SMED30009956

Overview
NameSMED30009956
Smed IDSMED30009956
Length (bp)4780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009956 (SMED30009956) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009956 (SMED30009956) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009956 (SMED30009956) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009956 (SMED30009956) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009956

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009956SMESG000022272.1 dd_Smed_v4_10991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009956SMESG000022272.1 dd_Smed_v4_10991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009956SMESG000022272.1 dd_Smed_v4_10991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009956SMESG000022273.1 dd_Smed_v4_8344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009956SMESG000022273.1 dd_Smed_v4_8344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009956SMESG000022273.1 dd_Smed_v6_8344_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009956SMESG000022273.1 dd_Smed_v6_8344_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30009956SMESG000022273.1 dd_Smed_v6_8344_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009956SMESG000022272.1 dd_Smed_v6_10991_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009956SMESG000022272.1 dd_Smed_v6_10991_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30009956SMESG000022273.1 dd_Smed_v4_8344_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009956SMESG000022273.1 dd_Smed_v4_8344_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009956SMESG000022273.1 dd_Smed_v4_8344_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30009956SMESG000022273.1 dd_Smed_v4_8344_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009956 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.013019:2031..12421 +19622
Homology
BLAST of SMED30009956 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0087621)

HSP 1 Score: 81.2629 bits (199), Expect = 8.472e-15
Identity = 47/183 (25.68%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  468 VKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSET 1016
            ++Q W  +L  +    +H K A +YHQF+ E  +  + + +R ++     +Q +    +   + +++  +    EL++  + +  L+RR+  +VP+  R   +  QG    + A  + G LQ++K E VT+LDN G                 R+ W V T  G +  IP   L +P PD E 
Sbjct:  772 LQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFG--LDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSG-----------------RVKWRVRTAKGQEGPIPGACLLLPPPDQEA 935          
BLAST of SMED30009956 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273225)

HSP 1 Score: 81.2629 bits (199), Expect = 9.857e-15
Identity = 47/183 (25.68%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  468 VKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSET 1016
            ++Q W  +L  +    +H K A +YHQF+ E  +  + + +R ++     +Q +    +   + +++  +    EL++  + +  L+RR+  +VP+  R   +  QG    + A  + G LQ++K E VT+LDN G                 R+ W V T  G +  IP   L +P PD E 
Sbjct:  813 LQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFG--LDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSG-----------------RVKWRVRTAKGQEGPIPGACLLLPPPDQEA 976          
BLAST of SMED30009956 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273226)

HSP 1 Score: 81.2629 bits (199), Expect = 9.939e-15
Identity = 57/228 (25.00%), Postives = 104/228 (45.61%), Query Frame = 3
Query:  339 FYDSISSLEELFSQVTTQIADR--ALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSET 1016
            +Y+++ S  E        I DR  AL +     +K  E+ ++   ++Q W  +L  +    +H K A +YHQF+ E  +  + + +R ++     +Q +    +   + +++  +    EL++  + +  L+RR+  +VP+  R   +  QG    + A  + G LQ++K E VT+LDN G                 R+ W V T  G +  IP   L +P PD E 
Sbjct:  770 YYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTA--LQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFG--LDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSG-----------------RVKWRVRTAKGQEGPIPGACLLLPPPDQEA 976          
BLAST of SMED30009956 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0087619)

HSP 1 Score: 81.2629 bits (199), Expect = 1.003e-14
Identity = 47/183 (25.68%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  468 VKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSET 1016
            ++Q W  +L  +    +H K A +YHQF+ E  +  + + +R ++     +Q +    +   + +++  +    EL++  + +  L+RR+  +VP+  R   +  QG    + A  + G LQ++K E VT+LDN G                 R+ W V T  G +  IP   L +P PD E 
Sbjct:  813 LQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFG--LDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSG-----------------RVKWRVRTAKGQEGPIPGACLLLPPPDQEA 976          
BLAST of SMED30009956 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0301964)

