PBPe domain-containing protein

Overview
NamePBPe domain-containing protein
Smed IDSMED30009951
Length (bp)621
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009951

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009951 SmedASXL_002312SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30009951SMESG000069032.1 Contig52440newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009951SMESG000069032.1 Contig52440uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRID1 (glutamate ionotropic receptor delta type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4575])

HSP 1 Score: 60.4622 bits (145), Expect = 3.545e-10
Identity = 45/177 (25.42%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   ++L  L+  + FK  +Y+A D  +G ++ N+S   + G IG++ + ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P  +  W  I   + +  V+ ++ +    + A +   P        L    W + G+F+ QG +    SM+ R V+ 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS---WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS--VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSMAMRIVMG 635          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRID1 (glutamate ionotropic receptor delta type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4575])

HSP 1 Score: 60.077 bits (144), Expect = 3.984e-10
Identity = 45/177 (25.42%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   ++L  L+  + FK  +Y+A D  +G ++ N+S   + G IG++ + ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P  +  W  I   + +  V+ ++ +    + A +   P        L    W + G+F+ QG +    SM+ R V+ 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS---WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS--VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSMAMRIVMG 635          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 53.1434 bits (126), Expect = 1.077e-7
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF-RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLN-----LPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   +ML+ L+  ++F+  L   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM        +        +  F  P     W  ++L  +  S + +L +  SP   +N +      P  + ++  L    W  +G F+ QG +  P ++S R V
Sbjct:  441 ERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCV 620          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 52.7582 bits (125), Expect = 1.311e-7
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF-RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLN-----LPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   +ML+ L+  ++F+  L   ED L+GA      N S+TG +G++ N K+    + FT   +R+  +DFS  FM        +        +  F  P     W  ++L  +  S + +L +  SP   +N +      P  + ++  L    W  +G F+ QG +  P ++S R V
Sbjct:  441 ERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGA---PEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCV 620          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 52.7582 bits (125), Expect = 1.311e-7
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF-RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLN-----LPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   +ML+ L+  ++F+  L   ED L+GA      N S+TG +G++ N K+    + FT   +R+  +DFS  FM        +        +  F  P     W  ++L  +  S + +L +  SP   +N +      P  + ++  L    W  +G F+ QG +  P ++S R V
Sbjct:  441 ERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGA---PEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCV 620          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 61.2326 bits (147), Expect = 6.700e-11
Identity = 50/181 (27.62%), Postives = 88/181 (48.62%), Query Frame = 1
Query:   82 KTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF---RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLP----FSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSAR 603
            K  G   ++LK+L+ K++     +  E KL        ++ S+ G IG++ +G++    +  T N +R+  VDFS  FM  +   S+   KP+ + + +F   +PL    W  II   +  SV+ +L S +SP   W +       F+I ++  +    W  + +F+ QG D  P S+S R
Sbjct:  491 KFEGFCIDLLKLLADKIE----EFNYEIKLGTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFM--TTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYE-WRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGR 664          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 52.7582 bits (125), Expect = 4.664e-8
Identity = 44/179 (24.58%), Postives = 80/179 (44.69%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASL-QFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIR---LREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   +++ ++ V++ F   +YE ED  +G    N +   + G IG + +G +    +  +   +R+  VDF+V + D      L +    E  ++   + L W  W  I+   +  S++ ++F  +SP S  N    +    E R   L+E  W  + S   QG    P ++S R V A
Sbjct:  183 GYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGN---WNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAA 358          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 52.7582 bits (125), Expect = 5.586e-8
Identity = 44/179 (24.58%), Postives = 80/179 (44.69%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASL-QFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIR---LREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   +++ ++ V++ F   +YE ED  +G    N +   + G IG + +G +    +  +   +R+  VDF+V + D      L +    E  ++   + L W  W  I+   +  S++ ++F  +SP S  N    +    E R   L+E  W  + S   QG    P ++S R V A
Sbjct:  378 GYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGN---WNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAA 553          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 52.373 bits (124), Expect = 6.270e-8
Identity = 44/179 (24.58%), Postives = 80/179 (44.69%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASL-QFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIR---LREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   +++ ++ V++ F   +YE ED  +G    N +   + G IG + +G +    +  +   +R+  VDF+V + D      L +    E  ++   + L W  W  I+   +  S++ ++F  +SP S  N    +    E R   L+E  W  + S   QG    P ++S R V A
Sbjct:  397 GYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGN---WNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAA 572          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 51.6026 bits (122), Expect = 1.199e-7
Identity = 45/177 (25.42%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQ-FKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF---RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN--LNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSAR 603
            G   ++L +L+  +  F+  ++ ++   +G+R    ++ S+ G IG + N  +    +  T   +R+  VDFS  FM  +   S+   KPE + ++IF    PL  T W   +      S+  +L S++SP           F++ +E  L    W  + +F+ QG D  P ++S R
Sbjct:  451 GYCIDLLNLLAKNITGFEYDVFISDGNKYGSR---QADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFM--TTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGR 622          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0089102)

