gene:FBgn0000032 transcript:FBtr0085610)

HSP 1 Score: 191.045 bits (484), Expect = 1.032e-54
Identity = 119/338 (35.21%), Postives = 190/338 (56.21%), Query Frame = 1
Query:  169 QLIHVHILYRHGDRAPIIIYPTDKNREDK-WPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSGDS-CPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVW--KNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            QL  VH++YRHGDR P+  YPTD   + K WP G G+LTN G ++H+DLG WLR RY++ L    +   IYV+STD DR LMSA+SNLAGL+    +++ N  + W P PI T  ++ D +L+  + CP +     +  ++  F+   + ++    +L  K G     F+D+  + +T+F E   N+++  W TK V+  + LT ++   + + +Y  +L +L AG L+K I +      S +   ++   M +YS HDT VA + + L + + + P YT+CIM+EL    + ++   V + YKN T    P +     IPGC  + CPL+K + + E
Sbjct:   64 QLKFVHVIYRHGDRTPVDPYPTDPWGDRKFWPTGWGDLTNLGKQEHYDLGKWLRNRYSNLLPPIYSNENIYVQSTDVDRTLMSAQSNLAGLYEPQGEDIWNTDINWQPIPIHTSPEREDPILAAKAPCPAYDYELASLESSPEFKALTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLPKW-TKMVYGREELTYVSNFAFAISSYTRKLARLKAGPLLKDIFQRFKEKSSGSLKPDRS--MWVYSAHDTTVASVLNALKLFELHSPPYTACIMMEL--RVDETNTPLVSIFYKNTTAEPLPLD-----IPGCGPS-CPLTKLMNIYE 390          
BLAST of Lysosomal acid phosphatase vs. Ensembl Fly
Match: CG9449 (gene:FBgn0036875 transcript:FBtr0345147)

HSP 1 Score: 141.354 bits (355), Expect = 5.997e-37
Identity = 100/360 (27.78%), Postives = 170/360 (47.22%), Query Frame = 1
Query:  100 MIILCVL-TLIINYKFCHCSAADKQLIHV-HILYRHGDRAPIIIYPTDKN-REDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLF--FNLSKEVINGLRWHPFPIQTQSKKYD-ILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQL 1158
            +II CV  + + +    +   ADK  + + H+++RHG R P   YP D    E  +P G G++TN G ++ F++G WLR+RY  FL    +   ++ ++T   R  M+ ++ LA  F       E  +   W P P+ +Q    D +LL    CP +       Y     + + +PY E  + L+  TG       D  S+  T+  E+   L + +W      + L  + + ++    Y  E+ K+  G  +K++ + +     N   K  G K+ IY+GHD+ V  + S L + +   P Y+S I+ EL+K     D W V++ ++N  D  G  +     +PGC+   CPL K L+ 
Sbjct:   10 VIIWCVAHSTVESTAKLYDPGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGWGQITNNGKRELFNIGTWLRKRYGKFLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDMEWNSRFNWQPIPVFSQELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEIEPYLEMFKELEEHTGLSFKEPEDVQSLYLTLLAEQEWGLELPEWTHAYFPEKLQFLAEQSYIYNVYTPEMQKIKGGPFLKKMLDEMQQ-KKNGTLKPSGRKLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYW-VEIYFRN--DPKGQAQ--KLTLPGCEFQ-CPLDKVLEF 362          
BLAST of Lysosomal acid phosphatase vs. Ensembl Fly
Match: CG9449 (gene:FBgn0036875 transcript:FBtr0333846)

HSP 1 Score: 140.969 bits (354), Expect = 9.128e-37
Identity = 100/360 (27.78%), Postives = 170/360 (47.22%), Query Frame = 1
Query:  100 MIILCVL-TLIINYKFCHCSAADKQLIHV-HILYRHGDRAPIIIYPTDKN-REDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLF--FNLSKEVINGLRWHPFPIQTQSKKYD-ILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQL 1158
            +II CV  + + +    +   ADK  + + H+++RHG R P   YP D    E  +P G G++TN G ++ F++G WLR+RY  FL    +   ++ ++T   R  M+ ++ LA  F       E  +   W P P+ +Q    D +LL    CP +       Y     + + +PY E  + L+  TG       D  S+  T+  E+   L + +W      + L  + + ++    Y  E+ K+  G  +K++ + +     N   K  G K+ IY+GHD+ V  + S L + +   P Y+S I+ EL+K     D W V++ ++N  D  G  +     +PGC+   CPL K L+ 
Sbjct:   23 VIIWCVAHSTVESTAKLYDPGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGWGQITNNGKRELFNIGTWLRKRYGKFLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDMEWNSRFNWQPIPVFSQELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEIEPYLEMFKELEEHTGLSFKEPEDVQSLYLTLLAEQEWGLELPEWTHAYFPEKLQFLAEQSYIYNVYTPEMQKIKGGPFLKKMLDEMQQ-KKNGTLKPSGRKLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYW-VEIYFRN--DPKGQAQ--KLTLPGCEFQ-CPLDKVLEF 375          
BLAST of Lysosomal acid phosphatase vs. Ensembl Fly
Match: CG9449 (gene:FBgn0036875 transcript:FBtr0333847)

HSP 1 Score: 140.969 bits (354), Expect = 9.128e-37
Identity = 100/360 (27.78%), Postives = 170/360 (47.22%), Query Frame = 1
Query:  100 MIILCVL-TLIINYKFCHCSAADKQLIHV-HILYRHGDRAPIIIYPTDKN-REDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLF--FNLSKEVINGLRWHPFPIQTQSKKYD-ILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQL 1158
            +II CV  + + +    +   ADK  + + H+++RHG R P   YP D    E  +P G G++TN G ++ F++G WLR+RY  FL    +   ++ ++T   R  M+ ++ LA  F       E  +   W P P+ +Q    D +LL    CP +       Y     + + +PY E  + L+  TG       D  S+  T+  E+   L + +W      + L  + + ++    Y  E+ K+  G  +K++ + +     N   K  G K+ IY+GHD+ V  + S L + +   P Y+S I+ EL+K     D W V++ ++N  D  G  +     +PGC+   CPL K L+ 
Sbjct:   23 VIIWCVAHSTVESTAKLYDPGADKSTLELLHVVFRHGPRTPADTYPRDPYVNETYYPFGWGQITNNGKRELFNIGTWLRKRYGKFLAPNYSPDSVHAQATGVPRTHMTMQTVLAAFFPPKGTDMEWNSRFNWQPIPVFSQELNEDTLLLVRKPCPRYFEALNEVYELPEVKAEIEPYLEMFKELEEHTGLSFKEPEDVQSLYLTLLAEQEWGLELPEWTHAYFPEKLQFLAEQSYIYNVYTPEMQKIKGGPFLKKMLDEMQQ-KKNGTLKPSGRKLFIYAGHDSTVVNVLSALKIWERQMPRYSSMILFELHKNKETGDYW-VEIYFRN--DPKGQAQ--KLTLPGCEFQ-CPLDKVLEF 375          
BLAST of Lysosomal acid phosphatase vs. Ensembl Zebrafish
Match: acp2 (acid phosphatase 2, lysosomal [Source:ZFIN;Acc:ZDB-GENE-050306-40])

HSP 1 Score: 232.261 bits (591), Expect = 3.739e-71
Identity = 133/357 (37.25%), Postives = 203/357 (56.86%), Query Frame = 1
Query:  112 CVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVM----NYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAI-IPGCDSTLCPLSKFLQL 1158
            C + +   + F   S+ ++ L  V +LYRHGDR+PI  YP D  +E  WP G G+L+ +G+KQHF+LG +L++RY  FL +  N   IYVRSTD DR LMSAE+NLAG+F     EV N  L+W P P+ T   + + LLS   ++CP ++ +       D F    + Y++ +E +K KTG    +  + WS+ DT+FCE  +     DWVT++V + L L+    ++++       E  +L  G L+ +I + LS   + +  +NK +KM++YS HDT +  +   L V +  QP Y SC MIELY+  N    + V++ Y+N +  S     P A+ +PGC S  CPL  F+ +
Sbjct:    4 CFVIVAFLFAF-SLSSGERTLKFVTVLYRHGDRSPIKAYPNDPYKESDWPQGFGQLSQEGMKQHFELGQFLKKRYTGFLSEDYNRYEIYVRSTDIDRTLMSAEANLAGMFPPNGSEVFNPDLKWQPIPVHTIPSEEERLLSFPLENCPRYKQLMNETAKTDVFLNMTETYKDFIEMVKNKTGLELASIENIWSVYDTLFCEAQHGKKAPDWVTQDVMQTLKLLKNFGFQILFGVYKRKEKCRLQGGLLVDQIIKNLSIAAATD-SQNK-VKMIVYSAHDTTIVALQEALNVFNGVQPPYASCHMIELYQEDN--GMFSVEMFYRNDSSVS-----PYAVSLPGC-SQRCPLQDFVNI 349          
BLAST of Lysosomal acid phosphatase vs. Ensembl Zebrafish
Match: acp6 (acid phosphatase 6, lysophosphatidic [Source:ZFIN;Acc:ZDB-GENE-050208-290])