HSP 1 Score: 81.2629 bits (199), Expect = 1.007e-14
Identity = 57/228 (25.00%), Postives = 104/228 (45.61%), Query Frame = 3
Query:  339 FYDSISSLEELFSQVTTQIADR--ALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSET 1016
            +Y+++ S  E        I DR  AL +     +K  E+ ++   ++Q W  +L  +    +H K A +YHQF+ E  +  + + +R ++     +Q +    +   + +++  +    EL++  + +  L+RR+  +VP+  R   +  QG    + A  + G LQ++K E VT+LDN G                 R+ W V T  G +  IP   L +P PD E 
Sbjct:  729 YYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTA--LQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFG--LDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSG-----------------RVKWRVRTAKGQEGPIPGACLLLPPPDQEA 935          
BLAST of SMED30009956 vs. TrEMBL
Match: gnl|BL_ORD_ID|18263877 (tr|A0A267GZ50|A0A267GZ50_9PLAT SH3_10 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024865g2 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.760e-22
Identity = 87/320 (27.19%), Postives = 153/320 (47.81%), Query Frame = 3
Query:  162 FSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRAL-----KDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFY 1106
            F     AL  ++  Q  L T++  +E  I+ ++E  +     ++E+ + E+  NQ+A+ +   IS+LE +F + + Q+ ++A+     +D  +   K   SDV    V Q W  +    EL  +H K++ADYH FYH  +E+  L+  R     + +  +   G+      +  +     ++   L  +  +L  +S ++VP+Y RT  + E G     +  F  G+  L+ +E VTVLDN               S P  + W V+  NG  + +PSI +W+P PD+E   V   ++ +L  TW  L+  LR   ++FY
Sbjct:   29 FGCTQQALARQDKVQQTLLTQIHRLERQIELSSEQLTA-CSTQLEQARSEVGVNQDAIRYLGRISALENVFLEASNQVTEQAISMAQVQDDFVIGGKKMLSDV----VTQSWEWVSKLGELMQLHLKNSADYHSFYHNANELDGLLNSRRANNNQVVGSIPPSGLPASMHRMNTVLSDNLSQFLFLWQRTDDLVSKSHSVVPVYRRTHPV-ESGYPGRNIHRFDDGENVLQDAEEVTVLDN---------------SHP--MTWQVKKSNGTVMQVPSICIWLPPPDTEAVEVSYAVRRKLLNTWAALLSKLRAWIVDFY 325          
BLAST of SMED30009956 vs. TrEMBL
Match: gnl|BL_ORD_ID|18307437 (tr|A0A1I8I886|A0A1I8I886_9PLAT RNase H domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 4.646e-22
Identity = 87/320 (27.19%), Postives = 153/320 (47.81%), Query Frame = 3
Query:  162 FSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRAL-----KDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFY 1106
            F     AL  ++  Q  L T++  +E  I+ ++E  +     ++E+ + E+  NQ+A+ +   IS+LE +F + + Q+ ++A+     +D  +   K   SDV    V Q W  +    EL  +H K++ADYH FYH  +E+  L+  R     + +  +   G+      +  +     ++   L  +  +L  +S ++VP+Y RT  + E G     +  F  G+  L+ +E VTVLDN               S P  + W V+  NG  + +PSI +W+P PD+E   V   ++ +L  TW  L+  LR   ++FY
Sbjct: 1652 FGCTQQALARQDKVQQTLLTQIHRLERQIELSSEQLTA-CSTQLEQARSEVGVNQDAIRYLGRISALENVFLEASNQVTEQAISMAQVQDDFVIGGKKMLSDV----VTQSWEWVSKLGELMQLHLKNSADYHSFYHNANELDGLLNSRRANNNQVVGSIPPSGLPASMHRMNTVLSDNLSQFLFLWQRTDDLVSKSHSVVPVYRRTHPV-ESGYPGRNIHRFDDGENVLQDAEEVTVLDN---------------SHP--MTWQVKKSNGTVMQVPSICIWLPPPDTEAVEVSYAVRRKLLNTWAALLSKLRAWIVDFY 1948          
BLAST of SMED30009956 vs. TrEMBL
Match: gnl|BL_ORD_ID|18243272 (tr|A0A267GQQ9|A0A267GQQ9_9PLAT SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031564g1 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.308e-21
Identity = 87/334 (26.05%), Postives = 151/334 (45.21%), Query Frame = 3
Query:  159 PFSSCHSALILENSR-QAALKTELEEIEN--FIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEITS 1151
            P   C    +L  SR Q +L  ++  +E    I +++E+  L             + N++A+ +   ISSLE   ++   Q+  +A+  S    T+  E      +V Q W  +    ELT +H K++ADY  FYHE +E+  +I  R     + +  +   G +   + +  +     ++L  L+ +   L  +S ++VP+Y R   + + G  A  +  F  G+  L  SE VT+LDN      +NS            NW V   +G  + +PSI +W+P PD+E   V   +Q +L  TW  L+  +++    FY     K+ S   +T+
Sbjct:   30 PRLGCSQQALLHQSRTQESLLAKIASLEEQLAIASSSEAQKLQQARGQV------SINKDAIAYLRQISSLESNLAECCRQVEGQAIALSQRDNTELLEKKQLSNEVSQTWEWVTRLGELTQLHLKNSADYQWFYHEANELEEVINSRNLANAQVVGSIPPTGQLSSMQRMNTVLSDNYSQLLLLSQRTDQLMSKSHSVVPLYRRCQPV-DVGYPARNIFRFDDGENTLNDSEEVTILDN------SNS-----------FNWKVAKADGTVMEVPSICIWLPPPDTEAVEVAVVIQRKLRNTWASLLTEVQQWLTQFYSDYLQKLLSNDTVTA 339          
BLAST of SMED30009956 vs. TrEMBL
Match: gnl|BL_ORD_ID|18258395 (tr|A0A267FZT9|A0A267FZT9_9PLAT SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024051g1 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.644e-21
Identity = 87/320 (27.19%), Postives = 153/320 (47.81%), Query Frame = 3
Query:  162 FSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRAL-----KDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFY 1106
            F     AL  ++  Q  L T++  +E  I+ ++E  +     ++E+ + E+  NQ+A+ +   IS+LE +F + + Q+ ++A+     +D  +   K   SDV    V Q W  +    EL  +H K++ADYH FYH  +E+  L+  R     + +  +   G+      +  +     ++   L  +  +L  +S ++VP+Y RT  + E G     +  F  G+  L+ +E VTVLDN               S P  + W V+  NG  + +PSI +W+P PD+E   V   ++ +L  TW  L+  LR   ++FY
Sbjct:   29 FGCTQQALARQDKVQQTLLTQIHRLERQIELSSEQLTA-CSTQLEQARSEVGVNQDAIRYLGRISALENVFLEASNQVTEQAISMAQVQDDFVIGGKKMLSDV----VTQSWEWVSKLGELMQLHLKNSADYHSFYHNANELDGLLNSRRANNNQVVGSIPPSGLPASMHRMNTVLSDNLSQFLFLWQRTDDLVSKSHSVVPVYRRTHPV-ESGYPGRNIHRFDDGENVLQDAEEVTVLDN---------------SHP--MTWQVKKSNGTVMQVPSICIWLPPPDTEAVEVSYAVRRKLLNTWAALLSKLRAWIVDFY 325          
BLAST of SMED30009956 vs. TrEMBL
Match: gnl|BL_ORD_ID|18277605 (tr|A0A267FZL1|A0A267FZL1_9PLAT SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024865g1 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.934e-21
Identity = 87/320 (27.19%), Postives = 153/320 (47.81%), Query Frame = 3
Query:  162 FSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRAL-----KDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFY 1106
            F     AL  ++  Q  L T++  +E  I+ ++E  +     ++E+ + E+  NQ+A+ +   IS+LE +F + + Q+ ++A+     +D  +   K   SDV    V Q W  +    EL  +H K++ADYH FYH  +E+  L+  R     + +  +   G+      +  +     ++   L  +  +L  +S ++VP+Y RT  + E G     +  F  G+  L+ +E VTVLDN               S P  + W V+  NG  + +PSI +W+P PD+E   V   ++ +L  TW  L+  LR   ++FY
Sbjct:   29 FGCTQQALARQDKVQQTLLTQIHRLERQIELSSEQLTA-CSTQLEQARSEVGVNQDAIRYLGRISALENVFLEASNQVTEQAISMAQVQDDFVIGGKKMLSDV----VTQSWEWVSKLGELMQLHLKNSADYHSFYHNANELDGLLNSRRANNNQVVGSIPPSGLPASMHRMNTVLSDNLSQFLFLWQRTDDLVSKSHSVVPVYRRTHPV-ESGYPGRNIHRFDDGENVLQDAEEVTVLDN---------------SHP--MTWQVKKSNGTVMQVPSICIWLPPPDTEAVEVSYAVRRKLLNTWAALLSKLRAWIVDFY 325          
BLAST of SMED30009956 vs. Planmine SMEST
Match: SMESG000022272.1 (SMESG000022272.1)

