WH1 domain-containing protein

Overview
NameWH1 domain-containing protein
Smed IDSMED30009933
Length (bp)1617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WH1 domain-containing protein (SMED30009933) t-SNE clustered cells

Violin plots show distribution of expression levels for WH1 domain-containing protein (SMED30009933) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WH1 domain-containing protein (SMED30009933) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WH1 domain-containing protein (SMED30009933) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009933

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009933SMESG000052345.1 Contig5222GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30009933SMESG000052345.1 dd_Smed_v4_1714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30009933SMESG000052345.1 dd_Smed_v4_1714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009933SMESG000052345.1 dd_Smed_v4_1714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009933SMESG000052345.1 dd_Smed_v4_1714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: EVL (Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234])

HSP 1 Score: 80.1073 bits (196), Expect = 1.861e-17
Identity = 46/118 (38.98%), Postives = 67/118 (56.78%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPK 430
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS +  K
Sbjct:    5 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGDK 121          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: EVL (Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234])

HSP 1 Score: 79.337 bits (194), Expect = 3.509e-17
Identity = 45/115 (39.13%), Postives = 66/115 (57.39%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPK 421
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS +
Sbjct:    5 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNSQE 118          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: EVL (Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234])

HSP 1 Score: 81.2629 bits (199), Expect = 6.960e-16
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    5 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 116          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: EVL (Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234])

HSP 1 Score: 81.2629 bits (199), Expect = 7.662e-16
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    3 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Human
Match: EVL (Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234])

HSP 1 Score: 79.337 bits (194), Expect = 8.545e-16
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    5 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 116          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 65.855 bits (159), Expect = 3.684e-11
Identity = 39/113 (34.51%), Postives = 56/113 (49.56%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG----SQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL 409
            E  I  A   V+ Y+ ST  W  LG    S     +I   + P  E+R VS +  S  + LN  ++  + Y++ TP FHQW  E +  YGLNF +  +A  F   V+ A+E L
Sbjct:    4 EACIATAMARVMTYNESTKGWVLLGGNDDSMTNVRLIQDIRRP--EFRIVSNRADSTNI-LNCNIYRGIKYHKATPMFHQWRTEQRRVYGLNFENEQDATMFLSIVLQAIETL 113          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 63.5438 bits (153), Expect = 9.758e-11
Identity = 39/113 (34.51%), Postives = 56/113 (49.56%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG----SQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL 409
            E  I  A   V+ Y+ ST  W  LG    S     +I   + P  E+R VS +  S  + LN  ++  + Y++ TP FHQW  E +  YGLNF +  +A  F   V+ A+E L
Sbjct:    4 EACIATAMARVMTYNESTKGWVLLGGNDDSMTNVRLIQDIRRP--EFRIVSNRADSTNI-LNCNIYRGIKYHKATPMFHQWRTEQRRVYGLNFENEQDATMFLSIVLQAIETL 113          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 63.5438 bits (153), Expect = 1.894e-10
Identity = 36/103 (34.95%), Postives = 53/103 (51.46%), Query Frame = 2
Query:  113 VLKYSLSTGQWEELG----SQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL 409
            V+ Y+ ST  W  LG    S     +I   + P  E+R VS +  S  + LN  ++  + Y++ TP FHQW  E +  YGLNF +  +A  F   V+ A+E L
Sbjct:    4 VMTYNESTKGWVLLGGNDDSMTNVRLIQDIRRP--EFRIVSNRADSTNI-LNCNIYRGIKYHKATPMFHQWRTEQRRVYGLNFENEQDATMFLSIVLQAIETL 103          
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Match: unc-34 (UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53])

HSP 1 Score: 59.3066 bits (142), Expect = 1.955e-9
Identity = 35/102 (34.31%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  116 LKYSLSTGQWEELG----SQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL 409
            + Y+ ST  W  LG    S     +I   + P  E+R VS +  S  + LN  ++  + Y++ TP FHQW  E +  YGLNF +  +A  F   V+ A+E L
Sbjct:    1 MTYNESTKGWVLLGGNDDSMTNVRLIQDIRRP--EFRIVSNRADSTNI-LNCNIYRGIKYHKATPMFHQWRTEQRRVYGLNFENEQDATMFLSIVLQAIETL 99          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0340450)

HSP 1 Score: 82.8037 bits (203), Expect = 2.415e-16
Identity = 61/182 (33.52%), Postives = 89/182 (48.90%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL-----NSPKVPKPMSMDNVSVSKKVEKSPGYRT-AKKMSSIDRPPAS--STVSPYATTGINQMNDSSAAKPP 601
            EQ I+ A   V+ Y  +  +W   GS  G   + I+    N  +R V  K    EVV+N  +   + YN+ T TFHQW D SK  YGLNF+  N+A+ F  A++ ALE+L     N+P  P        +     E+  GYRT   + ++I R   S    V+P A T  +Q N ++  + P
Sbjct:    3 EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWRD-SKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP-------TNGNGYEEDMGYRTMTSEDAAILRQNNSIGGHVTPSAQTPTSQTNQNNIPQSP 176          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0100174)