HSP 1 Score: 78.1814 bits (191), Expect = 4.413e-15
Identity = 77/319 (24.14%), Postives = 136/319 (42.63%), Query Frame = 1
Query:  271 GELTNQGIKQHFDLGMWLRRRY---NDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSG-DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLS----IDDWVTKEVWKNLTLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLC 1203
            G+LT  G++Q +DLG+ LR++Y     FL    N   +Y+RST+  R + SA+  +AGLF      V++        I T   + ++L      C L + +  N +      P        L+ ++   G      +D   I D +   +++ L     ++ W +    + + +I  + +E      L   +   L   +T       S+   +++  K+ +YS HDT + P    LGV D   P Y + I +ELY+    +++  V+V Y +              IPGC +  CP+ +F   M   ++    Y  LC
Sbjct:  103 GQLTTIGMQQLYDLGVRLRKKYIQEEPFLTPTFNPKEVYIRSTNIVRTIESAKCLVAGLFQQEQAGVVS--------ILTDKAEKEVLYPNYHGCKLLKMLIGNRWAESSTLPDI---AADLQNIQDDLGVDAQQRLDFILIRDDMVARETHGLPLPTVLEQWRSTIEQRAVDMIYHI-YEPSKRQNLQMCVGPLLNMLVTNMEDKIQSSPSKQDR--KLFLYSVHDTTLMPCLMALGVFDMKWPPYAADITLELYQ-HRQTNQHYVKVSYIDQDQK----------IPGCSNIYCPIDEFKAAMAVHSLPDDRYYALC 396          
BLAST of Lysosomal acid phosphatase vs. Ensembl Xenopus
Match: tmem205 (transmembrane protein 205 [Source:Xenbase;Acc:XB-GENE-5820509])

HSP 1 Score: 204.912 bits (520), Expect = 4.407e-60
Identity = 115/343 (33.53%), Postives = 191/343 (55.69%), Query Frame = 1
Query:  157 AADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYD--ILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTG--CINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQL----NWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQL 1158
            AA ++L    ILYRHGDR+PI  +P D + ED WP+G G+LT  G +Q ++LG +LR RY  FL      S +YVRSTD DR +MSA++NLAGLF     ++ N  + W P P+ T SK  D  +L+   +CPL+  + K  +++  +    +PY + L  L + TG     L+   +W+  D +FCE  +N S+  W +KE    L  ++++    N+ +  + E  +L  G L+  I + +++      ++    +++IYS HDT V  + + L V++     YT+C + ELY+  +   ++ +++ Y+N    S     P+  +PGC  + CPL +F++L
Sbjct:   28 AAGRELKFAVILYRHGDRSPIATFPNDNHTEDSWPDGFGQLTKLGKQQQYELGRYLRTRYARFLNASYRPSEVYVRSTDIDRTIMSAQANLAGLFQPAGDQIWNSSIFWQPIPVHTVSKTEDKLLLMPFSNCPLYEKLVKETFSSKEYHQLVEPYLDFLNILSKNTGFSIEQLSQFGAWTTYDALFCETIHNYSLPTWASKETMNKLQHLSEIILSANYGIYRHQEKSRLQGGVLLNSIIQNITNMKETPSFQR---RILIYSAHDTTVFGLHAALNVSNGKLIPYTACHLFELYQ--DEQGQYSIEMYYRN---DSAVEPYPLT-LPGCAFS-CPLHQFIEL 360          
BLAST of Lysosomal acid phosphatase vs. Ensembl Xenopus
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:779653])

HSP 1 Score: 204.527 bits (519), Expect = 7.642e-60
Identity = 118/344 (34.30%), Postives = 188/344 (54.65%), Query Frame = 1
Query:  157 AADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            A  +QL  V ++YRHGDR+P+  YPTD ++E  WP G G+LT  G+KQH+DLG  LR RY  FL +  N   IYV+ST+ DR LMSAE+NLAGL+     ++ N  + W P P+ T  +  D LL      CP +  +Q+    +  F    +  +  L  +  KTG    +    WS+ D +FCEK +NLS+  W T +V+  L  +   ++ V ++G     +  +L  G L+++I + +++   N    + GLK++ YS HD+ +A +   L V +  Q  Y SC + EL++     +  G+  +     + SG +  P++ +PGC +  CPL +F  L++
Sbjct:   30 AESRQLRFVTLVYRHGDRSPVHGYPTDVHKESAWPQGYGQLTQVGMKQHWDLGQELRARYKGFLNESYNRHEIYVQSTNVDRTLMSAEANLAGLYPPKGSQIFNPNITWQPIPVHTVPESEDKLLKFPLTPCPEYLRLQEETRQSAEFVNMTRDNEAFLRMVANKTGLSECSLETVWSVYDILFCEKMHNLSLPSWATPKVFARLNKLKDFSF-VFSFGVTERVKKARLQGGVLVEQILKNITAAAQN---ASDGLKLIAYSAHDSTLAALQIALDVYNGKQVPYASCHIFELFE-----EDSGIFTVEMYLRNESGKSPYPLS-LPGC-AQACPLQEFQSLLQ 362          
BLAST of Lysosomal acid phosphatase vs. Ensembl Xenopus
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:779653])

HSP 1 Score: 204.527 bits (519), Expect = 7.942e-60
Identity = 118/344 (34.30%), Postives = 188/344 (54.65%), Query Frame = 1
Query:  157 AADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            A  +QL  V ++YRHGDR+P+  YPTD ++E  WP G G+LT  G+KQH+DLG  LR RY  FL +  N   IYV+ST+ DR LMSAE+NLAGL+     ++ N  + W P P+ T  +  D LL      CP +  +Q+    +  F    +  +  L  +  KTG    +    WS+ D +FCEK +NLS+  W T +V+  L  +   ++ V ++G     +  +L  G L+++I + +++   N    + GLK++ YS HD+ +A +   L V +  Q  Y SC + EL++     +  G+  +     + SG +  P++ +PGC +  CPL +F  L++
Sbjct:   30 AESRQLRFVTLVYRHGDRSPVHGYPTDVHKESAWPQGYGQLTQVGMKQHWDLGQELRARYKGFLNESYNRHEIYVQSTNVDRTLMSAEANLAGLYPPKGSQIFNPNITWQPIPVHTVPESEDKLLKFPLTPCPEYLRLQEETRQSAEFVNMTRDNEAFLRMVANKTGLSECSLETVWSVYDILFCEKMHNLSLPSWATPKVFARLNKLKDFSF-VFSFGVTERVKKARLQGGVLVEQILKNITAAAQN---ASDGLKLIAYSAHDSTLAALQIALDVYNGKQVPYASCHIFELFE-----EDSGIFTVEMYLRNESGKSPYPLS-LPGC-AQACPLQEFQSLLQ 362          
BLAST of Lysosomal acid phosphatase vs. Ensembl Xenopus
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:779653])

HSP 1 Score: 205.297 bits (521), Expect = 1.191e-59
Identity = 118/344 (34.30%), Postives = 188/344 (54.65%), Query Frame = 1
Query:  157 AADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            A  +QL  V ++YRHGDR+P+  YPTD ++E  WP G G+LT  G+KQH+DLG  LR RY  FL +  N   IYV+ST+ DR LMSAE+NLAGL+     ++ N  + W P P+ T  +  D LL      CP +  +Q+    +  F    +  +  L  +  KTG    +    WS+ D +FCEK +NLS+  W T +V+  L  +   ++ V ++G     +  +L  G L+++I + +++   N    + GLK++ YS HD+ +A +   L V +  Q  Y SC + EL++     +  G+  +     + SG +  P++ +PGC +  CPL +F  L++
Sbjct:   61 AESRQLRFVTLVYRHGDRSPVHGYPTDVHKESAWPQGYGQLTQVGMKQHWDLGQELRARYKGFLNESYNRHEIYVQSTNVDRTLMSAEANLAGLYPPKGSQIFNPNITWQPIPVHTVPESEDKLLKFPLTPCPEYLRLQEETRQSAEFVNMTRDNEAFLRMVANKTGLSECSLETVWSVYDILFCEKMHNLSLPSWATPKVFARLNKLKDFSF-VFSFGVTERVKKARLQGGVLVEQILKNITAAAQN---ASDGLKLIAYSAHDSTLAALQIALDVYNGKQVPYASCHIFELFE-----EDSGIFTVEMYLRNESGKSPYPLS-LPGC-AQACPLQEFQSLLQ 393          
BLAST of Lysosomal acid phosphatase vs. Ensembl Xenopus
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:779653])

HSP 1 Score: 199.519 bits (506), Expect = 2.019e-58
Identity = 114/333 (34.23%), Postives = 182/333 (54.65%), Query Frame = 1
Query:  190 LYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            +YRHGDR+P+  YPTD ++E  WP G G+LT  G+KQH+DLG  LR RY  FL +  N   IYV+ST+ DR LMSAE+NLAGL+     ++ N  + W P P+ T  +  D LL      CP +  +Q+    +  F    +  +  L  +  KTG    +    WS+ D +FCEK +NLS+  W T +V+  L  +   ++ V ++G     +  +L  G L+++I + +++   N    + GLK++ YS HD+ +A +   L V +  Q  Y SC + EL++     +  G+  +     + SG +  P++ +PGC +  CPL +F  L++
Sbjct:    4 VYRHGDRSPVHGYPTDVHKESAWPQGYGQLTQVGMKQHWDLGQELRARYKGFLNESYNRHEIYVQSTNVDRTLMSAEANLAGLYPPKGSQIFNPNITWQPIPVHTVPESEDKLLKFPLTPCPEYLRLQEETRQSAEFVNMTRDNEAFLRMVANKTGLSECSLETVWSVYDILFCEKMHNLSLPSWATPKVFARLNKLKDFSF-VFSFGVTERVKKARLQGGVLVEQILKNITAAAQN---ASDGLKLIAYSAHDSTLAALQIALDVYNGKQVPYASCHIFELFE-----EDSGIFTVEMYLRNESGKSPYPLS-LPGC-AQACPLQEFQSLLQ 325          
BLAST of Lysosomal acid phosphatase vs. Ensembl Mouse
Match: Acp2 (acid phosphatase 2, lysosomal [Source:MGI Symbol;Acc:MGI:87882])