HSP 1 Score: 1293.49 bits (3346), Expect = 0.000e+0
Identity = 695/696 (99.86%), Postives = 695/696 (99.86%), Query Frame = 1
Query: 1390 EIKDMNDLKEEWQSTMDSNLRVVKALGILQEMQYRNQEELKFILEHVEMWKQGTLSASSMKELKKMRHESHSPEFMFSTEPRDYCRXXXXXXXRNDDFTENQNKFTETKLHCEFEASNYNSFDKMYNEMFVSSADIEKNMEFEPYIERTDEVQLYKSRKRLQLKPFWDGSNLKITYFEVSPVVDGYSSSEDEKMELNKESVQLESSMENERDRNDLDSDIEQKQEKEYLSVLDQVKLSGPDLSSKSFIEIKNEELESISSRDLIQKSFERGELPILLKEIYXXXXXXXXXXXXXXXXNIETISIKDFVKETDQRNEISILMTEISSLFSKVSQSNQTDLVERTVSISIKEFVKETNERNEMPILLKEINSILTRSSTGIQTERVRKIETFSIKDFVKETNDRNEMEILLKEINSSLTRATTGVQTERIRKIETLTIKDFVKETKDRNEMEVLLIEINSNLTKMTQGMQTDRIRKIETISIKDFIKETIERNEMPILLTEINSGLMKSTKNIQTDRTKQIEIISIKDMIAEIIERNEMPVLINEINSKLMKFTKKTQTEERKPITFVELKNXXXXXXXXXXXXXXXXXXLNALADIESHYEIKESKEELIERITDNGMLKVILTQLYNNDSKEFEKTVKEIELIKSGTRLERHDKITFENALTEYEGEKPTLKDFGIRSTEKLQLTHSDKFLSTEEM 3477
            EIKDMNDLKEEWQSTMDSNLRVVKALGILQEMQYRNQEELKFILEHVEMWKQGTLSASSMKELKKMRHESHSPEFMFSTEPRDYCRSSSSSSSRNDDFTENQNKFTETKLHCEFEASNYNSFDKMYNEMFVSSADIEKNMEFEPYIERTDEVQLYKSRKRLQLKPFWDGSNLKITYFEVSPVVDGYSSSEDEKMELNKESVQLESSMENERDRNDLDSDIEQKQEKEYLSVLDQVKLSGPDLSSKSFIEIKNEELESISSRDLIQKSFERGELPILLKEIYSLLSRTTTSSQTERLRNIETISIKDFVKETDQRNEISILMTEISSLFSKVSQSNQTDLVERTVSISIKEFVKETNERNEMPILLKEINSILTRSSTGIQTERVRKIETFSIKDFVKETNDRNEMEILLKEINSSLTRATTGVQTERIRKIETLTIKDFVKETKDRNEMEVLLIEINSNLTKMTQGMQTDRIRKIETISIKDFIKETIERNEMPILLTEINSGLMKSTKNIQTDRTKQIEIISIKDMIAEIIERNEMPVLINEINSKLMKFTKKTQTEERKPITFVELKNIIRKTT TITTEEVTNEILNALADIESHYEIKESKEELIERITDNGMLKVILTQLYNNDSKEFEKTVKEIELIKSGTRLERHDKITFENALTEYEGEKPTLKDFGIRSTEKLQLTHSDKFLSTEEM
Sbjct:  426 EIKDMNDLKEEWQSTMDSNLRVVKALGILQEMQYRNQEELKFILEHVEMWKQGTLSASSMKELKKMRHESHSPEFMFSTEPRDYCRSSSSSSSRNDDFTENQNKFTETKLHCEFEASNYNSFDKMYNEMFVSSADIEKNMEFEPYIERTDEVQLYKSRKRLQLKPFWDGSNLKITYFEVSPVVDGYSSSEDEKMELNKESVQLESSMENERDRNDLDSDIEQKQEKEYLSVLDQVKLSGPDLSSKSFIEIKNEELESISSRDLIQKSFERGELPILLKEIYSLLSRTTTSSQTERLRNIETISIKDFVKETDQRNEISILMTEISSLFSKVSQSNQTDLVERTVSISIKEFVKETNERNEMPILLKEINSILTRSSTGIQTERVRKIETFSIKDFVKETNDRNEMEILLKEINSSLTRATTGVQTERIRKIETLTIKDFVKETKDRNEMEVLLIEINSNLTKMTQGMQTDRIRKIETISIKDFIKETIERNEMPILLTEINSGLMKSTKNIQTDRTKQIEIISIKDMIAEIIERNEMPVLINEINSKLMKFTKKTQTEERKPITFVELKNIIRKTTGTITTEEVTNEILNALADIESHYEIKESKEELIERITDNGMLKVILTQLYNNDSKEFEKTVKEIELIKSGTRLERHDKITFENALTEYEGEKPTLKDFGIRSTEKLQLTHSDKFLSTEEM 1121          