HSP 1 Score: 82.4185 bits (202), Expect = 3.099e-16
Identity = 51/143 (35.66%), Postives = 71/143 (49.65%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL-----NSPKVPKPMSMDNVSVSKKVEKSPGYRT 493
            EQ I+ A   V+ Y  +  +W   GS  G   + I+    N  +R V  K    EVV+N  +   + YN+ T TFHQW D SK  YGLNF+  N+A+ F  A++ ALE+L     N+P  P        +     E+  GYRT
Sbjct:    3 EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWRD-SKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP-------TNGNGYEEDMGYRT 137          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0086582)

HSP 1 Score: 82.4185 bits (202), Expect = 3.170e-16
Identity = 51/143 (35.66%), Postives = 71/143 (49.65%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL-----NSPKVPKPMSMDNVSVSKKVEKSPGYRT 493
            EQ I+ A   V+ Y  +  +W   GS  G   + I+    N  +R V  K    EVV+N  +   + YN+ T TFHQW D SK  YGLNF+  N+A+ F  A++ ALE+L     N+P  P        +     E+  GYRT
Sbjct:    3 EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWRD-SKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP-------TNGNGYEEDMGYRT 137          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0100176)

HSP 1 Score: 82.4185 bits (202), Expect = 3.170e-16
Identity = 51/143 (35.66%), Postives = 71/143 (49.65%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL-----NSPKVPKPMSMDNVSVSKKVEKSPGYRT 493
            EQ I+ A   V+ Y  +  +W   GS  G   + I+    N  +R V  K    EVV+N  +   + YN+ T TFHQW D SK  YGLNF+  N+A+ F  A++ ALE+L     N+P  P        +     E+  GYRT
Sbjct:    3 EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWRD-SKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP-------TNGNGYEEDMGYRT 137          
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Match: ena (gene:FBgn0000578 transcript:FBtr0086583)

HSP 1 Score: 82.4185 bits (202), Expect = 3.170e-16
Identity = 51/143 (35.66%), Postives = 71/143 (49.65%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL-----NSPKVPKPMSMDNVSVSKKVEKSPGYRT 493
            EQ I+ A   V+ Y  +  +W   GS  G   + I+    N  +R V  K    EVV+N  +   + YN+ T TFHQW D SK  YGLNF+  N+A+ F  A++ ALE+L     N+P  P        +     E+  GYRT
Sbjct:    3 EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWRD-SKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP-------TNGNGYEEDMGYRT 137          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: enah (ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010323-11])

HSP 1 Score: 79.337 bits (194), Expect = 3.833e-17
Identity = 42/119 (35.29%), Postives = 62/119 (52.10%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPM 436
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS     P+
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQDAGPPL 120          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: evla (Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-65])

HSP 1 Score: 77.7962 bits (190), Expect = 5.936e-16
Identity = 43/113 (38.05%), Postives = 64/113 (56.64%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSP-SNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ +  +N +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L S
Sbjct:    3 EQSICQARASVMIYDDTSKKWVPVKPGQQGFSRINIYHNTVNNSFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSTAMLFALNVLGS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: vaspa (vasodilator stimulated phosphoprotein a [Source:ZFIN;Acc:ZDB-GENE-070424-68])

HSP 1 Score: 80.4925 bits (197), Expect = 9.607e-16
Identity = 44/113 (38.94%), Postives = 64/113 (56.64%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGS-QKGTCVISIFK-SPSNEYRFVSWKE-SSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILN 412
            EQ I QA   V+ Y   + +W   GS  +    I IF+ S S  +R V  K+ + Q+VV+N  L   M YN+ TPTFHQW D ++  +GLNF    EA +F   ++ AL++L+
Sbjct:    3 EQSICQARATVMLYDDGSKRWMPAGSGAQAVSRIHIFQNSSSCSFRVVGRKQQADQQVVINCPLVRGMKYNQATPTFHQWRD-ARQVWGLNFGSKEEASQFASGIMQALDMLS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: enah (ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010323-11])

HSP 1 Score: 79.7221 bits (195), Expect = 2.230e-15
Identity = 42/119 (35.29%), Postives = 62/119 (52.10%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPM 436
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS     P+
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQDAGPPL 120          
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Match: evla (Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-65])

HSP 1 Score: 78.5666 bits (192), Expect = 2.761e-15
Identity = 43/113 (38.05%), Postives = 64/113 (56.64%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSP-SNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ +  +N +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L S
Sbjct:    3 EQSICQARASVMIYDDTSKKWVPVKPGQQGFSRINIYHNTVNNSFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSTAMLFALNVLGS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-478190])

HSP 1 Score: 82.8037 bits (203), Expect = 1.668e-16
Identity = 45/135 (33.33%), Postives = 70/135 (51.85%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            +EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +S  N  +  +V+  P
Sbjct:    1 IEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQESGPTLSRQNSHIPIQVQNGP 134          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: slc30a9 (solute carrier family 30 (zinc transporter), member 9 [Source:Xenbase;Acc:XB-GENE-976698])

HSP 1 Score: 81.6481 bits (200), Expect = 6.123e-16
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  L   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    3 EQSICQARASVMIYDDTSKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSLVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMIFALNIMNS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: slc30a9 (solute carrier family 30 (zinc transporter), member 9 [Source:Xenbase;Acc:XB-GENE-976698])

HSP 1 Score: 81.2629 bits (199), Expect = 1.506e-15
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  L   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    3 EQSICQARASVMIYDDTSKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSLVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMIFALNIMNS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: slc30a9 (solute carrier family 30 (zinc transporter), member 9 [Source:Xenbase;Acc:XB-GENE-976698])

