Sorting nexin-33

Overview
NameSorting nexin-33
Smed IDSMED30009911
Length (bp)1869
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin-33 (SMED30009911) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin-33 (SMED30009911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin-33 (SMED30009911) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin-33 (SMED30009911) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30009911SMESG000005938.1 dd_Smed_v4_7087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009911SMESG000005938.1 dd_Smed_v4_7087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30009911SMESG000005938.1 dd_Smed_v4_7087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009911SMESG000005938.1 dd_Smed_v4_7087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30009911SMESG000005938.1 dd_Smed_v4_7087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30009911SMESG000005938.1 dd_Smed_v4_7087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin-33 vs. Ensembl Human
Match: SNX33 (sorting nexin 33 [Source:HGNC Symbol;Acc:HGNC:28468])

HSP 1 Score: 167.933 bits (424), Expect = 3.444e-44
Identity = 109/393 (27.74%), Postives = 188/393 (47.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWF---IDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            + F++ G + F+ G   +   I AE   ++ G     QWK   +   C+++     +K+KGIK++++Y++T +++   V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W++H+T HPVLS     + F S  D K+WK+ K + + D      F    + PT+  D+  + +R+     F   +DD       ++    R H     G  KE  K+   F  I+ S   +P    +   L   ++  G  Y+ IG +F  Q K D   +   L    G+    P I+ L  GA   +     MS E ++ ++    + R  ++V   + AE++    RR+   + +M  +L+ QI  + ++   L  TL+ +D
Sbjct:  187 SCFVRSGVEAFILGDVPMMAKI-AETYSIEMGP-RGPQWKANPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHV---GGFRKEFQKLGSAFQAISHSFQMDPPFCSEA--LNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYD 572          

HSP 2 Score: 51.2174 bits (121), Expect = 4.482e-6
Identity = 22/56 (39.29%), Postives = 35/56 (62.50%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELI 200
            K +ALYD+   + E+I    DE L+I      +GW +G+N+R E G+ P+SY E++
Sbjct:    4 KGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIV 59          
BLAST of Sorting nexin-33 vs. Ensembl Human
Match: SNX18 (sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:19245])

HSP 1 Score: 162.54 bits (410), Expect = 5.276e-42
Identity = 111/395 (28.10%), Postives = 185/395 (46.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF---SESDXXXXXXXXXXXXNDVFKNGGFYNAVKA-PTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S   +D +    VL  G +   +W++      C ID     +K+KG+K++++Y++  +++   V  RY  FDWLY++ AEK+P I VP LP +Q  GRF+ +FI  RR  L  W+NH+  HPVL+     + F    S +D+K WK  K K + D      F+  +   P   LD+ ++  ++     F      ++  L+     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G+AY  IG LF  Q + D   V   L    G     P I+ +  GAL  +        E K++ +    +      ++    AE+      R    +S M   L+ QI  F ++T  L + L  +D
Sbjct:  233 STFVKSGGEAFVLGEASGFVKDGDKLCVVL--GPYGP-EWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKYD 622          
BLAST of Sorting nexin-33 vs. Ensembl Human
Match: SNX9 (sorting nexin 9 [Source:HGNC Symbol;Acc:HGNC:14973])

HSP 1 Score: 141.354 bits (355), Expect = 5.780e-35
Identity = 109/409 (26.65%), Postives = 186/409 (45.48%), Query Frame = 3
Query:  348 SSVKIP----NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKY-PCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRF------HKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            SS+KIP      F K G + +L  K+      +  + V   G   +Y    F     C +   +  SK  G+K+++ Y++T + + + V HRY  FDWLY +   K+   I +P LP +QV GRF+ EFI+ R   LQ W+  +  HPV+S S   + F +  D+K+WK  K K + D       ++ ++     LD+ +I ++ + V  F          + DG +        H  +  G L KE+ KI K    +    + +  Q +   DL   + + G  Y+EI  L   Q K D  F+     E  G     P I+    GA+  +     + + SK+  +  +N+ + V +++  + AE++   + R +   SV+  +L+ Q++ +  I   L   L  F V
Sbjct:  199 SSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTF----DCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTK-------AMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGE--TDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPV 594          
BLAST of Sorting nexin-33 vs. Ensembl Human
Match: SNX18 (sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:19245])