HSP 2 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 358/358 (100.00%), Postives = 358/358 (100.00%), Query Frame = 3
Query:   99 MALGDPRIRLNFIQSTIQSIPFSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEITSNHKELFT 1172
            MALGDPRIRLNFIQSTIQSIPFSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNIVEEVEKIKEEINANQEALEFYDSISSLEELFSQVTTQIADRALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEITSNHKELFT
Sbjct:    1 MALGDPRIRLNFIQSTIQSIPFSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNIVEEVEKIKEEINANQEALEFYDSISSLEELFSQVTTQIADRALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEITSNHKELFT 358          

HSP 3 Score: 82.0333 bits (201), Expect = 3.051e-15
Identity = 66/76 (86.84%), Postives = 67/76 (88.16%), Query Frame = 2
Query: 1166 FHKWITTSKXXXXXXXXXXXXXXXXXXXXKRLEEEIKFGEVSESNTGYNLRQQDLVLLDEVMVKFIAIQKIRRPVK 1393
            F KWITTSKSLVTTENSSSTLTNNFLRNLKRLEEEIK        TGYNLRQQDLVLLDEVMVKFIAIQKIRRPV+
Sbjct:  357 FTKWITTSKSLVTTENSSSTLTNNFLRNLKRLEEEIKIK------TGYNLRQQDLVLLDEVMVKFIAIQKIRRPVE 426          
BLAST of SMED30009956 vs. Planmine SMEST
Match: SMESG000022273.1 (SMESG000022273.1)

HSP 1 Score: 534.643 bits (1376), Expect = 1.654e-165
Identity = 319/341 (93.55%), Postives = 330/341 (96.77%), Query Frame = 1
Query: 3757 NIAEESQLETKTLNKKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGTTAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 4779
            ++  E+ +E K+L    +K+  +++EIKTENI LESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISS+EIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF
Sbjct:  888 DVTSETGIEFKSL----VKDSSQHFEIKTENIALESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISSKEIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 1224          

HSP 2 Score: 534.258 bits (1375), Expect = 2.597e-165
Identity = 318/341 (93.26%), Postives = 330/341 (96.77%), Query Frame = 1
Query: 3757 NIAEESQLETKTLNKKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGTTAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 4779
            ++  E+ +E K+L    +K+  +++EIKTENI LESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDE+EFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISS+EIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF
Sbjct:  256 DVTSETGIEFKSL----VKDSSQHFEIKTENIALESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEVEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISSKEIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 592          

HSP 3 Score: 531.946 bits (1369), Expect = 1.782e-164
Identity = 318/341 (93.26%), Postives = 329/341 (96.48%), Query Frame = 1
Query: 3757 NIAEESQLETKTLNKKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGTTAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 4779
            ++  E+ +E K+L    +K+  +++EIKTENI LESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGK HLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISS+EIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF
Sbjct:  572 DVTSETGIEFKSL----VKDSSQHFEIKTENIALESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKIHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISSKEIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 908          

HSP 4 Score: 453.366 bits (1165), Expect = 7.735e-136
Identity = 275/276 (99.64%), Postives = 276/276 (100.00%), Query Frame = 1
Query: 3952 MNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGTTAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 4779
            MNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISS+EIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF
Sbjct:    1 MNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECERTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMISSKEIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQFESKISDVTSETGIEFKSLVKDSSQHF 276          
BLAST of SMED30009956 vs. Planmine SMEST
Match: SMESG000023005.1 (SMESG000023005.1)