HSP 1 Score: 188.734 bits (478), Expect = 4.271e-54
Identity = 111/340 (32.65%), Postives = 179/340 (52.65%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLN----WEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            + L  V +LYRHGDR+P+  YP D  +E+KWP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L  +  +TG  N+     W++ DT+FCE+++ L +  W + +  + L+ +   +    + +    +  +L  G L+ +I + L+   + + +     K+++YS HDT +  +   L V +  Q  Y SC + ELY+  N    + V++ ++N    S     P+ I+PGC    CPL  FL+L E
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTLFCEQTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFP----KLLVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDN--GNFSVEMYFRN---DSKKAPWPL-ILPGCPHR-CPLQDFLRLTE 359          
BLAST of Lysosomal acid phosphatase vs. Ensembl Mouse
Match: Acp2 (acid phosphatase 2, lysosomal [Source:MGI Symbol;Acc:MGI:87882])

HSP 1 Score: 188.734 bits (478), Expect = 4.271e-54
Identity = 111/340 (32.65%), Postives = 179/340 (52.65%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLN----WEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            + L  V +LYRHGDR+P+  YP D  +E+KWP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L  +  +TG  N+     W++ DT+FCE+++ L +  W + +  + L+ +   +    + +    +  +L  G L+ +I + L+   + + +     K+++YS HDT +  +   L V +  Q  Y SC + ELY+  N    + V++ ++N    S     P+ I+PGC    CPL  FL+L E
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTLFCEQTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFP----KLLVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDN--GNFSVEMYFRN---DSKKAPWPL-ILPGCPHR-CPLQDFLRLTE 359          
BLAST of Lysosomal acid phosphatase vs. Ensembl Mouse
Match: Acp2 (acid phosphatase 2, lysosomal [Source:MGI Symbol;Acc:MGI:87882])

HSP 1 Score: 188.734 bits (478), Expect = 5.276e-54
Identity = 111/340 (32.65%), Postives = 179/340 (52.65%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLN----WEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            + L  V +LYRHGDR+P+  YP D  +E+KWP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L  +  +TG  N+     W++ DT+FCE+++ L +  W + +  + L+ +   +    + +    +  +L  G L+ +I + L+   + + +     K+++YS HDT +  +   L V +  Q  Y SC + ELY+  N    + V++ ++N    S     P+ I+PGC    CPL  FL+L E
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTLFCEQTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFP----KLLVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDN--GNFSVEMYFRN---DSKKAPWPL-ILPGCPHR-CPLQDFLRLTE 359          
BLAST of Lysosomal acid phosphatase vs. Ensembl Mouse
Match: Acpp (acid phosphatase, prostate [Source:MGI Symbol;Acc:MGI:1928480])

HSP 1 Score: 186.037 bits (471), Expect = 1.624e-53
Identity = 118/343 (34.40%), Postives = 176/343 (51.31%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVING-LRWHPFPIQTQSKKYDIL--LSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWS-IIDTIFCEKSNNLSIDDWVTKEVW----KNLTLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWG--VQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            K+L  V +++RHGDR PI  +PTD   E  WP G G+LT  G++QH++LG ++R+RY  FL     +  IY+RSTD DR LMSA +NLA LF      + N  L W P P+ T S   D L  L    CP F  ++     ++ F  +  PY+  L+ L   +G  + +    WS + D +FCE  +N ++  W T++      +   L     + +    E  +L  G L+  I + +        YK    K+V+YS HDT V+ +   L V +   P Y SC M+ELY      DK G  V++ Y+N T +      P+  +PGC  + CPL KF +L++
Sbjct:   32 KELKFVTLVFRHGDRGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIRSTDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRFEELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYDPLFCESVHNFTLPSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYK----KLVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMELYH-----DKGGHFVEMYYRNETQNE---PYPLT-LPGCTHS-CPLEKFAELLD 360          
BLAST of Lysosomal acid phosphatase vs. Ensembl Mouse
Match: Acpp (acid phosphatase, prostate [Source:MGI Symbol;Acc:MGI:1928480])