HSP 1 Score: 140.969 bits (354), Expect = 1.023e-34
Identity = 108/380 (28.42%), Postives = 178/380 (46.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF---SESDXXXXXXXXXXXXNDVFKNGGFYNAVKA-PTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGV-------QLVTRTVDAELSWLQNRRQHQMRSVMCQHL 1469
            ++F+K GG+ F+ G+ S   +D +    VL  G +   +W++      C ID     +K+KG+K++++Y++  +++   V  RY  FDWLY++ AEK+P I VP LP +Q  GRF+ +FI  RR  L  W+NH+  HPVL+     + F    S +D+K WK  K K + D      F+  +   P   LD+ ++  ++     F      ++  L+     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G+AY  IG LF  Q + D   V   L    G     P I+ +  G    L   I  S   +L   T+  V   V       +  +R VDA +  L+ +      S + ++L
Sbjct:  233 STFVKSGGEAFVLGEASGFVKDGDKLCVVL--GPYGP-EWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLEQVI-WSVLCRLKGATLTAVPLWVSESYSTGEEASRDVDAWVFSLECKLDCSTGSFLLEYL 606          
BLAST of Sorting nexin-33 vs. Ensembl Human
Match: SNX18 (sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:19245])

HSP 1 Score: 140.198 bits (352), Expect = 1.334e-34
Identity = 96/323 (29.72%), Postives = 156/323 (48.30%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF---SESDXXXXXXXXXXXXNDVFKNGGFYNAVKA-PTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCI 1319
            ++F+K GG+ F+ G+ S   +D +    VL  G +   +W++      C ID     +K+KG+K++++Y++  +++   V  RY  FDWLY++ AEK+P I VP LP +Q  GRF+ +FI  RR  L  W+NH+  HPVL+     + F    S +D+K WK  K K + D      F+  +   P   LD+ ++  ++     F      ++  L+     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G+AY  IG LF  Q + D   V   L    G     P I+ +  G    L   I
Sbjct:  233 STFVKSGGEAFVLGEASGFVKDGDKLCVVL--GPYGP-EWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLEQVI 550          
BLAST of Sorting nexin-33 vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 171.4 bits (433), Expect = 5.589e-46
Identity = 112/391 (28.64%), Postives = 187/391 (47.83%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEV-LKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K G + ++ G+      I    EV +  GI    QWK     +TC +D  K +SK KG+K+F+ Y ITSS +  +V  RY  FDWL+ Q + KY  I +PPLP +QVAGR++ + I+ R+ +LQ W+N I  HPVLS S     F S +D+K WK  K + + D +  G F N +  P   LD   +  ++++    +         + +    F K     + +   K+   F  + +S     D+    + LT+ L    + Y EIG +F++  K D   V  NL    G  + +P I+++   A+          SE +L     + + + +  ++ TV AE+      +   M+S M  +LK Q   + ++   L+     +D
Sbjct:  184 SNFVKSGVEAYVIGESKTTSQISERHEVVMNNGII---QWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSF--EIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFR-----DSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 564          
BLAST of Sorting nexin-33 vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 164.851 bits (416), Expect = 2.777e-45
Identity = 104/355 (29.30%), Postives = 171/355 (48.17%), Query Frame = 3
Query:  471 IYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            I QWK     +TC +D  K +SK KG+K+F+ Y ITSS +  +V  RY  FDWL+ Q + KY  I +PPLP +QVAGR++ + I+ R+ +LQ W+N I  HPVLS S     F S +D+K WK  K + + D +  G F N +  P   LD   +  ++++    +         + +    F K     + +   K+   F  + +S     D+    + LT+ L    + Y EIG +F++  K D   V  NL    G  + +P I+++   A+          SE +L     + + + +  ++ TV AE+      +   M+S M  +LK Q   + ++   L+     +D
Sbjct:    5 IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSF--EIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFR-----DSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 352          
BLAST of Sorting nexin-33 vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 164.851 bits (416), Expect = 2.777e-45
Identity = 104/355 (29.30%), Postives = 171/355 (48.17%), Query Frame = 3
Query:  471 IYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            I QWK     +TC +D  K +SK KG+K+F+ Y ITSS +  +V  RY  FDWL+ Q + KY  I +PPLP +QVAGR++ + I+ R+ +LQ W+N I  HPVLS S     F S +D+K WK  K + + D +  G F N +  P   LD   +  ++++    +         + +    F K     + +   K+   F  + +S     D+    + LT+ L    + Y EIG +F++  K D   V  NL    G  + +P I+++   A+          SE +L     + + + +  ++ TV AE+      +   M+S M  +LK Q   + ++   L+     +D
Sbjct:    5 IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSF--EIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFR-----DSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 352          
BLAST of Sorting nexin-33 vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 164.851 bits (416), Expect = 2.777e-45
Identity = 104/355 (29.30%), Postives = 171/355 (48.17%), Query Frame = 3
Query:  471 IYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            I QWK     +TC +D  K +SK KG+K+F+ Y ITSS +  +V  RY  FDWL+ Q + KY  I +PPLP +QVAGR++ + I+ R+ +LQ W+N I  HPVLS S     F S +D+K WK  K + + D +  G F N +  P   LD   +  ++++    +         + +    F K     + +   K+   F  + +S     D+    + LT+ L    + Y EIG +F++  K D   V  NL    G  + +P I+++   A+          SE +L     + + + +  ++ TV AE+      +   M+S M  +LK Q   + ++   L+     +D
Sbjct:    5 IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSF--EIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFR-----DSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 352          
BLAST of Sorting nexin-33 vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 168.318 bits (425), Expect = 7.473e-45
Identity = 112/393 (28.50%), Postives = 188/393 (47.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEV-LKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYST--KKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K G + ++ G+      I    EV +  GI    QWK     +TC +D  K +SK KG+K+F+ Y ITSS +   ++V  RY  FDWL+ Q + KY  I +PPLP +QVAGR++ + I+ R+ +LQ W+N I  HPVLS S     F S +D+K WK  K + + D +  G F N +  P   LD   +  ++++    +         + +    F K     + +   K+   F  + +S     D+    + LT+ L    + Y EIG +F++  K D   V  NL    G  + +P I+++   A+          SE +L     + + + +  ++ TV AE+      +   M+S M  +LK Q   + ++   L+     +D
Sbjct:  184 SNFVKSGVEAYVIGESKTTSQISERHEVVMNNGII---QWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSF--EIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFR-----DSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 566          
BLAST of Sorting nexin-33 vs. Ensembl Fly
Match: SH3PX1 (gene:FBgn0040475 transcript:FBtr0076413)