HSP 1 Score: 131.339 bits (329), Expect = 4.676e-30
Identity = 103/369 (27.91%), Postives = 186/369 (50.41%), Query Frame = 3
Query:  117 RIRLNFIQSTIQSIPFSSCHSALILENSRQAALKTELEEIENFIKTTNESNSLNXXXXXXXXXXXXNANQEALEFYDSISSLEELFSQVTTQIADRALKDSLMSTTKDFESDVSVPK-----VKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEITSNHKELFTNGLL-LQKVSLL 1205
            R RL   +   Q++ F     +L +E  RQ  +  EL E+EN +K  ++  +     ++  IK+E+ +   +L++   IS+LE L+S++T  I   AL  S+    ++F  ++ V K     V  CWN I   + L+ +H ++A+ YHQF+H+ +EI  L+++RW++ +  I     KG +K++ ++    K   +    L  +I NL+  S  IVPI+LR   +++       L  +   ++ +   E V +L+N               S P  + W ++   G+   IPS+ +WIPGPD  +S     L+ QL+  WE+ +     V I+ Y  LF ++ ++  I+ +  + F N L  +Q+V L+
Sbjct:   11 RNRLADCKDRSQNLHFGVSSKSLKVEEHRQQLILQELRELENNLKYKDDRTN-RTAAQILDIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSV---NQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNN---------------SNP--LTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLM 358          
BLAST of SMED30009956 vs. Planmine SMEST
Match: SMESG000056318.1 (SMESG000056318.1)

HSP 1 Score: 130.568 bits (327), Expect = 6.755e-30
Identity = 124/351 (35.33%), Postives = 200/351 (56.98%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMID------C------WSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D      C      WS + GK+ E       +      V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:  261 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSV-----VVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 603          

HSP 2 Score: 126.331 bits (316), Expect = 1.393e-28
Identity = 122/351 (34.76%), Postives = 199/351 (56.70%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMID------C------WSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  K ++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D      C      WS + GK+ E       +      V+CSSEY I++ +SQ++++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct: 1182 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKYSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSV-----VVECSSEYTIRMEDSQIDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 1524          

HSP 3 Score: 125.561 bits (314), Expect = 2.290e-28
Identity = 125/346 (36.13%), Postives = 202/346 (58.38%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct: 1506 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 1848          

HSP 4 Score: 121.324 bits (303), Expect = 4.681e-27
Identity = 118/346 (34.10%), Postives = 187/346 (54.05%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  +E  DE +                               E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:  585 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMT--VEATDEES-------------------------------ERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 895          

HSP 5 Score: 110.538 bits (275), Expect = 8.599e-24
Identity = 114/345 (33.04%), Postives = 192/345 (55.65%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGTTAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T+     +++++ +                   ++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:  877 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEILAQK------------------IEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 1200          

HSP 6 Score: 92.8189 bits (229), Expect = 2.208e-18
Identity = 101/282 (35.82%), Postives = 164/282 (58.16%), Query Frame = 1
Query: 3952 MNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 279          
BLAST of SMED30009956 vs. Planmine SMEST
Match: SMESG000056318.1 (SMESG000056318.1)

HSP 1 Score: 130.568 bits (327), Expect = 6.939e-30
Identity = 124/351 (35.33%), Postives = 200/351 (56.98%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMID------C------WSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D      C      WS + GK+ E       +      V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:  261 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSV-----VVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 603          

HSP 2 Score: 126.331 bits (316), Expect = 1.360e-28
Identity = 121/346 (34.97%), Postives = 196/346 (56.65%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+                    T+  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:  585 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFEL-----------------SCCTATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 911          

HSP 3 Score: 126.331 bits (316), Expect = 1.431e-28
Identity = 122/351 (34.76%), Postives = 199/351 (56.70%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMID------C------WSFLDGKXXXXXXXXXXXXXXXKTVDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  K ++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D      C      WS + GK+ E       +      V+CSSEY I++ +SQ++++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct: 1198 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKYSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSV-----VVECSSEYTIRMEDSQIDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 1540          

HSP 4 Score: 125.561 bits (314), Expect = 2.393e-28
Identity = 125/346 (36.13%), Postives = 202/346 (58.38%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct: 1522 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 1864          

HSP 5 Score: 110.538 bits (275), Expect = 8.981e-24
Identity = 114/345 (33.04%), Postives = 192/345 (55.65%), Query Frame = 1
Query: 3781 ETKTLN-------KKQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIEMNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGTTAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            ETKT N       K  +KE     EIK+ENI  E+ + EL  TSLE +++  +K ++++A+ I+M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T+     +++++ +                   ++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:  893 ETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEILAQK------------------IEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 1216          