HSP 1 Score: 81.2629 bits (199), Expect = 1.698e-15
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  L   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    3 EQSICQARASVMIYDDTSKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSLVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMIFALNIMNS 114          
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Match: sorbs2 (sorbin and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-478190])

HSP 1 Score: 81.2629 bits (199), Expect = 1.811e-15
Identity = 45/135 (33.33%), Postives = 70/135 (51.85%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            +EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +S  N  +  +V+  P
Sbjct:    1 IEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQESGPTLSRQNSHIPIQVQNGP 134          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 82.0333 bits (201), Expect = 5.601e-16
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +   N  +  +V+  P
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAGPTLPRQNSQLPAQVQNGP 135          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 81.6481 bits (200), Expect = 5.914e-16
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +   N  +  +V+  P
Sbjct:   23 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAGPTLPRQNSQLPAQVQNGP 155          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 81.6481 bits (200), Expect = 6.412e-16
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +   N  +  +V+  P
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAGPTLPRQNSQLPAQVQNGP 135          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Enah (ENAH actin regulator [Source:MGI Symbol;Acc:MGI:108360])

HSP 1 Score: 81.6481 bits (200), Expect = 6.592e-16
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +   N  +  +V+  P
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAGPTLPRQNSQLPAQVQNGP 135          
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Match: Evl (Ena-vasodilator stimulated phosphoprotein [Source:MGI Symbol;Acc:MGI:1194884])

HSP 1 Score: 79.7221 bits (195), Expect = 1.664e-15
Identity = 44/113 (38.94%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + S+ +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    3 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASSTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 114          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|O08719|EVL_RAT (Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 3.009e-15
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    9 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 120          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UI08|EVL_HUMAN (Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 3.679e-15
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    3 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 114          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R896|EVL_PONAB (Ena/VASP-like protein OS=Pongo abelii OX=9601 GN=EVL PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.286e-15
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL I+NS
Sbjct:    9 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNIMNS 120          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N8S7|ENAH_HUMAN (Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 4.918e-15
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS +    +   N  +  +V+  P
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGP 135          
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8T4F7|ENA_DROME (Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4)

HSP 1 Score: 81.6481 bits (200), Expect = 6.803e-15
Identity = 61/182 (33.52%), Postives = 89/182 (48.90%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL-----NSPKVPKPMSMDNVSVSKKVEKSPGYRT-AKKMSSIDRPPAS--STVSPYATTGINQMNDSSAAKPP 601
            EQ I+ A   V+ Y  +  +W   GS  G   + I+    N  +R V  K    EVV+N  +   + YN+ T TFHQW D SK  YGLNF+  N+A+ F  A++ ALE+L     N+P  P        +     E+  GYRT   + ++I R   S    V+P A T  +Q N ++  + P
Sbjct:  299 EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQNNTFRVVGRKLQDHEVVINCSILKGLKYNQATATFHQWRD-SKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP-------TNGNGYEEDMGYRTMTSEDAAILRQNNSIGGHVTPSAQTPTSQTNQNNIPQSP 472          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A2G8K494 (WH1 domain-containing protein (Fragment) OS=Stichopus japonicus OX=307972 GN=BSL78_20377 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.945e-18
Identity = 56/177 (31.64%), Postives = 88/177 (49.72%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSPGYRTAKKMSSIDRPPASSTVSPYATTGINQMNDSSAAKPPVV 607
            ME+ +   T  V+ Y  +  +W + G+  G   + I++   N  YR V   ++ Q VV+NS +   + YN+ TPTFHQW D S+  YGLNF  P +A+ F  A++SALE L++P  P   +        +V   P  +   +     RPP +           NQ   SS+++PP +
Sbjct:    1 MERAVCNTTASVMIYDDANRKWVQAGNSAGVSRVQIYQHQQNNTYRVVGRLKADQSVVINSAILKGLKYNQATPTFHQWRD-SRQVYGLNFHSPEDAENFSSAMLSALEKLSAPSRPPVPTTAPPQAPTQVHNGPSIQEEIRQ----RPPETQ----------NQRTSSSSSEPPAL 162          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A183B049 (WH1 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS12584 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.491e-18
Identity = 43/113 (38.05%), Postives = 63/113 (55.75%), Query Frame = 2
Query:   74 FQMEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSP-SNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL 409
            +  E P+  A   V+ Y   +  W   GS  G   + ++ +P +N YR V W+   +EVV+N  +   + Y++  PTFHQW D  +  YGLNFT P EA+ F +AV SAL+ L
Sbjct:    7 YHRENPVATAKANVMLYDSDSSTWIPSGSGHGVSKVQLYHNPTANTYRIVGWRLQDREVVINCAIVRGLKYHQARPTFHQWRDSKQRVYGLNFTLPEEAEAFAVAVKSALDDL 119          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A267E155 (WH1 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000235g3 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.147e-17
Identity = 48/113 (42.48%), Postives = 64/113 (56.64%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            MEQ I+     V+ Y     +W   GS +G   + IF+  SN  +R V  K    EVV+N  +   + YN+ TPTFHQW D +K  YGLNFT P +A+ F IA+  ALE+L S
Sbjct:    1 MEQAIISTHATVMIYDDGLKRWLPSGSSQGLSKVQIFQHTSNNTFRVVGRKVQDHEVVINCAILRGLKYNQATPTFHQWRD-AKQIYGLNFTKPEDAENFAIAMRRALEVLTS 112          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A267EXD9 (WH1 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000235g2 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.266e-17
Identity = 48/113 (42.48%), Postives = 64/113 (56.64%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            MEQ I+     V+ Y     +W   GS +G   + IF+  SN  +R V  K    EVV+N  +   + YN+ TPTFHQW D +K  YGLNFT P +A+ F IA+  ALE+L S
Sbjct:    1 MEQAIISTHATVMIYDDGLKRWLPSGSSQGLSKVQIFQHTSNNTFRVVGRKVQDHEVVINCAILRGLKYNQATPTFHQWRD-AKQIYGLNFTKPEDAENFAIAMRRALEVLTS 112          
BLAST of WH1 domain-containing protein vs. TrEMBL
Match: A0A267H284 (WH1 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005718g1 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.320e-17
Identity = 53/134 (39.55%), Postives = 70/134 (52.24%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS-------PKVPKPMSMDNVSV 457
            MEQ I+     V+ Y     +W   GS +G   + IF+  SN  +R V  K    EVV+N  +   + YN+ TPTFHQW D +K  YGLNFT P +A+ F IA+  ALE+L S       P VP       V+V
Sbjct:    1 MEQAIISTHATVMIYDDGLKRWLPSGSSQGLSKVQIFQHTSNNTFRVVGRKVQDHEVVINCAILRGLKYNQATPTFHQWRD-AKQIYGLNFTKPEDAENFAIAMRRALEVLTSAMELAAAPPVPGGQQYREVAV 133          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: evla (Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-65])