HSP 1 Score: 58.5362 bits (140), Expect = 7.055e-10
Identity = 47/184 (25.54%), Postives = 84/184 (45.65%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPES---RIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNL----PFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++L+ +S ++ F  +L    D+ +GA  K+     + G +  +   K+       T  Y R+  +DF+  FM+     S+ F  P S   R++    PL    W  +++   + S+  Y+    SP+    +N       SI ++  L + FW  IG+F+ Q  D YP +MS R +
Sbjct:  428 ERFYGFCVDILETISREVGFDYILDLVPDRKYGA--KDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLG--ISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRII 607          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 58.5362 bits (140), Expect = 7.342e-10
Identity = 47/184 (25.54%), Postives = 84/184 (45.65%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPES---RIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNL----PFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++L+ +S ++ F  +L    D+ +GA  K+     + G +  +   K+       T  Y R+  +DF+  FM+     S+ F  P S   R++    PL    W  +++   + S+  Y+    SP+    +N       SI ++  L + FW  IG+F+ Q  D YP +MS R +
Sbjct:  428 ERFYGFCVDILETISREVGFDYILDLVPDRKYGA--KDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLG--ISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRII 607          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 54.299 bits (129), Expect = 1.753e-8
Identity = 48/184 (26.09%), Postives = 85/184 (46.20%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPES---RIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNL----PFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++L+ +S ++ F  +L    D+ +GA  K+     + G +  +     L   S+ T  Y R+  +DF+  FM+     S+ F  P S   R++    PL    W  +++   + S+  Y+    SP+    +N       SI ++  L + FW  IG+F+ Q  D YP +MS R +
Sbjct:  428 ERFYGFCVDILETISREVGFDYILDLVPDRKYGA--KDPETGEWNGMVAQLMKYADLAVGSM-TITYARESVIDFTKPFMNLG--ISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRII 606          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 50.447 bits (119), Expect = 3.362e-7
Identity = 41/180 (22.78%), Postives = 81/180 (45.00%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPES---RIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIID----EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   ++LK ++ ++ F+  +    D ++G  I  ++  S+ G + ++   ++    +  T NY R+  +DF+  FM+      + F  P S   R++    PL    W  ++   ++ S   ++ + +SP    N +  +   D    +  +   FW I G+FL QG    P + S R V
Sbjct:  454 GFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETN--SWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLG--IGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIV 629          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 50.447 bits (119), Expect = 3.362e-7
Identity = 41/180 (22.78%), Postives = 81/180 (45.00%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPES---RIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIID----EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   ++LK ++ ++ F+  +    D ++G  I  ++  S+ G + ++   ++    +  T NY R+  +DF+  FM+      + F  P S   R++    PL    W  ++   ++ S   ++ + +SP    N +  +   D    +  +   FW I G+FL QG    P + S R V
Sbjct:  454 GFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETN--SWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLG--IGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIV 629          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grid1b (glutamate receptor, ionotropic, delta 1b [Source:ZFIN;Acc:ZDB-GENE-121214-84])

HSP 1 Score: 56.6102 bits (135), Expect = 3.685e-9
Identity = 48/184 (26.09%), Postives = 88/184 (47.83%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN---LNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            ++  G   ++L+ L+  + FK  +Y+  D  +G+++   SN S+ G IG++ N ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P     W  I   + +  V+ +L +    L + N    +   S+ +   L    W + G+F+ QG D    S++ R V+ 
Sbjct:  462 KRYKGFSIDVLEALAKILGFKYDIYQVADSKYGSQL---SNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYS--VGILHRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQNPPGAHHASSMSNS--LHSAIWIVYGAFVQQGGDSVVGSVALRIVMG 638          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 54.6842 bits (130), Expect = 1.733e-8
Identity = 48/187 (25.67%), Postives = 81/187 (43.32%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR---IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNL-------PFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++   ++    FK  L    D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     ++    PL +  W  I+   +  SV+ +L S +SP   W+          P    +E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  433 ERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGAR--DAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 614          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 54.6842 bits (130), Expect = 1.896e-8
Identity = 48/187 (25.67%), Postives = 81/187 (43.32%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR---IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNL-------PFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++   ++    FK  L    D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     ++    PL +  W  I+   +  SV+ +L S +SP   W+          P    +E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  437 ERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGAR--DAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 618          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 54.6842 bits (130), Expect = 1.896e-8
Identity = 48/187 (25.67%), Postives = 81/187 (43.32%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR---IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNL-------PFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++   ++    FK  L    D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     ++    PL +  W  I+   +  SV+ +L S +SP   W+          P    +E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  437 ERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGAR--DAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 618          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grid1b (glutamate receptor, ionotropic, delta 1b [Source:ZFIN;Acc:ZDB-GENE-121214-84])