HSP 6 Score: 92.8189 bits (229), Expect = 2.305e-18
Identity = 101/282 (35.82%), Postives = 164/282 (58.16%), Query Frame = 1
Query: 3952 MNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVNVLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKXXXXXXXXXXXXXXXKT-------VDCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNESIASETVVKNIGT-TAKCSLIDMISSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATS--EIKSCSIDIQF-ESKISDVTSETGIEFKSLVKD 4764
            M+SE  KD++  ++ F   KD +D S   +S +IEVGTE +GEKH V ++ LTS+E +     TLT+F  E +D  S  + KS EE  S V  ++   +       V+CSSEY I++ +SQV+++    E+ + T  ++ +DES+  E+         T  + EEI+ K +  E++E + I+NES++ E  + +I T TAK +L D+ +   I++ E S E      +ES++FETE+      + +S  +IK CS++IQF E+K  ++  ETG E KS +K+
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSC-CTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNI--ETGYEIKSTMKE 279          
The following BLAST results are available for this feature:
BLAST of SMED30009956 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shot8.472e-1525.68gene:FBgn0013733 transcript:FBtr0087621[more]
shot9.857e-1525.68gene:FBgn0013733 transcript:FBtr0273225[more]
shot9.939e-1525.00gene:FBgn0013733 transcript:FBtr0273226[more]
shot1.003e-1425.68gene:FBgn0013733 transcript:FBtr0087619[more]
shot1.007e-1425.00gene:FBgn0013733 transcript:FBtr0301964[more]
back to top
BLAST of SMED30009956 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182638773.760e-2227.19tr|A0A267GZ50|A0A267GZ50_9PLAT SH3_10 domain-conta... [more]
gnl|BL_ORD_ID|183074374.646e-2227.19tr|A0A1I8I886|A0A1I8I886_9PLAT RNase H domain-cont... [more]
gnl|BL_ORD_ID|182432723.308e-2126.05tr|A0A267GQQ9|A0A267GQQ9_9PLAT SH3_10 domain-conta... [more]
gnl|BL_ORD_ID|182583954.644e-2127.19tr|A0A267FZT9|A0A267FZT9_9PLAT SH3_10 domain-conta... [more]
gnl|BL_ORD_ID|182776054.934e-2127.19tr|A0A267FZL1|A0A267FZL1_9PLAT SH3_10 domain-conta... [more]
back to top
BLAST of SMED30009956 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009956 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022272.13.051e-1599.86SMESG000022272.1[more]
SMESG000022273.11.654e-16593.55SMESG000022273.1[more]
SMESG000023005.14.676e-3027.91SMESG000023005.1[more]
SMESG000056318.16.755e-3035.33SMESG000056318.1[more]
SMESG000056318.16.939e-3035.33SMESG000056318.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009956 ID=SMED30009956|Name=SMED30009956|organism=Schmidtea mediterranea sexual|type=transcript|length=4780bp
ACTAATTTCATTATTTAAAACTTTGGATTTTTATTATTTGTTATCAATTA
CGATTTTTCTAAGATAAATATAGTGTTGAATTGAGTTTATTTGCAAAAAT
GGCTCTCGGGGATCCTCGCATCCGATTGAATTTTATTCAATCAACCATCC
AATCTATACCGTTTTCCTCTTGTCACAGTGCCTTAATATTAGAAAATAGT
AGACAAGCAGCACTGAAAACCGAGTTAGAGGAAATTGAAAATTTTATCAA
AACAACTAACGAGTCTAACTCATTAAATATTGTGGAAGAAGTGGAAAAAA
TAAAAGAAGAAATCAATGCTAATCAAGAAGCTCTAGAATTTTATGATTCA
ATTTCATCTTTGGAAGAACTTTTTTCACAAGTTACCACACAAATTGCAGA
CAGGGCTCTGAAAGATTCATTGATGTCTACAACAAAAGATTTCGAGTCCG
ATGTATCCGTCCCTAAAGTTAAACAATGTTGGAATAGAATTCTACACTAT
TCAGAATTGACATCTATTCACACAAAAGATGCTGCTGATTATCATCAATT
CTATCATGAATGCTCCGAAATACGACGACTGATTGAAAGGCGATGGCAAC
TGACAACAAAATCAATTAATCAACTAAACATCAAAGGTGTCATGAAGGAT
GCTAAAGAAATTATAAAAATCACAAAAGGAACGACAAACGAGCTTCATAG
TTTGGCCGATCAAATAATGAATCTCAAACGACGATCAGCAAACATTGTCC
CAATTTATCTGCGAACCAGTTCAATCGCCGAACAGGGTAAAAAAGCATTT
CTGTTGGCAGATTTCAAAATCGGAGATTTGCAATTGAAAAAATCTGAACA
CGTAACCGTTTTGGACAACTGGGGTAAAGATGGATCAACCAATAGCGATT
CTAATATTTCCGGCTCAATTCCAAGTCGAATCAACTGGTTGGTTGAAACT
AGAAACGGGGATAAATTACTAATTCCATCTATTGCTCTATGGATTCCTGG
ACCCGATTCAGAAACAAGTCTAGTATTGAATGAATTACAAAATCAACTAT
CGGCCACCTGGGAAGAACTTATTCAAATGTTACGAGAAGTTAACATAAAT
TTCTATCAGCGGTTATTTGGTAAAATATTTTCCAAATCTGAAATTACATC
CAACCACAAAGAGCTTTTCACAAATGGATTACTACTTCAAAAAGTCTCGT