HSP 1 Score: 144.821 bits (364), Expect = 1.644e-36
Identity = 107/389 (27.51%), Postives = 193/389 (49.61%), Query Frame = 3
Query:  393 NFLFGKKSVARDI-EAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFI---DDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLA----KNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            +++ G  S    I E E+  + +    IYQW Q  + ++  + S K +SK+KG+KTF+ Y++T S++   V  RY  FDWL+ +  +K+  I VPPLP +Q++GR++ +F+E RRV LQ +++ +  HPV+S       F +  D+K WK  K K + D +    +  A+  P   L   K+  +++    FI   D   RN   +S+   +    Q++   KE  +I     D+ ++LA    + P +N     L++ + +IG  +  IG  F  Q K D   +   L    G+    P I     GA+     C  ++ E +++   + +V+R   +V+ TV AEL+  ++ R   ++  +   +  QI+ +  + A L +  +  +
Sbjct:  182 SYILGLSSTKEKIPECEMAYITQVEDSIYQWTQNHSPYSVVVASPKKESKFKGMKTFIAYQLTPSFNNISVSRRYKHFDWLHERLVDKFCLIPVPPLPDKQISGRYEEQFVEHRRVQLQEFVDWVCRHPVISKCEVWYHFLTCRDEKIWKSGKRKAERDPYMGVNYCLAISPPDKNLLHSKVDAQVELGTQFIHSMDVAVRNLNNISNDMAKRSMSQSK---KEFQRIGDGLSDLAKALAIDERRAPTRN--AVPLSESVGRIGGIFIGIGQAFGDQPKHDWIPLSDRLHIYRGVLNCFPDIFSTHKGAIQKRKDCEKLAGEGRMNNPQLHDVNRRTDVVSYTVLAELTHFKSERDTHLKHTLKNFIAEQIKFYQGVVARLQEASRQIE 565          
BLAST of Sorting nexin-33 vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082641)