HSP 1 Score: 185.652 bits (470), Expect = 5.259e-53
Identity = 118/343 (34.40%), Postives = 176/343 (51.31%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVING-LRWHPFPIQTQSKKYDIL--LSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWS-IIDTIFCEKSNNLSIDDWVTKEVW----KNLTLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWG--VQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            K+L  V +++RHGDR PI  +PTD   E  WP G G+LT  G++QH++LG ++R+RY  FL     +  IY+RSTD DR LMSA +NLA LF      + N  L W P P+ T S   D L  L    CP F  ++     ++ F  +  PY+  L+ L   +G  + +    WS + D +FCE  +N ++  W T++      +   L     + +    E  +L  G L+  I + +        YK    K+V+YS HDT V+ +   L V +   P Y SC M+ELY      DK G  V++ Y+N T +      P+  +PGC  + CPL KF +L++
Sbjct:   32 KELKFVTLVFRHGDRGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIRSTDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRFEELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYDPLFCESVHNFTLPSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYK----KLVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMELYH-----DKGGHFVEMYYRNETQNE---PYPLT-LPGCTHS-CPLEKFAELLD 360          
BLAST of Lysosomal acid phosphatase vs. UniProt/SwissProt
Match: sp|B1H1P9|PPAL_XENLA (Lysosomal acid phosphatase OS=Xenopus laevis OX=8355 GN=acp2 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.573e-63
Identity = 131/377 (34.75%), Postives = 203/377 (53.85%), Query Frame = 1
Query:  157 AADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIALTVG 1263
            A  ++L  V ++YRHGDR+P+  YPTD ++E  WP G G+LT  G+KQH+DLG  LR RY  FL +  N   IYVRSTD DR LMSAE+NLAGL+     ++ N  + W P PI T  +  D LL      CP +  +Q+    +  +      Y+  L+ +  KTG  +      WS+ DT+FCEK++N S+  W T +V   L  +   ++ V  +G     +  +L  G L+ +I + +++  +N    + GLK++ YS HD+ +  +   L V +  Q  Y SC + ELYK    S  + VQ+ ++N    SG T  P++ +PGC +  CPL  F  L++   +  +++ + C     I+   +   I LT+G
Sbjct:   30 AQSRELRFVTLVYRHGDRSPVHGYPTDVHKESVWPQGYGQLTQVGMKQHWDLGQELRARYKGFLNESYNRHEIYVRSTDVDRTLMSAEANLAGLYPPEGPQIFNPNITWQPIPIHTIPESEDQLLKFPISPCPAYVKLQEETRQSAEYINMTTTYKAFLQMVANKTGLSDCTLESVWSVYDTLFCEKTHNFSLPTWATADVLSKLNKLKDFSF-VFLFGVHERVKKARLQGGVLVDQILKNMTAAANN---ASNGLKLLAYSAHDSTLGALQLALDVYNGKQAPYASCHIFELYK--EDSGNFTVQMYFRN---ESGKTPYPVS-LPGC-AHACPLQDFQSLLQP--ILAQDWEEECQTTSFIM--TEETIIGLTIG 391          
BLAST of Lysosomal acid phosphatase vs. UniProt/SwissProt
Match: sp|Q0P5F0|PPAL_BOVIN (Lysosomal acid phosphatase OS=Bos taurus OX=9913 GN=ACP2 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.120e-57
Identity = 116/340 (34.12%), Postives = 182/340 (53.53%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWE----VMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            + L  V +LYRHGDR+P+  YP D ++EDKWP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP F  +Q        ++ +     + L+ +  +TG  +L+    W++ DT+FCE+++ L +  W + +  + L+ +   ++     +    E  +L  G L+ +I + L+   + +       K+++YS HDT +  +   LGV +  Q  Y SC M ELY+    S  + V++ ++N    S     P+  +PGC S  CPL  FL+L E
Sbjct:   31 RTLRFVTLLYRHGDRSPVKAYPKDPHQEDKWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPDGIQRFNPNISWQPIPVHTVPVAEDRLLKFPLGPCPRFEQLQNETRRMPEYQNESVQNAQFLDMVANETGLTDLSLETVWNVYDTLFCEQTHGLPLPPWASPQTMQRLSRLKDFSFRFLFGIYKQAEKARLQGGVLLAQIRKNLTLMATTSQLP----KLLVYSAHDTTLVALHMALGVYNGEQAPYASCHMFELYQ--EDSGNFSVEMYFRN---ESHRAPWPLT-LPGC-SHRCPLQDFLRLTE 359          
BLAST of Lysosomal acid phosphatase vs. UniProt/SwissProt
Match: sp|A6H730|PPAP_BOVIN (Prostatic acid phosphatase OS=Bos taurus OX=9913 GN=ACPP PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.157e-57
Identity = 118/342 (34.50%), Postives = 187/342 (54.68%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDIL--LSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWS-IIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLN----WEVMNYGELPKLIAGYLMKRITEYLSSF--PSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLM 1161
            K+L  V +++RHGDR+PI  +P D  +E  WP G G+LT  G+ QH++LG ++R+RY +FL +      ++VRSTD DR LMSA +NLA LF      + N  L W P P+ T     D L  L   +CP F+ +Q     ++ F+ + QPY++ +E L + TG  + + +  WS + D +FCE  +N ++  W T++    L  I++L+    + +    E  +L  G L+  I  ++ S   PSN        K+++YS HDT V+ +   L V +   P Y SC M+ELY       ++ V++ Y+N T      E     +PGC  + CPL+KF++L+
Sbjct:   35 KELRFVTLVFRHGDRSPIETFPNDPIKESSWPQGFGQLTQLGMAQHYELGQYIRKRYENFLNESYKREQVHVRSTDIDRTLMSAMTNLAALFPPEGISIWNPSLPWQPIPVHTVPVSEDQLLYLPFRNCPRFQELQSETLISEEFQKRLQPYKDFIEVLPKLTGYHDQDLLGIWSKVYDPLFCEGVHNFTLPSWATEDTMTKLKEISELSLLSLYGIHKQKEKSRLQGGVLINEILNHMKSATQPSNR------RKLIMYSAHDTTVSGLQMALDVYNGILPPYASCHMMELY---FQDGEYFVEMYYRNETR----YEPHPLTLPGCTPS-CPLAKFVELV 362          
BLAST of Lysosomal acid phosphatase vs. UniProt/SwissProt
Match: sp|Q3KQG9|PPAT_XENLA (Testicular acid phosphatase homolog OS=Xenopus laevis OX=8355 GN=acp4 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.205e-57
Identity = 128/365 (35.07%), Postives = 192/365 (52.60%), Query Frame = 1
Query:   94 LIMIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLF-FNLSKEVINGLRWHPFPIQTQSKKYDILLSGDS--CPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDS--WSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLN----WEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLM 1161
            ++ + L    L I   FC  +     L  V  ++RHGDRAPI  YP D ++E  WPNGL +LT +G++Q ++LG +LRRRY+ FL    N   IYVRSTD DR LMSA+++LAGL+  N S+     + W P P+ T     D LL   S  CP +  + +       ++ K   +++ +E +   TG      +    W + DT+FC+KS+N+S+  W T +V K L  I+  +     E+    E  +L  G L+  +    S   +    K+  LKM++YS HD+ +  +   L V +   P Y+SC +IE YK  + +    V++ Y+N T    P E+    +PGCDS  CPL  F QLM
Sbjct:    7 ILWLPLAFTNLYILTTFCQRT---DNLTFVVAVFRHGDRAPIDTYPNDPHKEKLWPNGLQQLTQEGMRQQYELGRFLRRRYDHFLSSTYNRQEIYVRSTDYDRTLMSAQASLAGLYPPNGSQLWHRDIHWQPIPVHTVPASQDRLLKFPSKDCPRYYELMRETIQQPEYQDKVNSWKDFMERIANYTGYRAETTISRWVWKVYDTLFCQKSHNISLPSWATADVVKTLKEISAFDVKTHVEMHKTNEKARLTGGILVDALLRNFSDVVN----KSLPLKMLMYSAHDSTLIALQGALKVYNGLHPPYSSCHIIEFYKEADGTH--SVRMFYRNET-VREPYEL---ALPGCDSP-CPLLNFTQLM 357          
BLAST of Lysosomal acid phosphatase vs. UniProt/SwissProt
Match: sp|Q5NVF6|PPAL_PONAB (Lysosomal acid phosphatase OS=Pongo abelii OX=9601 GN=ACP2 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.394e-55
Identity = 116/370 (31.35%), Postives = 192/370 (51.89%), Query Frame = 1
Query:  166 KQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWE----VMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIAL 1254
            + L  V +LYRHGDR+P+  YP D  +E++WP G G+LT +G+ QH++LG  LR+RY+ FL    +   +YVRSTD DR LMSAE+NLAGLF     +  N  + W P P+ T     D LL      CP +  +Q        ++ +     + L+ +  +TG  +L     W++ DT+FCE+++ L +  W + +  + L+ +   ++     +    E  +L  G L+ +I + L+   + +       K+++YS HDT +  +   L V +  Q  Y SC + ELY+    S  + V++ ++N +D +     P++ +PGC    CPL  FL+L E   +  K++   C        T  IV +A+
Sbjct:   31 RSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLP----KLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQ--EDSGNFSVEMYFRNESDKA---PWPLS-LPGCPHR-CPLQDFLRLTEP--VVPKDWQQECQVASGPADTEVIVALAV 387          
BLAST of Lysosomal acid phosphatase vs. TrEMBL
Match: A0A3B5A4U5 (Acid phosphatase 2, lysosomal OS=Stegastes partitus OX=144197 PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.658e-71
Identity = 138/362 (38.12%), Postives = 203/362 (56.08%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVM----NYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            M+   VL L+     C  +AAD++L +V +L+RHGDR+P+  YPTD  +E  WP G G+L+ +G++QHFDLG +LR RY  FL +  N   I VRSTD DR LMSAE+NLAGL+     +V    L+W P P+ T  +  + LLS     CP ++ +     + + F      Y++T++ ++ KTG    N    WS+ DT+FCE  +N+S  DWVT +V   L  +    ++V+    N  E  +L  G L+  I + LS     +    + LK+++ S HDT VA + + L V +  QP YTSC M ELY+  N S    VQ+ Y+N    S     PI  +PGC S  CPL +F+++ +
Sbjct:    1 MVSAAVLVLLTLGCVCGEAAADRKLAYVTVLFRHGDRSPVKAYPTDPYQESDWPQGFGQLSQEGMRQHFDLGQFLRNRYKGFLSESYNRHEILVRSTDYDRTLMSAEANLAGLYPPSGAQVFTPSLKWQPIPVHTVPESQERLLSFPLSDCPRYKQLMNETEHTEEFLNVTATYKDTIDLVRTKTGLNKTNVESVWSVYDTLFCESRHNMSAPDWVTPDVMNKLRELKDFGFQVLFGVYNQQEKSRLQGGLLLGEIVKNLSKMAVPD--PTQKLKLMMLSAHDTTVAALQASLNVFNGVQPPYTSCHMFELYQEENGS--ASVQMFYRN---DSTVDPYPIQ-LPGC-SLNCPLDEFVKIAK 353          
BLAST of Lysosomal acid phosphatase vs. TrEMBL
Match: A0A3B4U707 (Acid phosphatase 2, lysosomal OS=Seriola dumerili OX=41447 PE=3 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.257e-69
Identity = 137/364 (37.64%), Postives = 203/364 (55.77%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLS---GDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVM----NYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAI-IPGCDSTLCPLSKFLQLME 1164
            M+   VL ++     C  +A +K L++V +L+RHGDR+P+  YPTD ++E  WP G G+L+ +G++QHFDLG +LR RYN FL    +   I VRSTD DR LMSAE+NLAGL+     +V    LRW P P+ T  +  + LLS   GD CP ++ +     +   F      YQ+ +E ++ KTG    N    WS+ DT+FCE  +N S  DWVT +V + L ++    ++V+       E  +L  G L+  I + LS   + +    + LK+++ S HDT VA + + L V +  QP Y SC + ELY+  N S    V + Y+N  DS   T  P  + +PGC S  CPL  F+++ +
Sbjct:    1 MVPAAVLFILTVGSVCGPAATEKTLVYVTVLFRHGDRSPVKAYPTDPHQESDWPQGFGQLSQEGMRQHFDLGQFLRSRYNGFLNASYDRHEISVRSTDYDRTLMSAEANLAGLYPPSGPQVFKPSLRWQPIPVHTVPQSEERLLSFPLGD-CPRYKQLMNETEHTQEFINVTTKYQDIIELVRNKTGLNKTNVESVWSVYDTLFCESIHNKSAPDWVTPDVMEKLKVLKDFGFQVIFGFYKQQEKSRLQGGILLGEIVKNLSKMAAPD--PKQRLKLMMLSAHDTTVAALQASLNVFNGKQPPYASCQIFELYRDDNGS--ASVSMFYRN--DS---TAAPYPLQLPGC-SLHCPLEDFVRITK 353          
BLAST of Lysosomal acid phosphatase vs. TrEMBL
Match: A0A3B4WSK8 (Acid phosphatase 2, lysosomal OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 3.630e-69
Identity = 137/365 (37.53%), Postives = 205/365 (56.16%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLS---GDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEV--MNYG---ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAI-IPGCDSTLCPLSKFLQLME 1164
            M+   VL ++     C  +A +K L++V +L+RHGDR+P+  YPTD ++E  WP G G+L+ +G++QHFDLG +LR RYN FL    +   I VRSTD DR LMSAE+NLAGL+     +V    LRW P P+ T  +  + LLS   GD CP ++ +     +   F      YQ+ +E ++ KTG    N    WS+ DT+FCE  +N S  DWVT +V + L ++    ++   +N G   E+   ++G L+  I + LS   + +    + LK+++ S HDT VA + + L V +  QP Y SC + ELY+  N S    V + Y+N  DS   T  P  + +PGC S  CPL  F+++ +
Sbjct:    5 MVPAAVLFILTVGSVCGPAATEKTLVYVTVLFRHGDRSPVKAYPTDPHQESDWPQGFGQLSQEGMRQHFDLGQFLRSRYNGFLNASYDRHEISVRSTDYDRTLMSAEANLAGLYPPSGPQVFKPSLRWQPIPVHTVPQSEERLLSFPLGD-CPRYKQLMNETEHTQEFINVTTKYQDIIELVRNKTGLNKTNVESVWSVYDTLFCESVHNKSAPDWVTPDVMEKLKVLKDFGFQTYPLNTGLNVEIAPCLSGILLGEIVKNLSKMAAPD--PKQRLKLMMLSAHDTTVAALQASLNVFNGRQPPYASCQIFELYRDDNGS--ASVSMFYRN--DS---TAAPYPLQLPGC-SLHCPLEDFVRITK 358          
BLAST of Lysosomal acid phosphatase vs. TrEMBL
Match: A0A4W6E2G8 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=acp2 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.689e-69
Identity = 138/362 (38.12%), Postives = 204/362 (56.35%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLS---GDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVM----NYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSS-GPTEIPIAIIPGCDSTLCPLSKFLQL 1158
            M+   VL ++     C  +AA+K+L++V +L+RHGDR+PI  YPTD  +E  WP G G+L+  G++QHFDLG +LR+RY  FL +  +   I VRSTD DR LMSAE+NLAGL+    ++V N  L+W P P+ T  +  + LLS   GD CP ++ +     + + F      YQ+ +E ++ KTG    N    WS+ DT++CE  +N +  DWVT +V + L  +    ++VM       E  +L  G L+  I + LS     +    + LK+++ S HDT VA + + L V +  QP Y SC +IELY+  N S    V + Y+N  DS  GP       +PGC +  CPL  FL++
Sbjct:    1 MVAALVLFILTVGSVCGQAAAEKKLLYVTVLFRHGDRSPIKAYPTDPYQESAWPQGFGQLSQVGMQQHFDLGQFLRKRYTGFLNESYDRHEISVRSTDYDRTLMSAEANLAGLYPPSGEQVFNPNLKWQPIPVHTVPQSEERLLSFPLGD-CPRYKQLMNETEHTEEFLNVTSTYQDIIELVRSKTGLNKTNVESVWSVYDTLYCESVHNKTAPDWVTPDVMEKLRQLKDFGFQVMFGVYKQQEKSRLQGGILLGEIVKNLSKMAVPD--PKQRLKLMMLSAHDTTVAALQASLNVFNGRQPPYASCQIIELYRDDNGS--VSVSMFYRN--DSKVGPYP---QQLPGC-TLDCPLEDFLRI 351          
BLAST of Lysosomal acid phosphatase vs. TrEMBL
Match: A0A3B4FTZ6 (Acid phosphatase 2, lysosomal OS=Pundamilia nyererei OX=303518 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.415e-68
Identity = 133/361 (36.84%), Postives = 201/361 (55.68%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVM----NYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAI-IPGCDSTLCPLSKFLQL 1158
            M+   VL +      C  +AA+++L++  +L+RHGDR+P+  YPTD ++E  WP G G+L+  G++QHF+LG +LR RY  FL    N   I VRSTD DR LMSAE+NLAGL+    ++V N  L+W P P+ T  +  + LLS     CP ++ +     + + F      YQ+ +E ++ KTG  +      WS+ DT+FCE  +N++  DWV+ +V K L  +    ++V+       E  +L  G L+  I + LS     +    + LKM++ S HDT VA + + L V +  QP Y SC+MIELY+  N S    V + Y+N T      E P  + +PGC S  CPL +F+ +
Sbjct:    1 MVPAAVLFVFTLTCVCGRAAAERKLVYTTVLFRHGDRSPVKAYPTDPHQESDWPQGFGQLSQIGMQQHFELGQFLRTRYEKFLNASYNRHEILVRSTDYDRTLMSAEANLAGLYPPSGQQVFNPNLKWQPIPVHTVPQSEERLLSFPLKDCPRYQQLMNETEHTEEFLNVTATYQDIIELVRNKTGLKDTTVETVWSVYDTLFCESQHNMTAPDWVSSDVMKKLRKLKDFGFQVIFAVHEQQEKSRLQGGMLLGEIVKNLSKMAVPD--PKQQLKMMMLSAHDTTVAALLASLSVFNGIQPPYASCLMIELYREDNGS--ASVSMFYRNNTK-----EPPYPLQLPGC-SLDCPLDEFVTI 351          
BLAST of Lysosomal acid phosphatase vs. Ensembl Cavefish
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:103043608])