HSP 1 Score: 53.1434 bits (126), Expect = 2.607e-8
Identity = 44/169 (26.04%), Postives = 81/169 (47.93%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN---LNLPFSIIDEIRLREHFWNIIGSFLMQG 570
            ++  G   ++L+ L+  + FK  +Y+  D  +G+++   SN S+ G IG++ N ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P     W  I   + +  V+ +L +    L + N    +   S+ +   L    W + G+F+ QG
Sbjct:   28 KRYKGFSIDVLEALAKILGFKYDIYQVADSKYGSQL---SNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYS--VGILHRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQNPPGAHHASSMSNS--LHSAIWIVYGAFVQQG 189          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 55.0694 bits (131), Expect = 2.192e-8
Identity = 48/184 (26.09%), Postives = 83/184 (45.11%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN----LNLPFSIID-EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            ++  G   EML  L+  ++F   +   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  + +   +    P     W  ++L  +  S + +L +  SP   +N    L     I++ +  L    W  +G F+ QG +  P ++S R V
Sbjct:  391 DQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGR-KPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCV 570          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 53.9138 bits (128), Expect = 5.160e-8
Identity = 48/184 (26.09%), Postives = 83/184 (45.11%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN----LNLPFSIID-EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            ++  G   EML  L+  ++F   +   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  + +   +    P     W  ++L  +  S + +L +  SP   +N    L     I++ +  L    W  +G F+ QG +  P ++S R V
Sbjct:  156 DQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGR-KPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCV 335          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 51.9878 bits (123), Expect = 1.903e-7
Identity = 48/180 (26.67%), Postives = 80/180 (44.44%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN----LNLPFSIID-EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   EML  L+  ++F   +   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  +     +    P     W  ++L  +  S + +L +  SP   +N    L     I++ +  L    W  +G F+ QG +  P ++S R V
Sbjct:  439 GFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPG-YFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCV 614          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 51.9878 bits (123), Expect = 2.210e-7
Identity = 48/180 (26.67%), Postives = 80/180 (44.44%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN----LNLPFSIID-EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   EML  L+  ++F   +   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  +     +    P     W  ++L  +  S + +L +  SP   +N    L     I++ +  L    W  +G F+ QG +  P ++S R V
Sbjct:  441 GFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPG-YFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCV 616          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 51.9878 bits (123), Expect = 2.258e-7
Identity = 48/180 (26.67%), Postives = 80/180 (44.44%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWN----LNLPFSIID-EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   EML  L+  ++F   +   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  +     +    P     W  ++L  +  S + +L +  SP   +N    L     I++ +  L    W  +G F+ QG +  P ++S R V
Sbjct:  441 GFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPG-YFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCV 616          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grid1 (glutamate receptor, ionotropic, delta 1 [Source:MGI Symbol;Acc:MGI:95812])

HSP 1 Score: 57.3806 bits (137), Expect = 2.520e-9
Identity = 43/177 (24.29%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   ++L  L+  + FK  +Y+A D  +G ++ N+S   + G IG++ + ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P  +  W  I   + +  V+ ++ +    + + +   P        L    W + G+F+ QG +    S++ R V+ 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS---WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS--VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSVAMRIVMG 635          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik5 (glutamate receptor, ionotropic, kainate 5 (gamma 2) [Source:MGI Symbol;Acc:MGI:95818])