HSP 1 Score: 77.411 bits (189), Expect = 6.887e-16
Identity = 45/118 (38.14%), Postives = 68/118 (57.63%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWK-ESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVP 427
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K +  Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L+S + P
Sbjct:    1 EQSICQARASVMIYDDTSKKWVPIKPGQQGFSRINIYHNTTSNTFRVVGVKLQDQQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEAGTFSTAMLFALNVLSSQEPP 117          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:103032123])

HSP 1 Score: 79.337 bits (194), Expect = 3.052e-15
Identity = 43/121 (35.54%), Postives = 64/121 (52.89%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS----PKVPK 430
            EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+LNS    P +P+
Sbjct:    3 EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVLNSQDAGPTLPR 122          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: evlb (ena/VASP-like protein [Source:NCBI gene;Acc:103028674])

HSP 1 Score: 77.7962 bits (190), Expect = 3.580e-15
Identity = 42/113 (37.17%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L++
Sbjct:    3 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNVLST 114          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: evla (Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-65])

HSP 1 Score: 72.4034 bits (176), Expect = 4.800e-15
Identity = 41/109 (37.61%), Postives = 61/109 (55.96%), Query Frame = 2
Query:   86 QPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEI 406
            Q I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +
Sbjct:    2 QSICQARASVMIYDDTSKKWVPIKPGQQGFSRINIYHNTTSNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEAGTFSTAMLFALNL 109          
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Match: evlb (ena/VASP-like protein [Source:NCBI gene;Acc:103028674])

HSP 1 Score: 77.7962 bits (190), Expect = 5.861e-15
Identity = 42/113 (37.17%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L++
Sbjct:    9 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNVLST 120          
BLAST of WH1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006730.1 (pep scaffold:Pmarinus_7.0:GL476423:313891:330988:1 gene:ENSPMAG00000006060.1 transcript:ENSPMAT00000006730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 7.464e-17
Identity = 43/134 (32.09%), Postives = 66/134 (49.25%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPS-NEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSP 481
            EQ I QA   V+ Y  +  +W   G Q+G   + I+   S N +R V  +   Q+VV+N  L   + YN+ TP FHQW D ++  YGLNF    +A  F   ++ AL+ L++     P      S+   ++  P
Sbjct:    3 EQSICQARAQVMVYDDANKKWLPSGGQQGFSRVHIYHHTSLNTFRVVGRRMQDQQVVINCSLSKGLKYNQATPMFHQWRD-ARQVYGLNFGSKEDANVFANGIMHALDALSAQDTKGPTLQRQPSIVSSLQNGP 135          
BLAST of WH1 domain-containing protein vs. Ensembl Sea Lamprey
Match: SPRED2 (sprouty related EVH1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:17722])

HSP 1 Score: 56.225 bits (134), Expect = 1.042e-8
Identity = 38/117 (32.48%), Postives = 55/117 (47.01%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK------SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQW-YDESKSAYGLNFTDPNEAKKFGIAVVSALEILN 412
            E  IV+   +V+    STG W  L    G   + I+K      +  NE+  +  +   + VVL   L   + YN+ TP FH W  DE K  +GL F  P +A+ F   V  A+E L+
Sbjct:    6 ENYIVRVRAVVMTRDDSTGGWVPLAG-GGISRVGIYKVLHHEETGRNEFLILGERLKDKLVVLECVLKKDVVYNKVTPIFHHWKIDEQK--FGLTFQSPADARAFDRGVRKAIEDLS 119          
BLAST of WH1 domain-containing protein vs. Ensembl Nematostella
Match: EDO41208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4T4])