HSP 1 Score: 223.787 bits (569), Expect = 1.553e-67
Identity = 128/346 (36.99%), Postives = 195/346 (56.36%), Query Frame = 1
Query:  154 SAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEK 1167
            S    QL  V +LYRHGDR+P+  +PTD ++E  WP G G+LT +G++QH +LG +LRRRY  FL +      I VRSTD DR LMSAESNLAGL+     +V + GL W P PI T  +  + LLS    +C  ++ +       + F    + Y + LE ++ KTG  +      WSI DT+FCE+ + +++ DWVT +V   L  +    ++++ +G     E  +L  G L+ +I +  ++  S     N  LKM++YS HDT +  +   L V +  QP Y SC ++EL++ +N S  + V++ Y+N  DSS     P+  IPGC +  C L +F++L + 
Sbjct:   17 SFGQSQLKLVTVLYRHGDRSPVKAFPTDPHQESAWPQGFGQLTQEGMRQHLELGQFLRRRYQGFLSEPYTRYEIAVRSTDYDRTLMSAESNLAGLYPPNGSQVFHPGLNWQPIPIHTVPQDQERLLSFPLSNCAYYQRLMNETEKTELFINMTKTYADFLEMVRNKTGVESTTIASIWSIHDTLFCEEKHGMTLPDWVTPDVMSTLQFLKNFGFQIL-FGVHKRVEKSRLQGGLLLDQIIKNFTTVSS--LKPNGQLKMIMYSAHDTTIVALHEALNVFNGLQPPYASCHIMELHQDSNGS--FSVEIFYRN--DSSVAEPYPLT-IPGC-AHHCSLEEFIKLTQS 353          
BLAST of Lysosomal acid phosphatase vs. Ensembl Cavefish
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:103043608])

HSP 1 Score: 223.402 bits (568), Expect = 8.751e-67
Identity = 128/345 (37.10%), Postives = 195/345 (56.52%), Query Frame = 1
Query:  154 SAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLSG--DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLME 1164
            S    QL  V +LYRHGDR+P+  +PTD ++E  WP G G+LT +G++QH +LG +LRRRY  FL +      I VRSTD DR LMSAESNLAGL+     +V + GL W P PI T  +  + LLS    +C  ++ +       + F    + Y + LE ++ KTG  +      WSI DT+FCE+ + +++ DWVT +V   L  +    ++++ +G     E  +L  G L+ +I +  ++  S     N  LKM++YS HDT +  +   L V +  QP Y SC ++EL++ +N S  + V++ Y+N  DSS     P+  IPGC +  C L +F++L +
Sbjct:   17 SFGQSQLKLVTVLYRHGDRSPVKAFPTDPHQESAWPQGFGQLTQEGMRQHLELGQFLRRRYQGFLSEPYTRYEIAVRSTDYDRTLMSAESNLAGLYPPNGSQVFHPGLNWQPIPIHTVPQDQERLLSFPLSNCAYYQRLMNETEKTELFINMTKTYADFLEMVRNKTGVESTTIASIWSIHDTLFCEEKHGMTLPDWVTPDVMSTLQFLKNFGFQIL-FGVHKRVEKSRLQGGLLLDQIIKNFTTVSS--LKPNGQLKMIMYSAHDTTIVALHEALNVFNGLQPPYASCHIMELHQDSNGS--FSVEIFYRN--DSSVAEPYPLT-IPGC-AHHCSLEEFIKLTQ 352          
BLAST of Lysosomal acid phosphatase vs. Ensembl Nematostella
Match: EDO35543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL52])

HSP 1 Score: 81.6481 bits (200), Expect = 8.733e-19
Identity = 45/114 (39.47%), Postives = 65/114 (57.02%), Query Frame = 1
Query:  190 LYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRY---NDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEV-INGLRWHPFPIQTQSKKYD 519
            +Y HGDR+PI  YP+D    + WP G G+LT  G++Q + LG +LR RY    +FL      + +Y RSTD+DR +MSA++ L GL+     +   + L W P P+    K  D
Sbjct:    1 VYPHGDRSPIRSYPSDP-YANYWPQGFGQLTQLGMQQEYYLGKFLRNRYMESTNFLNSSYIRNQVYCRSTDKDRTIMSAQAQLNGLYPPKGPQKWRHNLDWQPIPVHVVPKNLD 113          
BLAST of Lysosomal acid phosphatase vs. Ensembl Nematostella
Match: EDO41028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L1])

HSP 1 Score: 87.4261 bits (215), Expect = 1.329e-18
Identity = 93/383 (24.28%), Postives = 153/383 (39.95%), Query Frame = 1
Query:  169 QLIHVHILYRHGDRAPIIIYPTDKNR-----EDKWPNGL------------------------------------GELTNQGIKQHFDLGMWLRRRYND---FLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDS-CPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYGELPKLIA--GYLMKRITEYLSSFPSNNWYKNKGL-----KMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLM 1161
            +L+H  I +RHG R P+   P    R     +  W   +                                    GELT  G +Q FDLG  L++RY D    L        +Y+RST+  R + SA+  +AGL+    KE I  +      I T+ ++ D +L   S CPL     +    +   +   + Y +    ++   G    NF       D +   +++ L +D  +  + W  +         V+  G L K  A    +   + ++L    +    K  G+     KM +YS HDT ++ + + LGV DN  P + S +  ELY+  N  +K+ V+V+Y+               +PG ++ LCP  KF  L+
Sbjct:   44 ELVHAQIAFRHGARTPVYRLPEMVGRGKGIDDVTWDKDVIMGDLPQTMIEFRVRNIDGGDQPEYSPNIKKGGCICGELTKVGQQQTFDLGRTLQKRYIDDIKLLSPVFTPHEVYIRSTNVPRTIKSAKCVVAGLY---GKENIQRV----LHIITRDEREDTILPNMSFCPLLTRWLRKIQASSIQKINLEGYAKDHSTIRNDLGITAKNFF-FVCFRDVMSAREAHGLFVDP-ILHDYWDMIDQHATEELVVVQCGNLGKRFARQDIIKASVGKFLDEIITRMNDKINGISPAQHKMCLYSVHDTSISCLLTALGVFDNKWPDFASEVAFELYR--NQDNKYFVKVLYQEKAQH----------LPGNNTDLCPFEKFKALL 405          
BLAST of Lysosomal acid phosphatase vs. Ensembl Nematostella
Match: EDO45438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB2])