HSP 1 Score: 52.7582 bits (125), Expect = 9.168e-8
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF-RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLN-----LPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   +ML+ L+  ++F+  L   ED L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM        +        +  F  P     W  ++L  +  S + +L +  SP   +N +      P  + ++  L    W  +G F+ QG +  P ++S R V
Sbjct:  441 ERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCV 620          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 50.447 bits (119), Expect = 5.962e-7
Identity = 44/160 (27.50%), Postives = 71/160 (44.38%), Query Frame = 1
Query:  163 DKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFR---PLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIID--------EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     +F    PL +  W  I+   +  SV+ +L S +SP   W+   P    +        E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  469 DGKYGAR--DADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 623          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 50.447 bits (119), Expect = 5.962e-7
Identity = 44/160 (27.50%), Postives = 71/160 (44.38%), Query Frame = 1
Query:  163 DKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFR---PLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIID--------EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     +F    PL +  W  I+   +  SV+ +L S +SP   W+   P    +        E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  469 DGKYGAR--DADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 623          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 50.0618 bits (118), Expect = 6.304e-7
Identity = 44/160 (27.50%), Postives = 71/160 (44.38%), Query Frame = 1
Query:  163 DKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFR---PLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIID--------EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     +F    PL +  W  I+   +  SV+ +L S +SP   W+   P    +        E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  469 DGKYGAR--DADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 623          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P26591|GLRK_LYMST (Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.516e-10
Identity = 49/182 (26.92%), Postives = 87/182 (47.80%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF---RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFS--IIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E   G   ++ K ++ K+ F  ++   +D  +G+ +   SN ++ G +G++   ++    + FT   DR   +DF+  FM  S   S+   +P+    H F    PL    W  I+   +  SV+ +L S +SP + W+L+      I ++  +    W  +G+F+ QG D  P SMS R V
Sbjct:  454 EPVEGFCIDLTKAVAEKVGFDFVIQFVKDGSYGSVL---SNGTWDGIVGELIRHEADMAIAPFTITADRSRVIDFTKPFM--SLGISIMIKRPQPAGKHFFSFMEPLSSEIWMCIVFAYIGVSVVLFLVSRFSP-NEWHLSEAHHSYIANDFSISNSLWFSLGAFMQQGCDISPRSMSGRIV 629          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P34299|GLR1_CAEEL (Glutamate receptor 1 OS=Caenorhabditis elegans OX=6239 GN=glr-1 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 8.522e-10
Identity = 50/181 (27.62%), Postives = 88/181 (48.62%), Query Frame = 1
Query:   82 KTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIF---RPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLP----FSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSAR 603
            K  G   ++LK+L+ K++     +  E KL        ++ S+ G IG++ +G++    +  T N +R+  VDFS  FM  +   S+   KP+ + + +F   +PL    W  II   +  SV+ +L S +SP   W +       F+I ++  +    W  + +F+ QG D  P S+S R
Sbjct:  491 KFEGFCIDLLKLLADKIE----EFNYEIKLGTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFM--TTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYE-WRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGR 664          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ULK0|GRID1_HUMAN (Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1 PE=2 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 1.913e-9
Identity = 45/177 (25.42%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   ++L  L+  + FK  +Y+A D  +G ++ N+S   + G IG++ + ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P  +  W  I   + +  V+ ++ +    + A +   P        L    W + G+F+ QG +    SM+ R V+ 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS---WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS--VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSMAMRIVMG 635          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q62640|GRID1_RAT (Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus OX=10116 GN=Grid1 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.682e-8
Identity = 43/177 (24.29%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   ++L  L+  + FK  +Y+A D  +G ++ N+S   + G IG++ + ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P  +  W  I   + +  V+ ++ +    + + +   P        L    W + G+F+ QG +    S++ R V+ 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS---WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS--VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSVAMRIVMG 635          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61627|GRID1_MOUSE (Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 1.763e-8
Identity = 43/177 (24.29%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            G   ++L  L+  + FK  +Y+A D  +G ++ N+S   + G IG++ + ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P  +  W  I   + +  V+ ++ +    + + +   P        L    W + G+F+ QG +    S++ R V+ 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS---WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS--VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSVAMRIVMG 635          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8HAM9 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.454e-36
Identity = 69/190 (36.32%), Postives = 113/190 (59.47%), Query Frame = 1
Query:   49 FLENGTYLPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLAF 618
            F E GT L      G++ ++L IL+ ++ F+  +   +D  WG      S   F+GC+G++  G    G S FT +  R   VDFS     E+    +    PES++W+++ P  +  W L+I+ + +++ + ++ +Y+SP +A+NL L F+  DEI L+E+ W+I+GSF+ QGQDFYP++MS R VLAF
Sbjct:  949 FREKGTVL----VGGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGRS--YFSGCVGEVQRGIVSIGGSTFTKSTTRDGVVDFSTPLFQEAYGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVSAAVTWVLAYFSPFTAYNLRLEFAFADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAF 1132          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8H5G6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.724e-35
Identity = 67/171 (39.18%), Postives = 104/171 (60.82%), Query Frame = 1
Query:  106 MLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLAF 618
            +L+  S ++ F+ L  ++ D  WG+   NS+   F GC+G++  G+       FT    R   +DFSV   +ESN   L    PES++W +F P   + W  I+  L + +   ++ +Y+SP +A+NLNL F+I DE+ L+E+ W+ IGSFL QGQDFYP++MS+RT +AF
Sbjct:    5 ILEYFSTQLDFRFLTKDSTDGNWGSPEVNSTY--FNGCVGELQRGEVSVAAGPFTITAARDEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAF 173          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J1L9 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.496e-35
Identity = 67/171 (39.18%), Postives = 104/171 (60.82%), Query Frame = 1
Query:  106 MLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLAF 618
            +L+  S ++ F+ L  ++ D  WG+   NS+   F GC+G++  G+       FT    R   +DFSV   +ESN   L    PES++W +F P   + W  I+  L + +   ++ +Y+SP +A+NLNL F+I DE+ L+E+ W+ IGSFL QGQDFYP++MS+RT +AF
Sbjct:    5 ILEYFSTQLDFRFLTKDSTDGNWGSPEVNSTY--FNGCVGELQRGEVSVAAGPFTITAARDEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAF 173          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 7.412e-35
Identity = 67/176 (38.07%), Postives = 108/176 (61.36%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLAF 618
            G++ ++L IL+ ++ F+  +   +D  WG      S   F+GC+G++  G    G S FT    R   VDFS     E+N   +    PES++W+++ P  +  W L+I+ + + + + ++ +Y+SP SA+NL L F+I DEI L+E+ W+I+GSF+ QGQDFYP++MS R VLAF
Sbjct:  183 GMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSY--FSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAF 356          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.782e-34
Identity = 66/176 (37.50%), Postives = 108/176 (61.36%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLAF 618
            G++ ++L IL+ ++ F+  +   +D  WG      S   F+GC+G++  G    G S FT    R   VDFS     E+N   +    PES++W+++ P  +  W L+I+ + + + + ++ +Y+SP +A+NL L F+I DEI L+E+ W+I+GSF+ QGQDFYP++MS R VLAF
Sbjct:  381 GMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKS--YFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFTAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAF 554          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRID1 (glutamate ionotropic receptor delta type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4575])

HSP 1 Score: 62.3882 bits (150), Expect = 3.278e-11
Identity = 50/182 (27.47%), Postives = 85/182 (46.70%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPF-SIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            +K  G   ++L  L+  + FK  +Y+  D  +G+++   SN S+ G IG++ N ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P     W  I   + +  V+ +L +    L + N   P  S      L    W + G+F+ QG D    S++ R V+ 
Sbjct:  411 KKYKGFSIDVLDALAKMLGFKYDIYQVADSKYGSQL---SNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYS--VGILMRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQSLRSQNPPGPHQSPSMSSTLHSAIWIVYGAFVQQGGDSVVGSVALRIVMG 587          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRID1 (glutamate ionotropic receptor delta type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4575])