HSP 1 Score: 87.8113 bits (216), Expect = 7.995e-21
Identity = 51/130 (39.23%), Postives = 65/130 (50.00%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSP-SNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKV 469
            E  I QA   V+ Y+    QW   G  +G   + ++  P +N +R V  K +   VV+N  L   + YNE TPTFHQW D+ +  YGLNF   +EA  FG AV  ALE L   K   P S   V    KV
Sbjct:    3 EHSIAQARASVMLYNNEAKQWAPSGGSQGISRVHVYHHPVNNTFRIVGRKMADHAVVINCALAKGLKYNEATPTFHQWRDQ-RQVYGLNFQSKDEADLFGQAVRDALETL---KTSAPPSAGTVCEGCKV 128          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: evla (ena/VASP-like protein [Source:NCBI gene;Acc:101173592])

HSP 1 Score: 81.6481 bits (200), Expect = 2.377e-16
Identity = 45/120 (37.50%), Postives = 68/120 (56.67%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPM 436
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L+SP    P+
Sbjct:    3 EQSICQARASVMVYDDASKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNVLSSPDSGGPV 121          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: evla (ena/VASP-like protein [Source:NCBI gene;Acc:101173592])

HSP 1 Score: 81.2629 bits (199), Expect = 3.602e-16
Identity = 45/120 (37.50%), Postives = 68/120 (56.67%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFKSPSNE-YRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPM 436
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+ + +N  +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L+SP    P+
Sbjct:    3 EQSICQARASVMVYDDASKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNVLSSPDSGGPV 121          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: evlb (ena/VASP-like protein [Source:NCBI gene;Acc:101159062])

HSP 1 Score: 79.337 bits (194), Expect = 1.345e-15
Identity = 43/113 (38.05%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L++
Sbjct:    3 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNVLSA 114          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: evlb (ena/VASP-like protein [Source:NCBI gene;Acc:101159062])

HSP 1 Score: 78.9518 bits (193), Expect = 2.384e-15
Identity = 43/113 (38.05%), Postives = 65/113 (57.52%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELG-SQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNS 415
            EQ I QA   V+ Y  ++ +W  +   Q+G   I+I+  + SN +R V  K   Q+VV+N  +   + YN+ TPTFHQW D ++  YGLNF    EA  F  A++ AL +L++
Sbjct:   33 EQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQATPTFHQWRD-ARQVYGLNFASKEEATTFSNAMLFALNVLSA 144          
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Match: enah (ENAH actin regulator [Source:NCBI gene;Acc:105357991])

HSP 1 Score: 75.8702 bits (185), Expect = 5.074e-14
Identity = 39/115 (33.91%), Postives = 60/115 (52.17%), Query Frame = 2
Query:   68 IKFQMEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFK-SPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEIL 409
            ++   EQ I QA   V+ Y  +  +W   G   G   + I+  + +N +R V  K    +VV+N  +   + YN+ T TFHQW D ++  YGLNF    +A  F  A++ ALE+L
Sbjct:    1 MEVHREQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNAFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRD-ARQVYGLNFGSKEDANVFASAMMHALEVL 114          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000052345.1 (SMESG000052345.1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 382/382 (100.00%), Postives = 382/382 (100.00%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSPGYRTAKKMSSIDRPPASSTVSPYATTGINQMNDSSAAKPPVVAVNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTSAPVAPTASVKKPANDFASQLLXXXXXXXXXXXXXXXXXXXXGMSTNMGVXXXXXXXXXXXXXXXXXVDFLTELRMKSQKRTDSTNQNKKAELXXXXXXXXXXXXXXXXXXXKIXXXXXXXXXXXXXXXXXTSYVTSADLDKFRADLMQDFLFNMDKMKNEXXXXXXXKLN 1225
            MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSPGYRTAKKMSSIDRPPASSTVSPYATTGINQMNDSSAAKPPVVAVNKPSGSAAPPPPGPPPSAPAPPGPPPSGPPPLTSAPVAPTASVKKPANDFASQLLAASQNMKSSSANSNSENPSAGMSTNMGVTAHAAPSKPAPTTSAAPVDFLTELRMKSQKRTDSTNQNKKAELPKTTPTTTTQPPTAPNVTTKISVNQSSKMSSSNSDLASTSYVTSADLDKFRADLMQDFLFNMDKMKNEIISSIISKLN
Sbjct:    1 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSPGYRTAKKMSSIDRPPASSTVSPYATTGINQMNDSSAAKPPVVAVNKPSGSAAPPPPGPPPSAPAPPGPPPSGPPPLTSAPVAPTASVKKPANDFASQLLAASQNMKSSSANSNSENPSAGMSTNMGVTAHAAPSKPAPTTSAAPVDFLTELRMKSQKRTDSTNQNKKAELPKTTPTTTTQPPTAPNVTTKISVNQSSKMSSSNSDLASTSYVTSADLDKFRADLMQDFLFNMDKMKNEIISSIISKLN 382          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000052345.1 (SMESG000052345.1)