HSP 1 Score: 88.1965 bits (217), Expect = 2.033e-18
Identity = 86/350 (24.57%), Postives = 155/350 (44.29%), Query Frame = 1
Query:  178 HVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYND-----FLGQYLNYSLIYVRSTDRDRALMSAESNLAGLF--FNLSKEVINGLRW------HPFPIQTQSKKYDILLSG-DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIID-----TIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDN----NQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDS-SGPTEIPIAIIPGCDSTLCPLSKFLQ 1155
             V ++ RHG R  +      K+ +     G   LT +G+ + F  G ++RR+YN+      L +  N S +YVRS+D  R L SA S L GL+   N ++    G  +         PI T   + D LL G  +C  F+     FYN+  F          L+ L+  TG  ++   + +++ D      ++ + S NL+   W   +        ++ +++V+          G L   I E      + +    +  K++ YS H   +  + + LG+  +    + P+Y S ++IEL  L     ++ V+  +++  D+ +G   +   ++PGC  TLCPL  F++
Sbjct:   43 QVVVISRHGSRGFLT-----KHHKTFVEGGDSSLTVRGMDEMFMAGEYIRRQYNESTHLNLLTEKYNASEVYVRSSDFARTLNSASSFLLGLYPPMNQTQSTSYGRIYSAPYNIQQVPIHTVDVENDQLLRGWMNCSTFQKKVSAFYNSKQFTSYKSQSANFLKELEDLTGMEDIQLENFYNVYDFIHLHRVYGDTSLNLTKGQWQRVQSIAAWVESHKFSFDVIGSKG-----GGILANEIAENFQETKTGH----RKAKLLYYSAHYPTITSLFATLGLGKDLTLHSIPSYASLVIIEL--LQTDVGEYNVRFGFRDGPDNDTGQDPLQFHVLPGCKETLCPLETFIK 376          
BLAST of Lysosomal acid phosphatase vs. Ensembl Nematostella
Match: EDO47726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP2])

HSP 1 Score: 71.2478 bits (173), Expect = 2.513e-13
Identity = 81/364 (22.25%), Postives = 142/364 (39.01%), Query Frame = 1
Query:  163 DKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYND--FLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDS-CPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKT----------GC-------------INLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVM----NYGELPKLIAGYLMKRI-TEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTN----HSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKF 1149
            D   I V  +YR G          +    D     +G LT +G KQ    G  LR+ Y D  FL    + + +Y+RS D  R + SA++ + G++       I   R     I T  K +D +      CP        F   D +R  +    + L    +K           GC             ++++ +D   ++D I   + +  +I   +T +++K +       W  M    +  +   +  G+L+K I  E + S    +  K      ++YSGHD  + P  S   V D   P Y S +M+E+ ++T      + ++ V+++Y             +   P CD+  CP+ +F
Sbjct:   88 DSHYIVVDRIYRRGY--------LNGRESDAGDCAIGHLTLEGYKQQELNGQILRKVYVDTGFLKSNFSSTEMYLRSDDESRTMQSAQALILGMY---PPATIASDRAQVADINTMDKLFDSIEPNTMLCPKLSEYNHGFLKTDMWRHHYNGITKPLLLEVQKALGSNKTLGSGGCSHTLYLPIAVTRKLDIDGLDD--LVDCIHTHQCHGFAIPPGITDDLFKRMVDELLYRWNSMYLYPSREKYATVGIGFLIKDIWQEVMESLTGESLRK-----FLLYSGHDGTIQPFLSAFNVTDFKWPPYASFLMLEILEVTGTPQASTPQYAVRMLYNG----------ELLKFPFCDANPCPMDQF 423          
BLAST of Lysosomal acid phosphatase vs. Ensembl Nematostella
Match: EDO30143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M3])

HSP 1 Score: 57.7658 bits (138), Expect = 1.435e-10
Identity = 40/119 (33.61%), Postives = 57/119 (47.90%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSA-----ADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLF 441
            MI L V+ L++   FC  S      A+K L   +++YRHGDR+ I  YP+D    + WP G G+LT                              +Y RSTD+DR +MSA++ L GL+
Sbjct:    8 MISLNVIRLLL--VFCLSSLKFSTNAEKILRMANLVYRHGDRSAIRSYPSDP-YANYWPQGFGQLTQ-----------------------------VYCRSTDKDRTIMSAQAQLNGLY 94          
BLAST of Lysosomal acid phosphatase vs. Ensembl Medaka
Match: acp2 (acid phosphatase 2, lysosomal [Source:NCBI gene;Acc:101166200])

HSP 1 Score: 215.312 bits (547), Expect = 2.972e-64
Identity = 130/358 (36.31%), Postives = 195/358 (54.47%), Query Frame = 1
Query:  115 VLTLIINYKFCHCSA-ADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVIN-GLRWHPFPIQTQSKKYDILLS---GDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQL 1158
            +++ ++ + F   SA A+K+L+ V +L+RHGDR+P+  YPTD  +E  WP G G+L+ +G++QHF+LG +LR RY +FL +      I VRSTD DR LMSAE+NLAGL+    ++V +  L W P P+ T  +  + LLS   GD CP +R + +   +   F      YQ+ ++ +K KTG  +      WS+ DT+FCE  +N S   WVT EV   L ++    ++V ++G     E  +L  G L+  I + LS     +    +  KM++ S HDT V  + + L V +  QP Y SC   ELY+  N      V + Y+N  DSS   E     +  C S  CPL  F+ +
Sbjct:    2 MVSSVVLFVFAVASAVAEKKLVFVTVLFRHGDRSPVKAYPTDPYQESAWPQGFGQLSQEGMRQHFELGQYLRSRYKNFLNESYVRHEILVRSTDYDRTLMSAEANLAGLYPPKGEQVFHPELEWQPIPVHTVPQSEERLLSFPLGD-CPRYRQLMEETAHTKEFLNVTSTYQDLIDLVKNKTGLEHTTVETVWSVYDTLFCEARHNKSAPAWVTPEVMDKLRILKDFGFQV-SFGFYKQQEKSRLQGGILLGEIVKNLSRMAVPD--PTRQFKMMMLSAHDTTVTALQASLNVFNGKQPPYASCHFFELYR--NDDGSTSVSMFYRN--DSS--VEPYPLQLSNC-SLDCPLEDFVSI 348          
BLAST of Lysosomal acid phosphatase vs. Ensembl Medaka
Match: ENSORLT00000008842.2 (testicular acid phosphatase homolog [Source:NCBI gene;Acc:101160600])

HSP 1 Score: 178.718 bits (452), Expect = 1.494e-50
Identity = 114/353 (32.29%), Postives = 183/353 (51.84%), Query Frame = 1
Query:  142 FC-HCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSK--EVINGLRWHPFPIQTQSKKYDILLS--GDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTG--CINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG----ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFT-DSSGPTEIPIAIIPGCDST-LCPLSKFLQLM 1161
            FC  C    +QL  V  ++RHGDR+PI  YP D + E+ W  G G+LT  G+KQ F+LG +LRRRY++FL +  ++  +YVRST  DR LMSA++ LAG+F  + +   ++  L W P P+ T  +  D LL   G +CP F+ +    + +  ++   + ++  +E L   TG     L     W + DT+ C++ +NL++  W T EV   L  I         Y     E  +L+ G L+  I   L +F S+   K   LK ++YS HD+ +  + + L + +   P Y +C + E Y+   +   + +++ Y+N T     P       +PGC+    CPLS F +L+
Sbjct:   14 FCFKCFTEARQLRFVVAVFRHGDRSPIESYPNDPHGEEVWAQGFGQLTELGMKQQFELGRFLRRRYSNFLSEDYDHRELYVRSTSYDRTLMSAQACLAGMFPPVRRPPPIMPQLLWRPIPVHTIPRVQDKLLKSPGKNCPRFKALMIETFESLPYQKFQKAHKNFVEELSNHTGYPVSKLVGKKIWRVYDTLSCQRIHNLTLPRWATPEVLDTLRRIASFEVTYSIYSHKRKEKARLLGGILLNAI---LRNF-SDAVEKGSKLKFIMYSAHDSTLITLQAALDIYNGLLPPYAACQLFEFYQ--EYDGSYSLEMYYRNETWRDPHPNS-----VPGCNGLHPCPLSMFTELV 355          
BLAST of Lysosomal acid phosphatase vs. Ensembl Medaka
Match: acp6 (acid phosphatase 6, lysophosphatidic [Source:NCBI gene;Acc:101172206])