HSP 1 Score: 58.151 bits (139), Expect = 1.507e-9
Identity = 38/108 (35.19%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  546 GIKTFVNYEITSS-----YSTKK--VVHRYNQFDWLYSQFAEKYPCIVVPPLPG----RQVA-----GRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSES 821
            G K + +YE+        +  K+  V  RY+ F+WL ++  E+   IVVPPLPG    RQ+      G F   FIE RR  L+ ++N I  HP+  N   + MF  E+
Sbjct:   47 GKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNEL-ERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQEN 153          
BLAST of Sorting nexin-33 vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082642)

HSP 1 Score: 58.151 bits (139), Expect = 1.507e-9
Identity = 38/108 (35.19%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  546 GIKTFVNYEITSS-----YSTKK--VVHRYNQFDWLYSQFAEKYPCIVVPPLPG----RQVA-----GRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSES 821
            G K + +YE+        +  K+  V  RY+ F+WL ++  E+   IVVPPLPG    RQ+      G F   FIE RR  L+ ++N I  HP+  N   + MF  E+
Sbjct:   47 GKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNEL-ERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQEN 153          
BLAST of Sorting nexin-33 vs. Ensembl Zebrafish
Match: snx33 (sorting nexin 33 [Source:ZFIN;Acc:ZDB-GENE-041111-209])

HSP 1 Score: 173.326 bits (438), Expect = 1.576e-46
Identity = 120/422 (28.44%), Postives = 197/422 (46.68%), Query Frame = 3
Query:  285 TENRKGSDSPRLLSVISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAE--VEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERL---KKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            + NRKGS   R L+  S           SF++ G + F+ G   +   I     +E+   G     QW       +C+I+     +K+KGIKT+++Y +T S++ + V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W++H+T HPVLS     + F    D K+WK+ K + + D      F    + P +  D+  + ER+   K  A  +DD       ++    R H     G  KE  ++   F  I++S   +P  + D   L+  ++  G  Y+ IG +F  Q K D   +   L    G+    P I+ L  GA   +     MS E K+D+     + +  + V   + AE++    RR+   + +M  +L+ QI  + ++   L  TL+ +D
Sbjct:  148 SSNRKGSMVGRNLNRFS-----------SFVRSGVEAFILGDVPMMAKIAESYSIEMGPRGP----QWMDNPRPFSCSIEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFEHFLMCGDDKQWKLGKRRAEKDEMVGAHFMLTFQIPNEHQDLQDVEERIDSFKSFAKKMDDSVMQLTNVASELVRKHL---GGFRKEFQRLGNGFQSISQSFLLDPPYSSDA--LSNAISHTGRTYENIGEMFADQPKNDLFQMLDKLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGKMDQGEADGIRKRCRTVGFALQAEMNHFHQRREVDFKEMMQAYLRQQIAFYQRVGQQLERTLRMYD 549          
BLAST of Sorting nexin-33 vs. Ensembl Zebrafish
Match: snx18a (sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705-339])

HSP 1 Score: 170.629 bits (431), Expect = 1.866e-45
Identity = 110/393 (27.99%), Postives = 187/393 (47.58%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF--SESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S   +D +    V+ +   E   W++     +C ID     +K+KG+K++++Y++T +++  +V  RY  FDWLY++  EK+P I VP +P +Q  GRF+ +FI  RR  L  W+NH+T HPVL+     + F   S +D+K WK  K K + D      F+  +  P   LD+  +  R+     F      +   ++     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G AY+ IG  F  Q K D   V   L    G     P I+ +  GAL  +        E K++ +    +     +++    AE+ +    R    +S M   L+ QI  F ++T  L + L+ +D
Sbjct:  178 STFVKSGGEAFVLGEASGFVKDGDKICVVMGQYGPE---WQENPYPFSCTIDDPTKQTKFKGMKSYISYKLTPTHTQSQVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRRGLIWWMNHMTSHPVLARCDVFQHFLSCSSTDEKAWKQGKRKAEKDEMVGANFFLTISTPPAPLDLQDVESRIDGFKVFSKKMDDSVIQVNATLSEFARKQIAGFKKEYQKVGQSFKYLSQAFEM--DQQSYSIGLNQAIAYTGEAYEVIGDYFVEQPKQDVDPVMDLLALYQGHLTNYPDIIHVQKGALTKVKESQKHVEEGKMESQHADGIRDRCNIISFATMAEIQYFHQTRVRDFKSQMQHFLQQQISFFQKVTGKLEEALQKYD 565          
BLAST of Sorting nexin-33 vs. Ensembl Zebrafish
Match: snx18a (sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705-339])