HSP 1 Score: 481.485 bits (1238), Expect = 2.291e-168
Identity = 367/382 (96.07%), Postives = 367/382 (96.07%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSPGYRTAKKMSSIDRPPASSTVSPYATTGINQMNDSSAAKPPVVAVNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTSAPVAPTASVKKPANDFASQLLXXXXXXXXXXXXXXXXXXXXGMSTNMGVXXXXXXXXXXXXXXXXXVDFLTELRMKSQKRTDSTNQNKKAELXXXXXXXXXXXXXXXXXXXKIXXXXXXXXXXXXXXXXXTSYVTSADLDKFRADLMQDFLFNMDKMKNEXXXXXXXKLN 1225
            MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEK               PPASSTVSPYATTGINQMNDSSAAKPPVVAVNKPSGSAAPPPPGPPPSAPAPPGPPPSGPPPLTSAPVAPTASVKKPANDFASQLLAASQNMKSSSANSNSENPSAGMSTNMGVTAHAAPSKPAPTTSAAPVDFLTELRMKSQKRTDSTNQNKKAELPKTTPTTTTQPPTAPNVTTKISVNQSSKMSSSNSDLASTSYVTSADLDKFRADLMQDFLFNMDKMKNEIISSIISKLN
Sbjct:    1 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPKVPKPMSMDNVSVSKKVEK---------------PPASSTVSPYATTGINQMNDSSAAKPPVVAVNKPSGSAAPPPPGPPPSAPAPPGPPPSGPPPLTSAPVAPTASVKKPANDFASQLLAASQNMKSSSANSNSENPSAGMSTNMGVTAHAAPSKPAPTTSAAPVDFLTELRMKSQKRTDSTNQNKKAELPKTTPTTTTQPPTAPNVTTKISVNQSSKMSSSNSDLASTSYVTSADLDKFRADLMQDFLFNMDKMKNEIISSIISKLN 367          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000052344.1 (SMESG000052344.1)

HSP 1 Score: 129.798 bits (325), Expect = 3.148e-33
Identity = 58/114 (50.88%), Postives = 80/114 (70.18%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPK 421
            + Q I+   V +L+Y     +W+ELGS  G C +++++S  N YRFV+ K  + E+VLN+FLFP+M+YNET+PTFHQW D S S YGLNFTD +EAK+F   V  AL+ LNS +
Sbjct:   10 LRQSIINTNVTILEYCKYNFEWKELGSVNGECSLTLYRSNMNTYRFVAHKILNNEIVLNAFLFPSMHYNETSPTFHQWIDNSFSVYGLNFTDSSEAKRFSSIVGFALQSLNSAQ 123          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000052344.1 (SMESG000052344.1)

HSP 1 Score: 129.798 bits (325), Expect = 3.286e-33
Identity = 58/114 (50.88%), Postives = 80/114 (70.18%), Query Frame = 2
Query:   80 MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILNSPK 421
            + Q I+   V +L+Y     +W+ELGS  G C +++++S  N YRFV+ K  + E+VLN+FLFP+M+YNET+PTFHQW D S S YGLNFTD +EAK+F   V  AL+ LNS +
Sbjct:   18 LRQSIINTNVTILEYCKYNFEWKELGSVNGECSLTLYRSNMNTYRFVAHKILNNEIVLNAFLFPSMHYNETSPTFHQWIDNSFSVYGLNFTDSSEAKRFSSIVGFALQSLNSAQ 131          
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Match: SMESG000063850.1 (SMESG000063850.1)