HSP 1 Score: 95.9005 bits (237), Expect = 5.364e-21
Identity = 95/360 (26.39%), Postives = 154/360 (42.78%), Query Frame = 1
Query:  178 HVHILY-----RHGDRAPIIIYPTDKNREDKWPNGL--GELTNQGIKQHFDLGMWLRRRY---NDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSG-DSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYGELP------KLIAGYLMKRITEYLSS-FPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLC 1203
            H HI Y     + G R P  I   D  R++    G   G+LT  G++Q +DLG  LRRRY     FL      + +YVRST+  R + SA   +AGLF    KE +        PI T   + +IL      C L +    + +      P        L+ +    G    + +D   I D +   +++ L     +  E W++   + Q   ++M +   P      +L  G L+  + + +       +   N+  K+ +YS HDT + P    LG+ D   P Y + I +EL++ +  +++  V+V Y               +IPGC    CPL +F Q M   ++S + Y+ LC
Sbjct:   80 HTHIDYVVTDLQGGPRPPAPI--EDNYRKNILTGGTFPGQLTTLGMQQLYDLGSRLRRRYVEERSFLNSSFTPAEVYVRSTNIVRTIESARCLIAGLFQQKQKETV--------PILTTPAESEILYPNYHGCKLLKARCSHRWAESSTLPDIA---ADLQRIHSALGIAAHHRVDFILIRDDMVARETHGLPSPPAL--EPWRDT--VEQRAVDMMLHVFQPSNRENLQLSVGPLLHTLLDNMEENLQGGSSEPNR--KLFLYSAHDTTLIPCLMALGIFDKKWPPYGADITVELHQ-SQQTNEPFVKVSYMGEDQ----------LIPGCSGVYCPLQEFKQAMSACSLSSERYHSLC 409          
BLAST of Lysosomal acid phosphatase vs. Planmine SMEST
Match: SMESG000074232.1 (SMESG000074232.1)

HSP 1 Score: 479.174 bits (1232), Expect = 6.679e-170
Identity = 228/231 (98.70%), Postives = 229/231 (99.13%), Query Frame = 1
Query:  100 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEV 792
            MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPLFRTMQKNFY+ DYFRPKFQPYQETLEFLKRKTG INLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEV
Sbjct:    1 MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPLFRTMQKNFYSKDYFRPKFQPYQETLEFLKRKTGLINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEV 231          
BLAST of Lysosomal acid phosphatase vs. Planmine SMEST
Match: SMESG000074242.1 (SMESG000074242.1)

HSP 1 Score: 353.214 bits (905), Expect = 3.541e-121
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 1
Query:  793 MNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIALTVGXXXXXXXXXXXXXXXKPEHRYSRVESDANIN 1356
            MNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIALTVGLILFIIVFSVFRFRRKPEHRYSRVESDANIN
Sbjct:    1 MNYGELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIALTVGLILFIIVFSVFRFRRKPEHRYSRVESDANIN 188          
BLAST of Lysosomal acid phosphatase vs. Planmine SMEST
Match: SMESG000074196.1 (SMESG000074196.1)

HSP 1 Score: 293.123 bits (749), Expect = 1.772e-94
Identity = 161/391 (41.18%), Postives = 232/391 (59.34%), Query Frame = 1
Query:   97 IMIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSG--PTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIALTV 1260
            ++IIL  +T II   F   +  +  LIHVH ++RHGDRAP+ +Y ++ N+   WPNGLGELTN GI Q F LG WLRRRYN F+ +  NYS IYVRSTD DR LMSAESNLAGL+FN +  VI  L+W P PI T  +K DI++  D C  +   +   Y    F P  + YQ TL+ ++  T    L F D W + D + CEK +N++ D WVTKE++ N+T + +++W++M YG ELP+L  G  +  I + L +       K +  K  +YSGHDTD+A + S +GV +  QP Y +C +IEL+K  +  D      I     +++G   T +P  I+  C    C L KF++++ ++TM+K++Y   C+      F + I F A T+
Sbjct:    1 MIIILFQITFII---FGVEAIENDSLIHVHAIFRHGDRAPLKLYSSNVNKIKLWPNGLGELTNLGIGQQFQLGQWLRRRYNGFISEKYNYSEIYVRSTDIDRTLMSAESNLAGLYFNQTHYVIPNLKWIPIPIHTIPQKSDIIMLQDDCDKYLRKKAEMYKR--FLPVLKKYQSTLDLIRNYTNEPQLEFSDLWEVYDYLICEKYHNITWDKWVTKEIYYNMTQMYKMDWKIMYYGDELPRLAGGLFLHEIIKQLMNTTFTPPPKRRE-KFRVYSGHDTDIAALMSAIGVYEERQPPYATCFLIELWKKADSKDNLENVYIKMYLRNNTGQKSTYLPEIILKQCPQYPCSLLKFIEVVRERTMTKEQYKAECFSVFLPTFIVGI-FTAFTL 384          
BLAST of Lysosomal acid phosphatase vs. Planmine SMEST
Match: SMESG000074204.1 (SMESG000074204.1)

HSP 1 Score: 270.781 bits (691), Expect = 2.477e-86
Identity = 156/375 (41.60%), Postives = 223/375 (59.47%), Query Frame = 1
Query:   97 IMIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSG--PTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKKEYNDLCYPK 1212
            ++IIL  +T II   F   +  +  LIHVH ++RHGDRAPI +Y +  N+   WPNGLGELT+ GI Q F LG WLRRRYN F+ +  NYS IYVRSTD DR LMSAESNLAGL+FN +  VI  L+W P PI T     D ++  D+C  +   +   Y    F P  + YQ TL+ ++R T    L F D   + D + CEK +N++ D WVTKE+  NLT I+ +NW+++ YG ELP+L  G  +  I + L++       K +  K  +YSGHDTD+A + S +GV +  QP Y +C +IEL+K  +  D      I     +++G   T +P  I+  C    C L KF++++ ++TM+K++Y   C+ +
Sbjct:    1 MIIILFQITFII---FGVEAIENDSLIHVHAIFRHGDRAPIKLYSSYVNKIKLWPNGLGELTDLGIGQQFQLGQWLRRRYNGFISEKYNYSEIYVRSTDIDRTLMSAESNLAGLYFNQTHYVIPNLKWIPIPIHTIPIDLDKIMLQDNCDKYLRKKAEMYKR--FLPVRKKYQSTLDLIRRYTNEPQLEFSDLCKVYDYLICEKYHNITWDKWVTKEICWNLTNISIINWKIIYYGDELPRLAGGLFLHEIIKQLTNTTFTPPAK-RMEKFRMYSGHDTDIAALMSAIGVYEERQPPYATCFLIELWKKADSKDNLENVYIKMYLRNNTGQKSTYLPELILKQCSQYPCSLLKFIEVVRERTMTKEQYKAECFTR 369          
BLAST of Lysosomal acid phosphatase vs. Planmine SMEST
Match: SMESG000074204.1 (SMESG000074204.1)