HSP 1 Score: 62.3882 bits (150), Expect = 3.844e-11
Identity = 50/182 (27.47%), Postives = 85/182 (46.70%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPF-SIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            +K  G   ++L  L+  + FK  +Y+  D  +G+++   SN S+ G IG++ N ++    S  T   +R+  VDFS  +MD S    +   KPE +  I+ +F P     W  I   + +  V+ +L +    L + N   P  S      L    W + G+F+ QG D    S++ R V+ 
Sbjct:  380 KKYKGFSIDVLDALAKMLGFKYDIYQVADSKYGSQL---SNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYS--VGILMRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQSLRSQNPPGPHQSPSMSSTLHSAIWIVYGAFVQQGGDSVVGSVALRIVMG 556          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 51.9878 bits (123), Expect = 1.194e-7
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 1
Query:   58 NGTYLPLEKTT---GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPL 474
            N T+LPL+ +    G   ++L+ LS  M F+  LY   D  +GA         +TG +GD+ NG +    + F+ N  R   +DF+  F   S    ++     + I     PL W+ W  I + L I ++   L+ + SP 
Sbjct:  416 NNTFLPLDYSKCCYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAW----KGGRWTGLVGDLLNGVADMAVTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPF 553          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 51.9878 bits (123), Expect = 1.333e-7
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 1
Query:   58 NGTYLPLEKTT---GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPL 474
            N T+LPL+ +    G   ++L+ LS  M F+  LY   D  +GA         +TG +GD+ NG +    + F+ N  R   +DF+  F   S    ++     + I     PL W+ W  I + L I ++   L+ + SP 
Sbjct:  416 NNTFLPLDYSKCCYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAW----KGGRWTGLVGDLLNGVADMAVTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPF 553          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 51.9878 bits (123), Expect = 1.387e-7
Identity = 49/184 (26.63%), Postives = 79/184 (42.93%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFF---KPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIR--------LREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   +MLK LS  ++F   +   +D L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM        +     KP    +    P     W  ++L  +  S + +L +  SP   +N   P   + E R        L    W  +G F+ QG +  P ++S R V
Sbjct:  459 GFCVDMLKELSDILKFTFRIKLVDDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPG--YFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYN---PHPCLRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPKALSTRCV 634          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.148e-6
Identity = 34/129 (26.36%), Postives = 60/129 (46.51%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLI-ILCLVINSVIGYLFSYYSPL 474
            G   ++LK LS  ++F   LY   +   G++I    N  + G IG++ N ++       T N +R   VDFSV F++      +              P     W ++ ILCL+++ +  ++F Y+SP+
Sbjct:  398 GFCIDILKKLSKTVKFTYDLYLVTNGKHGSKI----NGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPV 522          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 3.794e-6
Identity = 35/136 (25.74%), Postives = 62/136 (45.59%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLI-ILCLVINSVIGYLFSYYSPLSAWNLNL 495
            G   ++L+ LS  ++F   LY   +   G +I+   N    G +G++   ++       T N +R   VDFSV F++      +              P     W ++ ILCL+++++  +LF Y SP+  +N NL
Sbjct:   89 GFCIDILRKLSTTVRFTYDLYLVVNGKHGKKIQGVWN----GMVGEVEQKRAHMAVGSLTINEERSQVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSAAVWVMMFILCLMLSAIAVWLFEYLSPV-GFNRNL 219          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 47.7506 bits (112), Expect = 1.326e-6
Identity = 44/190 (23.16%), Postives = 81/190 (42.63%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKP----ESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLP----------FSIIDEIRLREHFWNIIGSFLMQGQD-FYPYSMSARTVLA 615
            G   E+L+ LS  ++FK  +Y   D  +GA  ++     + G + ++ NG++    +  T + +R+  +DF+  +MD          KP    E   + I RP  +  W  I   ++I     +LFS +SP   +   +             + D + L    W+ +  ++ Q  D  +P S S R  +A
Sbjct:  475 GYCIELLRKLSEMLRFKFEVYLVPDNNFGA--QDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMD---LGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVA 659          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 47.3654 bits (111), Expect = 1.602e-6
Identity = 43/180 (23.89%), Postives = 77/180 (42.78%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGA--RIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQG-QDFYPYSMSARTV 609
            +  +G   ++L  L  K+ F   +  +ED  +G+  R+  S    + G +G++  GK+    +  T N +R   ++FS  F  +     ++  +  + +    RP     W L++L + I +VI YL   +SP   + L         + L    W   G  L  G  +  P S SAR +
Sbjct:  437 DTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVL 616          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO32623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK5])

HSP 1 Score: 45.8246 bits (107), Expect = 3.074e-6
Identity = 51/179 (28.49%), Postives = 73/179 (40.78%), Query Frame = 1
Query:   82 KTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR---IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            K TG   ++L IL+    F+  +YE+  +L G +     + ++ G  GDI + K+       T N  R   +DFS  FM  S    L   KPE +   I     P     W + + C +  +    L +YYSP     L       DE       W  + S L QG D  P  +S R V
Sbjct:   15 KYTGHSIDLLDILAGMNGFQYEIYESA-ELGGVK----EDGTYYGLFGDIQSEKADLTTLPLTINSARLQYLDFSEPFMHVS--MDLVTRKPEEKQIDITGFMTPYTIPVWLMTMACWIFVTGCLSLVNYYSPY-GHRLRDTEGDGDEFSFFNSLWFCLASMLQQGGDATPKMLSGRIV 185          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:101175340])