HSP 1 Score: 100.908 bits (250), Expect = 1.439e-22
Identity = 46/111 (41.44%), Postives = 65/111 (58.56%), Query Frame = 2
Query:   83 EQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSP-SNEYRFVSWKESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFGIAVVSALEILN 412
            E+P+  A   V+ +   T  W   GS +G   + +F+   +N YR V WK + +EVVLN  +F  + YN+  PTFHQW D     YGLNFT+  EA++F  A++ ALE LN
Sbjct:    3 EKPVATARASVMLFDAVTNSWVASGSTQGISKVQLFRHQLNNTYRVVGWKLNDKEVVLNCAIFRGLKYNQARPTFHQWRDTKHQVYGLNFTNKEEAEQFAAAILEALENLN 113          
The following BLAST results are available for this feature:
BLAST of WH1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EVL1.861e-1738.98Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234][more]
EVL3.509e-1739.13Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234][more]
EVL6.960e-1639.82Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234][more]
EVL7.662e-1639.82Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234][more]
EVL8.545e-1639.82Enah/Vasp-like [Source:HGNC Symbol;Acc:HGNC:20234][more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-343.684e-1134.51UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
unc-349.758e-1134.51UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
unc-341.894e-1034.95UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
unc-341.955e-934.31UNC-34 [Source:UniProtKB/TrEMBL;Acc:G5EG53][more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ena2.415e-1633.52gene:FBgn0000578 transcript:FBtr0340450[more]
ena3.099e-1635.66gene:FBgn0000578 transcript:FBtr0100174[more]
ena3.170e-1635.66gene:FBgn0000578 transcript:FBtr0086582[more]
ena3.170e-1635.66gene:FBgn0000578 transcript:FBtr0100176[more]
ena3.170e-1635.66gene:FBgn0000578 transcript:FBtr0086583[more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enah3.833e-1735.29ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010... [more]
evla5.936e-1638.05Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-... [more]
vaspa9.607e-1638.94vasodilator stimulated phosphoprotein a [Source:ZF... [more]
enah2.230e-1535.29ENAH actin regulator [Source:ZFIN;Acc:ZDB-GENE-010... [more]
evla2.761e-1538.05Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sorbs21.668e-1633.33sorbin and SH3 domain containing 2 [Source:Xenbase... [more]
slc30a96.123e-1639.82solute carrier family 30 (zinc transporter), membe... [more]
slc30a91.506e-1539.82solute carrier family 30 (zinc transporter), membe... [more]
slc30a91.698e-1539.82solute carrier family 30 (zinc transporter), membe... [more]
sorbs21.811e-1533.33sorbin and SH3 domain containing 2 [Source:Xenbase... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Enah5.601e-1632.84ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah5.914e-1632.84ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah6.412e-1632.84ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Enah6.592e-1632.84ENAH actin regulator [Source:MGI Symbol;Acc:MGI:10... [more]
Evl1.664e-1538.94Ena-vasodilator stimulated phosphoprotein [Source:... [more]
back to top
BLAST of WH1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08719|EVL_RAT3.009e-1539.82Ena/VASP-like protein OS=Rattus norvegicus OX=1011... [more]
sp|Q9UI08|EVL_HUMAN3.679e-1539.82Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=E... [more]
sp|Q5R896|EVL_PONAB4.286e-1539.82Ena/VASP-like protein OS=Pongo abelii OX=9601 GN=E... [more]
sp|Q8N8S7|ENAH_HUMAN4.918e-1532.84Protein enabled homolog OS=Homo sapiens OX=9606 GN... [more]
sp|Q8T4F7|ENA_DROME6.803e-1533.52Protein enabled OS=Drosophila melanogaster OX=7227... [more]
back to top
BLAST of WH1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8K4941.945e-1831.64WH1 domain-containing protein (Fragment) OS=Sticho... [more]
A0A183B0499.491e-1838.05WH1 domain-containing protein OS=Echinostoma capro... [more]
A0A267E1552.147e-1742.48WH1 domain-containing protein OS=Macrostomum ligna... [more]
A0A267EXD92.266e-1742.48WH1 domain-containing protein OS=Macrostomum ligna... [more]
A0A267H2842.320e-1739.55WH1 domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
evla6.887e-1638.14Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-... [more]
enah3.052e-1535.54ENAH actin regulator [Source:NCBI gene;Acc:1030321... [more]
evlb3.580e-1537.17ena/VASP-like protein [Source:NCBI gene;Acc:103028... [more]
evla4.800e-1537.61Enah/Vasp-like a [Source:ZFIN;Acc:ZDB-GENE-000607-... [more]
evlb5.861e-1537.17ena/VASP-like protein [Source:NCBI gene;Acc:103028... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006730.17.464e-1732.09pep scaffold:Pmarinus_7.0:GL476423:313891:330988:1... [more]
SPRED21.042e-832.48sprouty related EVH1 domain containing 2 [Source:H... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412087.995e-2139.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WH1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
evla2.377e-1637.50ena/VASP-like protein [Source:NCBI gene;Acc:101173... [more]
evla3.602e-1637.50ena/VASP-like protein [Source:NCBI gene;Acc:101173... [more]
evlb1.345e-1538.05ena/VASP-like protein [Source:NCBI gene;Acc:101159... [more]
evlb2.384e-1538.05ena/VASP-like protein [Source:NCBI gene;Acc:101159... [more]
enah5.074e-1433.91ENAH actin regulator [Source:NCBI gene;Acc:1053579... [more]
back to top
BLAST of WH1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052345.10.000e+0100.00SMESG000052345.1[more]
SMESG000052345.12.291e-16896.07SMESG000052345.1[more]
SMESG000052344.13.148e-3350.88SMESG000052344.1[more]
SMESG000052344.13.286e-3350.88SMESG000052344.1[more]
SMESG000063850.11.439e-2241.44SMESG000063850.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009933 ID=SMED30009933|Name=WH1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1617bp
TAAATAATTGACTAAAATTATTATTTCAAATTTTGATAATAATTTTATTC
ATTTAATAAATATTTAAATTAAGTTTCAAATGGAGCAGCCTATTGTTCAA
GCAACAGTGATTGTTTTGAAATATAGCTTGTCAACTGGTCAGTGGGAAGA
GTTAGGTTCTCAAAAAGGAACTTGTGTAATTAGTATTTTTAAATCACCAT
CAAATGAATACAGATTCGTATCGTGGAAAGAATCAAGCCAAGAAGTGGTA
TTGAATTCATTTCTCTTTCCAACAATGAATTACAATGAAACAACTCCGAC
ATTCCATCAATGGTATGATGAATCTAAAAGTGCCTATGGATTGAATTTCA
CCGATCCAAATGAAGCGAAAAAGTTTGGAATCGCCGTAGTGAGCGCTCTT
GAAATTTTGAATTCTCCCAAAGTTCCTAAACCAATGAGCATGGATAATGT
TTCAGTCTCCAAGAAAGTAGAAAAAAGTCCTGGATATCGTACCGCAAAGA
AAATGTCTTCTATAGACAGACCACCTGCAAGTTCAACAGTTTCCCCATAT
GCCACAACCGGGATAAATCAAATGAACGATTCATCGGCAGCAAAACCACC
GGTGGTAGCAGTAAATAAACCTTCTGGTAGTGCTGCTCCTCCTCCGCCTG
GACCACCACCTTCCGCTCCAGCTCCACCTGGTCCTCCACCATCTGGACCT
CCACCTCTCACTAGTGCTCCTGTAGCTCCGACTGCCTCAGTTAAAAAACC
AGCTAATGATTTTGCTAGTCAACTTTTAGCTGCGTCACAAAATATGAAAA
GTTCATCAGCAAATTCAAATTCTGAAAATCCTTCTGCAGGTATGTCAACA
AACATGGGAGTCACGGCACATGCGGCTCCCTCGAAACCAGCACCAACTAC
AAGCGCTGCACCGGTGGACTTTTTAACAGAATTGAGAATGAAATCTCAAA
AGCGTACAGATAGTACAAATCAAAATAAAAAAGCTGAATTGCCAAAGACG
ACACCTACAACGACAACGCAACCTCCAACGGCACCAAACGTTACTACTAA
GATTTCCGTCAATCAGTCGAGTAAAATGTCTTCATCCAATTCAGATTTGG
CCTCAACTTCGTATGTTACTTCAGCTGACCTGGATAAATTCAGAGCCGAC
CTGATGCAGGATTTTCTATTTAATATGGACAAAATGAAAAATGAAATTAT
TTCTAGTATCATATCAAAATTGAATTGAAATCCATTTTCAACAATTGTTT
AACAACTGAAAGTATATTCGAACACTGATTCACATTTACACAATTCTTCT
AAATATTTTCAAATGTTCGTACGCTTGATTTTATTGAGACTCGCAAATAT
ATTTATACCCCAATACCTTGCTTTGATTTGTTTTCCGGTCTATTTGCTTT
TTCGATTTTTATTTCAGTTTCTATTTAATTGTTTACAGATTTTTATTCAT
CCACGGGTCGATGGTTTTTTTACTGTGGAAATGTGGATTTATTATTTTAA
CATAGAATTTATACAGTTATTGTTTAATAATTACCTTTTTTGCGATAGGC
CACCACCTTTTTAAATTTTGTTTTAATATATGGTTATGTAATTTCAAATT
GATGTTTTAATATTAGA
back to top