TACTACAGAAAATTCCAGTTCAACATTGACGAACAACTTCTTGCGTAACT
TAAAAAGACTTGAAGAGGAGATAAAGTTTGGCGAAGTTTCAGAATCAAAT
ACAGGCTACAATTTAAGACAACAAGACTTAGTTTTGCTCGACGAGGTTAT
GGTCAAATTTATAGCAATACAGAAGATCCGCCGGCCAGTGAAATAAAGGA
TATGAATGATTTGAAAGAGGAATGGCAATCAACAATGGATTCCAATTTAA
GGGTAGTAAAAGCTTTGGGAATTTTACAAGAAATGCAATATAGAAATCAA
GAAGAATTGAAATTCATTTTGGAACATGTCGAAATGTGGAAACAAGGAAC
GCTAAGTGCATCAAGCATGAAAGAATTGAAAAAAATGAGACATGAATCAC
ATTCACCAGAGTTTATGTTTTCAACTGAACCCAGAGATTACTGTCGATCT
TCTTCATCTTCATCGTCTAGAAATGATGATTTTACTGAAAATCAAAATAA
ATTTACTGAAACGAAACTTCACTGTGAATTTGAAGCTAGCAATTACAATT
CATTCGATAAAATGTATAATGAAATGTTTGTGTCAAGTGCAGATATTGAA
AAAAACATGGAGTTTGAACCATATATAGAAAGGACAGATGAGGTGCAATT
GTACAAATCCAGAAAACGATTACAGCTAAAACCATTTTGGGATGGCAGTA
ATCTTAAAATTACCTATTTTGAAGTTTCACCAGTAGTTGACGGTTACTCT
TCATCTGAAGATGAAAAAATGGAACTAAATAAGGAAAGTGTTCAGCTTGA
AAGTTCTATGGAAAATGAAAGAGATCGAAATGATTTGGATTCAGATATTG
AGCAAAAACAAGAAAAGGAATATTTAAGTGTATTAGATCAAGTTAAATTG
AGTGGTCCAGATTTATCATCAAAAAGTTTCATTGAGATCAAAAACGAAGA
ATTAGAAAGCATATCATCCAGAGATTTAATACAAAAGAGTTTTGAAAGAG
GTGAGTTACCAATATTATTAAAAGAAATATATTCTTTGCTGTCGAGAACT
ACAACTTCAAGTCAGACAGAAAGATTAAGAAATATTGAAACTATTTCCAT
TAAAGATTTTGTTAAAGAAACTGATCAAAGAAATGAAATATCTATTCTAA
TGACAGAAATCAGTTCTCTTTTTTCCAAAGTCTCTCAATCGAATCAAACA
GATTTAGTTGAGAGAACCGTAAGCATTTCCATAAAAGAATTTGTGAAAGA
AACTAATGAAAGAAATGAAATGCCAATTCTATTAAAAGAAATAAATTCGA
TTTTGACAAGATCGTCAACTGGAATTCAAACGGAAAGAGTAAGAAAAATA
GAAACATTTTCTATAAAAGATTTCGTCAAAGAAACGAACGATAGAAATGA
AATGGAAATATTATTAAAGGAAATAAATTCAAGTTTGACAAGAGCAACAA
CAGGAGTTCAGACTGAAAGAATTAGAAAAATAGAAACATTAACCATAAAG
GATTTCGTCAAGGAAACTAAAGACAGAAATGAAATGGAAGTTTTATTAAT
CGAAATAAACTCAAACTTAACAAAAATGACACAAGGAATGCAAACTGATA
GAATTAGAAAAATTGAAACAATTTCAATCAAAGATTTCATCAAAGAAACA
ATTGAAAGAAATGAAATGCCAATATTACTGACCGAAATAAATAGCGGTCT
AATGAAGTCCACAAAAAATATTCAAACAGATCGAACGAAGCAGATAGAAA
TTATTTCCATTAAAGATATGATCGCAGAAATCATAGAAAGAAACGAAATG
CCCGTGCTAATAAATGAAATAAATTCAAAACTGATGAAATTTACTAAAAA
GACACAAACAGAAGAAAGAAAACCAATAACATTTGTGGAGTTAAAAAATA
TCATAAGAAAAACAACAGAAACAATAACAACAGAAGAAGTAACAAATGAA
ATATTAAATGCACTAGCAGATATAGAAAGCCATTATGAAATCAAAGAGAG
CAAGGAAGAACTGATAGAAAGAATCACAGACAATGGAATGTTAAAAGTAA
TTCTGACACAACTATATAATAACGATTCAAAAGAATTCGAGAAAACTGTT
AAAGAAATAGAATTAATTAAGAGCGGAACACGCTTGGAAAGGCATGATAA
AATTACATTTGAAAATGCACTTACAGAATATGAAGGAGAAAAACCAACAT
TAAAAGATTTTGGAATTCGGAGCACTGAGAAACTACAGCTTACACATAGC
GATAAGTTCCTCTCAACCGAAGAAATGGATCTCAAAGAAGCAGAAATCTC
TAGAATTGAAACTTCTTTGGTAATGAAGGAAGTTAAAGTAACAAAATTAA
AAGATCTCCAAACCATATCAAAATCACCGAAATACAGTAATAAATGTACA
GAATATGCAGTCGAATTGAAAGATATTTACCAAGATAATATCAGCATTAT
TGATGATAACAATGACTTTGAAAAAGAATATAAAATTGATCGATTAGATG
CGGGAAAAGAATTTATTGAAACCAGAAAGAAAGCAAGCATAAACAAACAA
AGTCAAAACATTGCCGAAGAAAGTCAGTTAGAAACGAAAACATTAAACAA
AAAGCAATTGAAAGAAATTCGAGAAAATTATGAGATTAAAACTGAAAACA
TTGTACTGGAATCTAATATACCAGAGTTGATTGATACAAGTTTGGAATAC
GAGACAAGAAATAGAGATAAATCCAGCGAGTTCCGAGCAGACGTCATTGA
GATGAATAGCGAATTTTCCAAAGACACTCAAACAGATGAGATAGAATTTG
GAGTCGAAAAAGACATTTTAGATGATAGTAAATACGGCAAGAGTCACCTA
ATAGAAGTCGGAACCGAAATATATGGAGAAAAGCACGAAGTGTTAGTGAA
TGTTTTAACGAGCTATGAAGCGAAATCAAATGTTGTCAACACATTGACGG
ATTTTAAGAATGAAATGATAGACTGTTGGAGTTTCTTAGATGGAAAATCC
GATGAAGAAGAATTGTCAGAAGTGGAAATTGAAAGCACAAGTAAAACCGT
AGACTGTTCTAGTGAATATAAAATAAAACTGGTTGAAAGTCAAGTTAATG
AATCAAAGGCATATTTTGAAATCAGTATGGAGACTTCATTTATTGAAGTT
GTCGATGAATCAACAAGTTGTGAAGTAGATTGGAAATCAATTGAATGTGA
AAGAACAGAAACGGTAGAAGAAGAAATAATTAAAAAGACTAGTGAATCAG
AAAAGACTGAGGCGATAACGATAGATAATGAGAGCATAGCCAGTGAAACT
GTAGTGAAAAATATTGGTACAACAGCAAAATGTTCTCTGATTGACATGAT
TTCTAGTAGAGAAATAGATTATTGTGAGGTTAGTTACGAAACTGAATACA
GACAATTATATGAAAGTAAATTATTTGAAACGGAACAGAGAAAACTCAAG
GCAATGGTAGCGACATCTGAAATAAAATCTTGTTCTATTGACATCCAATT
CGAAAGTAAAATATCTGACGTTACATCTGAAACGGGAATCGAGTTCAAAT
CATTGGTGAAAGATTCATCCCAACATTTTG
back to top