HSP 1 Score: 170.629 bits (431), Expect = 1.866e-45
Identity = 110/393 (27.99%), Postives = 187/393 (47.58%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF--SESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S   +D +    V+ +   E   W++     +C ID     +K+KG+K++++Y++T +++  +V  RY  FDWLY++  EK+P I VP +P +Q  GRF+ +FI  RR  L  W+NH+T HPVL+     + F   S +D+K WK  K K + D      F+  +  P   LD+  +  R+     F      +   ++     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G AY+ IG  F  Q K D   V   L    G     P I+ +  GAL  +        E K++ +    +     +++    AE+ +    R    +S M   L+ QI  F ++T  L + L+ +D
Sbjct:  178 STFVKSGGEAFVLGEASGFVKDGDKICVVMGQYGPE---WQENPYPFSCTIDDPTKQTKFKGMKSYISYKLTPTHTQSQVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRRGLIWWMNHMTSHPVLARCDVFQHFLSCSSTDEKAWKQGKRKAEKDEMVGANFFLTISTPPAPLDLQDVESRIDGFKVFSKKMDDSVIQVNATLSEFARKQIAGFKKEYQKVGQSFKYLSQAFEM--DQQSYSIGLNQAIAYTGEAYEVIGDYFVEQPKQDVDPVMDLLALYQGHLTNYPDIIHVQKGALTKVKESQKHVEEGKMESQHADGIRDRCNIISFATMAEIQYFHQTRVRDFKSQMQHFLQQQISFFQKVTGKLEEALQKYD 565          
BLAST of Sorting nexin-33 vs. Ensembl Zebrafish
Match: snx18b (sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213-6])

HSP 1 Score: 158.303 bits (399), Expect = 4.162e-41
Identity = 110/393 (27.99%), Postives = 183/393 (46.56%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF--SESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S + RD +    V+ +   E   W++     TC ID     +K+KG+K++++Y +T S++  +V  RY  FDWLY++  EK+P I VP LP +Q  GRF+ +FI  RR  L  W+NH+T HPVLS     + F   S +D+K WK  K K + D      F+  +  P   LD+ ++  +++    F      N   ++     F + Q  G  KE+ ++ + F  ++++     DQ      L + +   G  Y+ IG  F  Q + D   +   L    G     P I+ +  GAL           E   D      ++    +++    AE+      R    ++ M   L+ QI  F +IT  L + L  +D
Sbjct:  176 STFVKSGGEAFVLGEASGLVRDGDKIFVVMGQSGPE---WQENPYAFTCTIDDPTKQTKFKGMKSYMSYGLTPSHTQSQVNRRYKHFDWLYARLVEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLSKCDVFQHFLTCSSTDEKAWKQGKRKAEKDDLVGANFFLTICPPALPLDLQEVENKVEGFKTFTKKMDENIIQVNVTINEFARKQITGFKKEYQRVGQAFRLLSQAF--EVDQQVFSSPLNKAMANTGEVYETIGDYFAEQPRQDLEPISDLLAIYQGHLANFPDIIHVQKGALTKAKESQKHGEEK--DGTAGGGINDRCNIISCATLAEIQHFHCIRVRDFKAQMQYFLQQQISFFQKITGKLEEALDMYD 561          

HSP 2 Score: 50.447 bits (119), Expect = 5.779e-6
Identity = 20/56 (35.71%), Postives = 35/56 (62.50%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELI 200
            +A+ALYD++  +  +I    +E+L +    + +GW  G N+R E G+ P+SY E+I
Sbjct:    4 RARALYDFTSENPGEISVTENEVLTLCSEEVVDGWLEGTNSRGETGLFPASYVEII 59          
BLAST of Sorting nexin-33 vs. Ensembl Zebrafish
Match: snx18b (sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213-6])