protein sequence of SMED30009933-orf-1

>SMED30009933-orf-1 ID=SMED30009933-orf-1|Name=SMED30009933-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MEQPIVQATVIVLKYSLSTGQWEELGSQKGTCVISIFKSPSNEYRFVSWK
ESSQEVVLNSFLFPTMNYNETTPTFHQWYDESKSAYGLNFTDPNEAKKFG
IAVVSALEILNSPKVPKPMSMDNVSVSKKVEKSPGYRTAKKMSSIDRPPA
SSTVSPYATTGINQMNDSSAAKPPVVAVNKPSGSAAPPPPGPPPSAPAPP
GPPPSGPPPLTSAPVAPTASVKKPANDFASQLLAASQNMKSSSANSNSEN
PSAGMSTNMGVTAHAAPSKPAPTTSAAPVDFLTELRMKSQKRTDSTNQNK
KAELPKTTPTTTTQPPTAPNVTTKISVNQSSKMSSSNSDLASTSYVTSAD
LDKFRADLMQDFLFNMDKMKNEIISSIISKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008154actin polymerization or depolymerization
GO:0003382epithelial cell morphogenesis
GO:0007010cytoskeleton organization
GO:0007015actin filament organization
GO:0007298border follicle cell migration
GO:0007303cytoplasmic transport, nurse cell to oocyte
GO:0007390germ-band shortening
GO:0007391dorsal closure
GO:0007396suture of dorsal opening
GO:0007409axonogenesis
GO:0007411axon guidance
GO:0008064regulation of actin polymerization or depolymerization
GO:0008258head involution
GO:0008360regulation of cell shape
GO:0010591regulation of lamellipodium assembly
GO:0030036actin cytoskeleton organization
GO:0030335positive regulation of cell migration
GO:0031346positive regulation of cell projection organization
GO:0032956regulation of actin cytoskeleton organization
GO:0035262gonad morphogenesis
GO:0045886negative regulation of synaptic growth at neuromuscular junction
GO:0046847filopodium assembly
GO:0048749compound eye development
GO:0048813dendrite morphogenesis
GO:0051489regulation of filopodium assembly
GO:0051491positive regulation of filopodium assembly
GO:0060288formation of a compartment boundary
GO:1990255subsynaptic reticulum organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR034367VASP
IPR000697WH1/EVH1_dom
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005515protein binding
GO:0017124SH3 domain binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005911cell-cell junction
GO:0005912adherens junction
GO:0030027lamellipodium
GO:0030424axon
GO:0030425dendrite
GO:0031252cell leading edge
GO:0032433filopodium tip
GO:0042995cell projection
GO:0071212subsynaptic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000697WH1/EVH1 domainSMARTSM00461WH1_2coord: 2..107
e-value: 6.5E-17
score: 72.2
IPR000697WH1/EVH1 domainPFAMPF00568WH1coord: 3..104
e-value: 3.0E-16
score: 59.3
IPR000697WH1/EVH1 domainPROSITEPS50229WH1coord: 1..110
score: 16.484
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 1..115
e-value: 6.5E-25
score: 89.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 300..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 120..154
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 183..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 179..221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 288..322
NoneNo IPR availablePANTHERPTHR11202VASODILATOR-STIMULATED PHOSPHOPROTEIN/SPROUTY PROTEIN EVH1 DOMAIN CONTAINING PROTEIN 3coord: 2..381
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 2..110
IPR034367Vasodilator-stimulated phosphoproteinPANTHERPTHR11202:SF12VASODILATOR-STIMULATED PHOSPHOPROTEINcoord: 2..381