protein sequence of SMED30009956-orf-1

>SMED30009956-orf-1 ID=SMED30009956-orf-1|Name=SMED30009956-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1126bp
MNDLKEEWQSTMDSNLRVVKALGILQEMQYRNQEELKFILEHVEMWKQGT
LSASSMKELKKMRHESHSPEFMFSTEPRDYCRSSSSSSSRNDDFTENQNK
FTETKLHCEFEASNYNSFDKMYNEMFVSSADIEKNMEFEPYIERTDEVQL
YKSRKRLQLKPFWDGSNLKITYFEVSPVVDGYSSSEDEKMELNKESVQLE
SSMENERDRNDLDSDIEQKQEKEYLSVLDQVKLSGPDLSSKSFIEIKNEE
LESISSRDLIQKSFERGELPILLKEIYSLLSRTTTSSQTERLRNIETISI
KDFVKETDQRNEISILMTEISSLFSKVSQSNQTDLVERTVSISIKEFVKE
TNERNEMPILLKEINSILTRSSTGIQTERVRKIETFSIKDFVKETNDRNE
MEILLKEINSSLTRATTGVQTERIRKIETLTIKDFVKETKDRNEMEVLLI
EINSNLTKMTQGMQTDRIRKIETISIKDFIKETIERNEMPILLTEINSGL
MKSTKNIQTDRTKQIEIISIKDMIAEIIERNEMPVLINEINSKLMKFTKK
TQTEERKPITFVELKNIIRKTTETITTEEVTNEILNALADIESHYEIKES
KEELIERITDNGMLKVILTQLYNNDSKEFEKTVKEIELIKSGTRLERHDK
ITFENALTEYEGEKPTLKDFGIRSTEKLQLTHSDKFLSTEEMDLKEAEIS
RIETSLVMKEVKVTKLKDLQTISKSPKYSNKCTEYAVELKDIYQDNISII
DDNNDFEKEYKIDRLDAGKEFIETRKKASINKQSQNIAEESQLETKTLNK
KQLKEIRENYEIKTENIVLESNIPELIDTSLEYETRNRDKSSEFRADVIE
MNSEFSKDTQTDEIEFGVEKDILDDSKYGKSHLIEVGTEIYGEKHEVLVN
VLTSYEAKSNVVNTLTDFKNEMIDCWSFLDGKSDEEELSEVEIESTSKTV
DCSSEYKIKLVESQVNESKAYFEISMETSFIEVVDESTSCEVDWKSIECE
RTETVEEEIIKKTSESEKTEAITIDNESIASETVVKNIGTTAKCSLIDMI
SSREIDYCEVSYETEYRQLYESKLFETEQRKLKAMVATSEIKSCSIDIQF
ESKISDVTSETGIEFKSLVKDSSQHF
back to top

protein sequence of SMED30009956-orf-2

>SMED30009956-orf-2 ID=SMED30009956-orf-2|Name=SMED30009956-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=377bp
MALGDPRIRLNFIQSTIQSIPFSSCHSALILENSRQAALKTELEEIENFI
KTTNESNSLNIVEEVEKIKEEINANQEALEFYDSISSLEELFSQVTTQIA
DRALKDSLMSTTKDFESDVSVPKVKQCWNRILHYSELTSIHTKDAADYHQ
FYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELH
SLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSE
HVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIP
GPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEIT
SNHKELFTNGLLLQKVSLLQKIPVQH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003447FEMABX
Vocabulary: molecular function
TermDefinition
GO:0016755transferase activity, transferring amino-acyl groups
Vocabulary: biological process
TermDefinition
GO:0009252peptidoglycan biosynthetic process