HSP 1 Score: 156.377 bits (394), Expect = 2.050e-40
Identity = 109/393 (27.74%), Postives = 182/393 (46.31%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF--SESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S + RD +    V+ +   E   W++     TC ID     +K+KG+K++++Y +T S++  +V  RY  FDWLY++  EK+P I VP LP +Q  GRF+ +FI  RR  L  W+NH+T HPVLS     + F   S +D+K WK  K K + D      F+  +  P   LD+ ++  +++    F      N   ++     F + Q  G  KE+ ++ + F  ++++     DQ      L + +   G  Y+ IG  F  Q + D   +   L          P I+ +  GAL           E   D      ++    +++    AE+      R    ++ M   L+ QI  F +IT  L + L  +D
Sbjct:  176 STFVKSGGEAFVLGEASGLVRDGDKIFVVMGQSGPE---WQENPYAFTCTIDDPTKQTKFKGMKSYMSYGLTPSHTQSQVNRRYKHFDWLYARLVEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLSKCDVFQHFLTCSSTDEKAWKQGKRKAEKDDLVGANFFLTICPPALPLDLQEVENKVEGFKTFTKKMDENIIQVNVTINEFARKQITGFKKEYQRVGQAFRLLSQAF--EVDQQVFSSPLNKAMANTGEVYETIGDYFAEQPRQDLEPISDLLAIYQAHLANFPDIIHVQKGALTKAKESQKHGEEK--DGTAGGGINDRCNIISCATLAEIQHFHCIRVRDFKAQMQYFLQQQISFFQKITGKLEEALDMYD 561          

HSP 2 Score: 50.447 bits (119), Expect = 5.931e-6
Identity = 20/56 (35.71%), Postives = 35/56 (62.50%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELI 200
            +A+ALYD++  +  +I    +E+L +    + +GW  G N+R E G+ P+SY E+I
Sbjct:    4 RARALYDFTSENPGEISVTENEVLTLCSEEVVDGWLEGTNSRGETGLFPASYVEII 59          
BLAST of Sorting nexin-33 vs. Ensembl Xenopus
Match: csrp2 (cysteine and glycine rich protein 2 [Source:Xenbase;Acc:XB-GENE-943913])

HSP 1 Score: 160.999 bits (406), Expect = 5.111e-42
Identity = 102/390 (26.15%), Postives = 181/390 (46.41%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            +SF++ G + F+ G       + +E   ++ G  +  QWK      +C+++     +K+KGIK++++Y +T       V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FI+ R+  L  W++H+T HPVLS     + F S  D+K+WK  K + + D      F   ++ PT+  D+  + ER+     F      N   LS       +    G  KE  ++      ++ S   +P  + +   L   ++  G  Y+ +G +F  Q K D       L    G+    P I+ L  GA   +     MS E +++++    + +  ++V   + AE++    RR    +  +  +LK QI  + +++  L  TL  +D
Sbjct:  162 SSFVRSGVEAFVLGDVPQFGGV-SESHAIEMGP-KGPQWKANPRPFSCSVEEPTKQTKFKGIKSYISYRLTPDPCNSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIQKRKRRLVLWMDHMTSHPVLSQYDGFQHFLSCQDEKQWKAGKRRAERDELVGASFLLTLQLPTEHQDLQDVEERVDVFKAFSKKMDENVLQLSSVVSELARKHLGGFRKEFQRLGAALQGLSHSFQLDPPYSSE--PLVGAISHTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMEQDEADGIRKRCRVVGFALQAEINHFHQRRLQDFKQAIQHYLKEQILFYRRVSQELEKTLHMYD 547          
BLAST of Sorting nexin-33 vs. Ensembl Xenopus
Match: snx18 (sorting nexin 18 [Source:NCBI gene;Acc:496591])