HSP 1 Score: 51.6026 bits (122), Expect = 1.517e-7
Identity = 45/161 (27.95%), Postives = 70/161 (43.48%), Query Frame = 1
Query:  163 DKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFR---PLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIID---------EIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            D  +GAR  +     + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     +F    PL +  W  I+   +  SV+ +L S +SP   W+   P    D         E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  407 DGKYGAR--DPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEEGTDGQPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIV 562          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 50.8322 bits (120), Expect = 3.103e-7
Identity = 47/183 (25.68%), Postives = 81/183 (44.26%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIR--------LREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   +ML+ L+  ++F   +   +D L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  + +   +    P     W  ++L  +  S + +L +  SP   +N   P   + E R        L    W  +G F+ QG +  P ++S R V
Sbjct:  444 GFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVQLGR-KPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYN---PHPCMRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCV 619          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 50.8322 bits (120), Expect = 3.281e-7
Identity = 47/183 (25.68%), Postives = 81/183 (44.26%), Query Frame = 1
Query:   91 GIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDE--SNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIR--------LREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            G   +ML+ L+  ++F   +   +D L+GA   N S   +TG +G++ N K+    + FT   +R+  +DFS  FM    S    +Q  + +   +    P     W  ++L  +  S + +L +  SP   +N   P   + E R        L    W  +G F+ QG +  P ++S R V
Sbjct:  454 GFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGS---WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVQLGR-KPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYN---PHPCMRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCV 629          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 50.447 bits (119), Expect = 3.968e-7
Identity = 47/187 (25.13%), Postives = 80/187 (42.78%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR---IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLN-------LPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTV 609
            E+  G   ++   ++    FK  L    D  +GAR  ++    + G +G++  GK+    +  T    R+  +DFS  FM  S   S+   KP+     ++    PL +  W  I+   +  SV+ +L S +SP   W+               +E  +    W  +G+F+ QG D  P S+S R V
Sbjct:  437 ERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGAR--DAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFM--SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIV 618          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRID1 (glutamate receptor ionotropic, delta-1 [Source:NCBI gene;Acc:101174819])

HSP 1 Score: 50.447 bits (119), Expect = 4.061e-7
Identity = 44/188 (23.40%), Postives = 84/188 (44.68%), Query Frame = 1
Query:   79 EKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESR--IWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSI-------IDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            ++  G   ++L  L+  + FK  +Y+  D  +G+++ N S   + G IGD+ N ++    S  T   +R+  VDFS  ++D      +   KPE +  I+ +F P  +  W  I   + +  V+ +L +    L + + +            +    L    W + G+F+ QG D    S++ R V+ 
Sbjct:  414 KRYKGFSIDVLDALAKILGFKYEIYQVADSKYGSQLPNGS---WNGMIGDLINKRADLAVSAITITPERENVVDFSKRYLDYR--VGILVRKPEEKINIFSLFAPFDFAVWACIAAAIPVVGVLIFLLNRLQALHSSSSSSQSLSHGRRSNGVGSGTLHSAIWIVYGAFVQQGGDGVVGSVALRIVMG 596          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 246.128 bits (627), Expect = 1.270e-78
Identity = 116/195 (59.49%), Postives = 146/195 (74.87%), Query Frame = 1
Query:   31 IFPALNFLENGTYLPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            IFPAL +    +++ L  TTG+I+E+L ILS K+ F PLLYEA D  WGAR  +S N  FTGCIGDI+N K+LFG S+FT N  R  GVDF+  F +ESN A L+F    S+IW++FRPL W+TW +I++  +  S + Y+ S YSPLSAWNL L F+++DEIRLREH WNI+GSFLMQGQDFYPYSMS+RTVLA
Sbjct:  243 IFPALTYTRKNSFVELNGTTGLIFEILSILSAKLNFIPLLYEAADSQWGARKNDSFN--FTGCIGDIFNKKTLFGASLFTINAMRNEGVDFTAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLA 435          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 245.743 bits (626), Expect = 1.365e-78
Identity = 116/195 (59.49%), Postives = 146/195 (74.87%), Query Frame = 1
Query:   31 IFPALNFLENGTYLPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            IFPAL +    +++ L  TTG+I+E+L ILS K+ F PLLYEA D  WGAR  +S N  FTGCIGDI+N K+LFG S+FT N  R  GVDF+  F +ESN A L+F    S+IW++FRPL W+TW +I++  +  S + Y+ S YSPLSAWNL L F+++DEIRLREH WNI+GSFLMQGQDFYPYSMS+RTVLA
Sbjct:  241 IFPALTYTRKNSFVELNGTTGLIFEILSILSAKLNFIPLLYEAADSQWGARKNDSFN--FTGCIGDIFNKKTLFGASLFTINAMRNEGVDFTAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLA 433          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 200.675 bits (509), Expect = 3.668e-59
Identity = 99/195 (50.77%), Postives = 136/195 (69.74%), Query Frame = 1
Query:   31 IFPALNFLENGTYLPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            I PA+ F  N  Y  +E+T G++ ++LKILS K+ F+ L+YEA DK +GARI N+SN  FTGC+G++ N K+ F    FT    R+  VD+S   M+ESN   LQ  K ++++WHIFRP  W+ W L I  + + S   Y+FS Y+PLSA+NLNL F+I+DEI ++EH WN IG F++QGQDFYPY++SAR VLA
Sbjct:  548 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSN--FTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLA 740          