HSP 1 Score: 257.299 bits (656), Expect = 2.718e-79
Identity = 152/366 (41.53%), Postives = 215/366 (58.74%), Query Frame = 1
Query:   97 IMIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNREDKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRDRALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPLFRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIFCEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYG-ELPKLIAGYLMKRITEYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCIMIELYKLTNHSDKWGVQVIYKNFTDSSG--PTEIPIAIIPGCDSTLCPLSKFLQLMEKKTMSKK 1185
            ++IIL  +T II   F   +  +  LIHVH ++RHGDRAPI +Y +  N+   WPNGLGELT+ GI Q F LG WLRRRYN F+ +  NYS IYVRSTD DR LMSAESNLAGL+FN +  VI  L+W P PI T     D ++  D+C  +   +   Y    F P  + YQ TL+ ++R T    L F D   + D + CEK +N++ D WVTKE+  NLT I+ +NW+++ YG ELP+L  G  +  I + L++       K +  K  +YSGHDTD+A + S +GV +  QP Y +C +IEL+K  +  D      I     +++G   T +P  I+  C    C L KF++ + + +M+ +
Sbjct:    1 MIIILFQITFII---FGVEAIENDSLIHVHAIFRHGDRAPIKLYSSYVNKIKLWPNGLGELTDLGIGQQFQLGQWLRRRYNGFISEKYNYSEIYVRSTDIDRTLMSAESNLAGLYFNQTHYVIPNLKWIPIPIHTIPIDLDKIMLQDNCDKYLRKKAEMYKR--FLPVRKKYQSTLDLIRRYTNEPQLEFSDLCKVYDYLICEKYHNITWDKWVTKEICWNLTNISIINWKIIYYGDELPRLAGGLFLHEIIKQLTNTTFTPPAK-RMEKFRMYSGHDTDIAALMSAIGVYEERQPPYATCFLIELWKKADSKDNLENVYIKMYLRNNTGQKSTYLPELILKQCSQYPCSLLKFIENILEYSMADR 360          
The following BLAST results are available for this feature:
BLAST of Lysosomal acid phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACP27.994e-5631.35acid phosphatase 2, lysosomal [Source:HGNC Symbol;... [more]
ACP28.438e-5631.35acid phosphatase 2, lysosomal [Source:HGNC Symbol;... [more]
ACP28.438e-5631.35acid phosphatase 2, lysosomal [Source:HGNC Symbol;... [more]
ACP24.172e-5531.49acid phosphatase 2, lysosomal [Source:HGNC Symbol;... [more]
ACPP2.019e-5231.98acid phosphatase, prostate [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pho-52.774e-5634.38Putative acid phosphatase 5 [Source:UniProtKB/Swi... [more]
pho-52.774e-5634.38Putative acid phosphatase 5 [Source:UniProtKB/Swi... [more]
pho-142.080e-3630.30Intestinal acid PHOsphatase [Source:UniProtKB/TrE... [more]
pho-61.970e-3330.57Intestinal acid PHOsphatase [Source:UniProtKB/TrE... [more]
pho-72.507e-3329.85Intestinal acid PHOsphatase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acph-18.403e-5535.21gene:FBgn0000032 transcript:FBtr0085609[more]
Acph-11.032e-5435.21gene:FBgn0000032 transcript:FBtr0085610[more]
CG94495.997e-3727.78gene:FBgn0036875 transcript:FBtr0345147[more]
CG94499.128e-3727.78gene:FBgn0036875 transcript:FBtr0333846[more]
CG94499.128e-3727.78gene:FBgn0036875 transcript:FBtr0333847[more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acp23.739e-7137.25acid phosphatase 2, lysosomal [Source:ZFIN;Acc:ZDB... [more]
acp64.413e-1524.14acid phosphatase 6, lysophosphatidic [Source:ZFIN;... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem2054.407e-6033.53transmembrane protein 205 [Source:Xenbase;Acc:XB-G... [more]
acp27.642e-6034.30acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
acp27.942e-6034.30acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
acp21.191e-5934.30acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
acp22.019e-5834.23acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acp24.271e-5432.65acid phosphatase 2, lysosomal [Source:MGI Symbol;A... [more]
Acp24.271e-5432.65acid phosphatase 2, lysosomal [Source:MGI Symbol;A... [more]
Acp25.276e-5432.65acid phosphatase 2, lysosomal [Source:MGI Symbol;A... [more]
Acpp1.624e-5334.40acid phosphatase, prostate [Source:MGI Symbol;Acc:... [more]
Acpp5.259e-5334.40acid phosphatase, prostate [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B1H1P9|PPAL_XENLA3.573e-6334.75Lysosomal acid phosphatase OS=Xenopus laevis OX=83... [more]
sp|Q0P5F0|PPAL_BOVIN1.120e-5734.12Lysosomal acid phosphatase OS=Bos taurus OX=9913 G... [more]
sp|A6H730|PPAP_BOVIN1.157e-5734.50Prostatic acid phosphatase OS=Bos taurus OX=9913 G... [more]
sp|Q3KQG9|PPAT_XENLA1.205e-5735.07Testicular acid phosphatase homolog OS=Xenopus lae... [more]
sp|Q5NVF6|PPAL_PONAB3.394e-5531.35Lysosomal acid phosphatase OS=Pongo abelii OX=9601... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5A4U52.658e-7138.12Acid phosphatase 2, lysosomal OS=Stegastes partitu... [more]
A0A3B4U7072.257e-6937.64Acid phosphatase 2, lysosomal OS=Seriola dumerili ... [more]
A0A3B4WSK83.630e-6937.53Acid phosphatase 2, lysosomal OS=Seriola lalandi d... [more]
A0A4W6E2G88.689e-6938.12Uncharacterized protein OS=Lates calcarifer OX=818... [more]
A0A3B4FTZ63.415e-6836.84Acid phosphatase 2, lysosomal OS=Pundamilia nyerer... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acp21.553e-6736.99acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
acp28.751e-6737.10acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355438.733e-1939.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410281.329e-1824.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454382.033e-1824.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477262.513e-1322.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301431.435e-1033.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
acp22.972e-6436.31acid phosphatase 2, lysosomal [Source:NCBI gene;Ac... [more]
ENSORLT00000008842.21.494e-5032.29testicular acid phosphatase homolog [Source:NCBI g... [more]
acp65.364e-2126.39acid phosphatase 6, lysophosphatidic [Source:NCBI ... [more]
back to top
BLAST of Lysosomal acid phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074232.16.679e-17098.70SMESG000074232.1[more]
SMESG000074242.13.541e-121100.00SMESG000074242.1[more]
SMESG000074196.11.772e-9441.18SMESG000074196.1[more]
SMESG000074204.12.477e-8641.60SMESG000074204.1[more]
SMESG000074204.12.718e-7941.53SMESG000074204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009962 ID=SMED30009962|Name=Lysosomal acid phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1526bp
CTTTGTAGTTCAAAAAGAATTTAAAGTATAAATTACAGAAAATTATTTCA
ATTATAAAATTTTGAATAACAGAAATTTTGAAATTTGTAACATTTAATTA
TGATTATTTTATGTGTCCTTACACTTATCATAAATTATAAATTTTGTCAT
TGTTCTGCTGCAGATAAGCAACTAATTCATGTTCATATTTTATATCGTCA
CGGTGATAGAGCTCCTATTATTATATATCCAACTGATAAAAATAGAGAAG
ATAAATGGCCTAACGGACTAGGAGAACTAACAAACCAAGGAATTAAGCAA
CATTTTGATTTGGGTATGTGGCTTCGGCGTCGCTATAATGACTTCCTTGG
ACAATATTTGAATTATTCTTTAATCTATGTACGTAGCACCGATAGAGACC
GAGCATTAATGTCTGCTGAATCGAATTTAGCAGGTTTATTTTTTAACTTG
TCTAAAGAAGTAATCAATGGGCTGAGGTGGCATCCTTTTCCTATTCAAAC
TCAATCAAAAAAATATGATATTTTGTTGTCTGGTGATTCATGTCCGTTGT
TTCGTACAATGCAGAAGAATTTCTACAACAATGATTATTTTCGACCGAAA
TTCCAGCCTTATCAAGAGACATTGGAGTTTCTGAAAAGGAAAACTGGATG
CATTAATCTCAATTTCATGGATTCTTGGAGTATTATAGATACGATATTTT
GTGAAAAATCCAATAACTTATCTATCGATGATTGGGTAACTAAAGAAGTG
TGGAAGAATTTAACATTAATTAATCAACTGAATTGGGAGGTCATGAATTA
TGGAGAATTACCAAAGTTAATCGCTGGTTATTTGATGAAAAGAATAACTG
AATATTTGTCTTCTTTTCCAAGCAATAACTGGTATAAAAATAAGGGTTTG
AAAATGGTCATCTATTCTGGTCACGATACAGATGTTGCGCCCATTAGTTC
ATTGCTTGGGGTTAATGATAATAATCAACCTGCGTATACCTCATGTATAA
TGATTGAACTTTATAAGTTAACTAATCATTCCGACAAATGGGGCGTTCAA
GTTATTTACAAGAATTTCACAGACAGTTCTGGCCCCACAGAAATTCCAAT
TGCTATAATTCCCGGTTGCGATTCTACTCTCTGCCCGTTGTCTAAATTTT
TGCAACTGATGGAAAAGAAAACTATGTCAAAAAAAGAATACAATGATCTT
TGTTATCCAAAGCCCAATATTCTGTTTACTATACAAATTGTTTTTATTGC
ATTGACAGTCGGTTTGATTTTGTTTATAATTGTTTTCTCTGTTTTCCGAT
TTCGGCGGAAACCAGAACATCGCTACTCCAGAGTTGAAAGCGATGCCAAC
ATTAATTGATAATTATTTCAAATGACTGCTTAAAATAACATTTTAATTAA
TTATTTATTTAAAATTTTATCTTTTATTCTAAATAATTTTTACATATTTT
TTGTAAAATTACTTTTCTTTTGATGAAACATAAACAGTTTTGGATTTTAT
TTAAATGAAAACATTTTAGTTTTAAG
back to top

protein sequence of SMED30009962-orf-1

>SMED30009962-orf-1 ID=SMED30009962-orf-1|Name=SMED30009962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MIILCVLTLIINYKFCHCSAADKQLIHVHILYRHGDRAPIIIYPTDKNRE
DKWPNGLGELTNQGIKQHFDLGMWLRRRYNDFLGQYLNYSLIYVRSTDRD
RALMSAESNLAGLFFNLSKEVINGLRWHPFPIQTQSKKYDILLSGDSCPL
FRTMQKNFYNNDYFRPKFQPYQETLEFLKRKTGCINLNFMDSWSIIDTIF
CEKSNNLSIDDWVTKEVWKNLTLINQLNWEVMNYGELPKLIAGYLMKRIT
EYLSSFPSNNWYKNKGLKMVIYSGHDTDVAPISSLLGVNDNNQPAYTSCI
MIELYKLTNHSDKWGVQVIYKNFTDSSGPTEIPIAIIPGCDSTLCPLSKF
LQLMEKKTMSKKEYNDLCYPKPNILFTIQIVFIALTVGLILFIIVFSVFR
FRRKPEHRYSRVESDANIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000560His_Pase_clade-2
IPR029033His_PPase_superfam
IPR033379Acid_Pase_AS
Vocabulary: molecular function
TermDefinition
GO:0003993acid phosphatase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000560Histidine phosphatase superfamily, clade-2PFAMPF00328His_Phos_2coord: 50..307
e-value: 6.9E-21
score: 75.0
IPR000560Histidine phosphatase superfamily, clade-2CDDcd07061HP_HAP_likecoord: 24..320
e-value: 7.12039E-37
score: 132.883
IPR029033Histidine phosphatase superfamilyGENE3DG3DSA:3.40.50.1240coord: 23..373
e-value: 1.4E-93
score: 316.0
IPR029033Histidine phosphatase superfamilySUPERFAMILYSSF53254Phosphoglycerate mutase-likecoord: 24..369
NoneNo IPR availablePANTHERPTHR11567:SF180LYSOSOMAL ACID PHOSPHATASEcoord: 16..402
NoneNo IPR availablePANTHERPTHR11567ACID PHOSPHATASE-RELATEDcoord: 16..402
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.61
NoneNo IPR availableTMHMMTMhelixcoord: 377..399
IPR033379Histidine acid phosphatase active sitePROSITEPS00616HIS_ACID_PHOSPHAT_1coord: 25..39