HSP 2 Score: 170.629 bits (431), Expect = 8.353e-49
Identity = 86/182 (47.25%), Postives = 124/182 (68.13%), Query Frame = 1
Query:   70 LPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            L + +TTG++  +L+ L   + FK L+YEA DK +G +I NSS   FTGCIG++   K++F   ++T    R   VDFS  +M+ESN   L+     S+IWH+ RPL ++ W LI++ +   S+  + FS +SPLSAWNLNL F+IIDE++L+E+ WN+IGS  MQGQDFYP+ +S+R VLA
Sbjct:    2 LYVNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSS--KFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLA 181          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 200.29 bits (508), Expect = 4.523e-59
Identity = 99/195 (50.77%), Postives = 136/195 (69.74%), Query Frame = 1
Query:   31 IFPALNFLENGTYLPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            I PA+ F  N  Y  +E+T G++ ++LKILS K+ F+ L+YEA DK +GARI N+SN  FTGC+G++ N K+ F    FT    R+  VD+S   M+ESN   LQ  K ++++WHIFRP  W+ W L I  + + S   Y+FS Y+PLSA+NLNL F+I+DEI ++EH WN IG F++QGQDFYPY++SAR VLA
Sbjct:  548 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSN--FTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLA 740          

HSP 2 Score: 170.244 bits (430), Expect = 1.179e-48
Identity = 86/182 (47.25%), Postives = 124/182 (68.13%), Query Frame = 1
Query:   70 LPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            L + +TTG++  +L+ L   + FK L+YEA DK +G +I NSS   FTGCIG++   K++F   ++T    R   VDFS  +M+ESN   L+     S+IWH+ RPL ++ W LI++ +   S+  + FS +SPLSAWNLNL F+IIDE++L+E+ WN+IGS  MQGQDFYP+ +S+R VLA
Sbjct:    2 LYVNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSS--KFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLA 181          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 170.244 bits (430), Expect = 3.805e-51
Identity = 86/182 (47.25%), Postives = 124/182 (68.13%), Query Frame = 1
Query:   70 LPLEKTTGIIYEMLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFGPSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTWTLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGSFLMQGQDFYPYSMSARTVLA 615
            L + +TTG++  +L+ L   + FK L+YEA DK +G +I NSS   FTGCIG++   K++F   ++T    R   VDFS  +M+ESN   L+     S+IWH+ RPL ++ W LI++ +   S+  + FS +SPLSAWNLNL F+IIDE++L+E+ WN+IGS  MQGQDFYP+ +S+R VLA
Sbjct:    2 LYVNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSS--KFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLA 181          
The following BLAST results are available for this feature:
BLAST of PBPe domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRID13.545e-1025.42glutamate ionotropic receptor delta type subunit 1... [more]
GRID13.984e-1025.42glutamate ionotropic receptor delta type subunit 1... [more]
GRIK51.077e-725.68glutamate ionotropic receptor kainate type subunit... [more]
GRIK51.311e-725.68glutamate ionotropic receptor kainate type subunit... [more]
GRIK51.311e-725.68glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-16.700e-1127.62Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-74.664e-824.58GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-75.586e-824.58GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-76.270e-824.58GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-21.199e-725.42Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ekar7.055e-1025.54gene:FBgn0039916 transcript:FBtr0089102[more]
Ekar7.342e-1025.54gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar1.753e-826.09gene:FBgn0039916 transcript:FBtr0344874[more]
CG111553.362e-722.78gene:FBgn0039927 transcript:FBtr0333701[more]
CG111553.362e-722.78gene:FBgn0039927 transcript:FBtr0089195[more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grid1b3.685e-926.09glutamate receptor, ionotropic, delta 1b [Source:Z... [more]
gria2a1.733e-825.67glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
gria2a1.896e-825.67glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
gria2a1.896e-825.67glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
grid1b2.607e-826.04glutamate receptor, ionotropic, delta 1b [Source:Z... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogfr2.192e-826.09opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr5.160e-826.09opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr1.903e-726.67opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr2.210e-726.67opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr2.258e-726.67opioid growth factor receptor [Source:Xenbase;Acc:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grid12.520e-924.29glutamate receptor, ionotropic, delta 1 [Source:MG... [more]
Grik59.168e-825.68glutamate receptor, ionotropic, kainate 5 (gamma 2... [more]
Gria45.962e-727.50glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria45.962e-727.50glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria46.304e-727.50glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
back to top
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26591|GLRK_LYMST3.516e-1026.92Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE... [more]
sp|P34299|GLR1_CAEEL8.522e-1027.62Glutamate receptor 1 OS=Caenorhabditis elegans OX=... [more]
sp|Q9ULK0|GRID1_HUMAN1.913e-925.42Glutamate receptor ionotropic, delta-1 OS=Homo sap... [more]
sp|Q62640|GRID1_RAT1.682e-824.29Glutamate receptor ionotropic, delta-1 OS=Rattus n... [more]
sp|Q61627|GRID1_MOUSE1.763e-824.29Glutamate receptor ionotropic, delta-1 OS=Mus musc... [more]
back to top
BLAST of PBPe domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HAM93.454e-3636.32CCHC-type domain-containing protein OS=Macrostomum... [more]
A0A1I8H5G61.724e-3539.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J1L93.496e-3539.18PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A267FSX57.412e-3538.07PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1343.782e-3437.50PBPe domain-containing protein (Fragment) OS=Macro... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRID13.278e-1127.47glutamate ionotropic receptor delta type subunit 1... [more]
GRID13.844e-1127.47glutamate ionotropic receptor delta type subunit 1... [more]
grin3bb1.194e-728.17glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb1.333e-728.17glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grik51.387e-726.63glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010716.11.148e-626.36pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000889.13.794e-625.74pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO302031.326e-623.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355451.602e-623.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326233.074e-628.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4b1.517e-727.95glutamate receptor 4 [Source:NCBI gene;Acc:1011753... [more]
grik53.103e-725.68glutamate ionotropic receptor kainate type subunit... [more]
grik53.281e-725.68glutamate ionotropic receptor kainate type subunit... [more]
gria2b3.968e-725.13glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRID14.061e-723.40glutamate receptor ionotropic, delta-1 [Source:NCB... [more]
back to top
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069533.11.270e-7859.49SMESG000069533.1[more]
SMESG000069533.11.365e-7859.49SMESG000069533.1[more]
SMESG000018611.13.668e-5950.77SMESG000018611.1[more]
SMESG000018611.14.523e-5950.77SMESG000018611.1[more]
SMESG000018611.13.805e-5147.25SMESG000018611.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009951 ID=SMED30009951|Name=PBPe domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=621bp
GTCGCCGAATTTCTTCTCCATTCATTGTAGATTTTTCCTGCTCTAAATTT
CCTTGAAAATGGTACTTATTTGCCATTGGAGAAGACTACTGGAATAATTT
ATGAAATGCTAAAGATTCTCTCTGTTAAGATGCAATTCAAACCATTATTA
TATGAAGCAGAAGATAAACTTTGGGGAGCTCGAATAAAGAATTCTTCCAA
TTTGAGCTTCACAGGCTGCATTGGAGACATATATAATGGAAAATCCTTGT
TTGGGCCTTCAGTTTTTACACCAAATTATGATCGAAAATTAGGAGTTGAT
TTCTCGGTTTTATTTATGGATGAGTCGAATTGCGCTTCTCTACAATTTTT
CAAACCCGAATCAAGAATATGGCACATATTTCGTCCACTTTTCTGGACAA
CATGGACATTGATAATTCTGTGCCTCGTCATAAATTCCGTCATCGGTTAT
TTATTTTCATATTATAGTCCATTGTCGGCCTGGAACCTCAACTTGCCGTT
TTCAATTATAGATGAAATCAGGCTCCGAGAACATTTTTGGAATATTATTG
GATCCTTCCTTATGCAAGGACAAGACTTCTATCCTTATTCAATGTCGGCA
AGAACGGTTTTAGCGTTTTAG
back to top

protein sequence of SMED30009951-orf-1

>SMED30009951-orf-1 ID=SMED30009951-orf-1|Name=SMED30009951-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MLKILSVKMQFKPLLYEAEDKLWGARIKNSSNLSFTGCIGDIYNGKSLFG
PSVFTPNYDRKLGVDFSVLFMDESNCASLQFFKPESRIWHIFRPLFWTTW
TLIILCLVINSVIGYLFSYYSPLSAWNLNLPFSIIDEIRLREHFWNIIGS
FLMQGQDFYPYSMSARTVLAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0005515protein binding
GO:0008066glutamate receptor activity
GO:0042802identical protein binding
GO:0015277kainate selective glutamate receptor activity
GO:0017124SH3 domain binding
GO:0030165PDZ domain binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR019594Glu/Gly-bd
IPR001320Iontro_rcpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005886plasma membrane
GO:0008328ionotropic glutamate receptor complex
GO:0042734presynaptic membrane
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043195terminal bouton
GO:0043204perikaryon
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0014069postsynaptic density
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
GO:0032983kainate selective glutamate receptor complex
Vocabulary: biological process
TermDefinition
GO:0006621protein retention in ER lumen
GO:0006810transport
GO:0006811ion transport
GO:0007268chemical synaptic transmission
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0035249synaptic transmission, glutamatergic
GO:0035725sodium ion transmembrane transport
GO:0042391regulation of membrane potential
GO:0043113receptor clustering
GO:0043525positive regulation of neuron apoptotic process
GO:0051649establishment of localization in cell
GO:0060079excitatory postsynaptic potential
GO:0071333cellular response to glucose stimulus
GO:0071805potassium ion transmembrane transport
GO:0031630regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 87..171
e-value: 1.0E-10
score: 43.4
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 1..86
e-value: 8.7E-10
score: 40.4
NoneNo IPR availablePANTHERPTHR18966:SF354coord: 1..171
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 1..171
NoneNo IPR availableTMHMMTMhelixcoord: 97..119