HSP 1 Score: 155.992 bits (393), Expect = 5.829e-40
Identity = 106/398 (26.63%), Postives = 182/398 (45.73%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAP--TDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNK----IGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            ++F+K GG+ F+ G+ +   RD +    V      E  +W++      C+ID     +K+KG+K++++Y +  S++  +V  RY  FDWLY++  +K+P + VP +P +Q  GRF+ +FI  R+  L  W+ H+  HPVL+   A + F S +D+K WK  K K + D      F+  +  P  + +L+   +  RL     F          LS     F + Q  G  KE+ K+ +    + ++         D    + GLN+     G AY+ IG +F  Q + D   +   L    G     P I+ +  GAL  +        E KL+ +    +     +++    AE+      R    +S M   L+ QI  F ++T  L + L+ +D 
Sbjct:  197 SAFVKSGGEAFVLGEAAGFVRDGDKLCVVPGA---EGPEWQENPYPFRCSIDEPTKQTKFKGMKSYISYRLLPSHTGLQVHRRYKHFDWLYARLLDKFPVVSVPRIPEKQATGRFEEDFISKRKKGLVWWMEHMCSHPVLARCDAFQHFLSCTDEKAWKQGKRKCERDEMVGANFFLTLSLPPGSPVLEPHDVDGRLDGFKVFTKRMDEGVLQLSQTAGEFARKQAAGFKKEYQKVGQAVRGLGQAF------EMDHMVFSAGLNRAMAFTGEAYEAIGEMFAEQPRQDLDPIMDLLAVYQGHLANFPDIIHVQRGALTKVRESKKQVEEGKLELQKAGEIQERCNVISYATLAEIHHFHKIRVRDFKSQMQHFLQQQICFFQKVTLKLEEALQKYDA 585          
BLAST of Sorting nexin-33 vs. Ensembl Xenopus
Match: snx9 (sorting nexin 9 [Source:NCBI gene;Acc:100145698])

HSP 1 Score: 141.739 bits (356), Expect = 1.468e-35
Identity = 121/522 (23.18%), Postives = 229/522 (43.87%), Query Frame = 3
Query:   45 LYDYSPSSAE-DIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLSVISPRMMSSVKI---------------PNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYP-CIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRF------HKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            LYD+S      ++     EI+ + + ++  GW   +N++ + G++P+ Y  + SP                     + P+P    +G     L+ V   +M   + +               P  +L          ++   R    ++  L  G   +Y      + + C +   +  +K  G+K+++ Y++T++ + + V HRY  FDWLY +   K+   I +P LP +QV GRF+ EFI+ R   LQ W++ +  HPV+S S   + F +  D+K+WKI K K + D       ++ V+     LD+ ++ ++ + V+ F       +  + DG +        H  +  G L KE+ KI K    +++  + +  Q +   +L   + + G  Y+ I  L E Q K D  ++     E  G     P I+    GAL  +     + + SK+ ++   N+ + V +++  + AE++   + R +   SV+  +L+ QI+ +  I   L   L  F V
Sbjct:    7 LYDFSAEPGNNELTVKEGEIVTVTNKDVGGGWIEAKNSQGDRGLVPTDYVTIKSP---------------------ASPLPLFTSEGL-LLTLMYVFYNQMFYFLAVDDDEWDDDWDDTKSSPPGYLGSETSETGAAQRGAGRPASMKIP-LNYGPMWVYP----TSTYDCIVADPRKGTKLYGLKSYIEYQLTATNTNRSVNHRYKHFDWLYERLLIKFGLAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMSRMCRHPVISESETFQQFLNFRDEKEWKIGKRKAEKDEIVGSMIFSTVEPEAQDLDMTEVEQKCEAVSRF-------TRAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQTLSQVFSTSGYQGET--ELNSAIIEAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVATSKITQQDKVNMMKRVSVMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALSQFPV 492          
BLAST of Sorting nexin-33 vs. Ensembl Xenopus
Match: snx9 (sorting nexin 9 [Source:NCBI gene;Acc:100145698])

HSP 1 Score: 139.043 bits (349), Expect = 2.722e-34
Identity = 107/409 (26.16%), Postives = 194/409 (47.43%), Query Frame = 3
Query:  348 SSVKIPNS----FLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYP-CIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRF------HKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            +S+KIP S    F K G   +L  K+      +  + +   G   +Y      + + C +   +  +K  G+K+++ Y++T++ + + V HRY  FDWLY +   K+   I +P LP +QV GRF+ EFI+ R   LQ W++ +  HPV+S S   + F +  D+K+WKI K K + D       ++ V+     LD+ ++ ++ + V+ F       +  + DG +        H  +  G L KE+ KI K    +++  + +  Q +   +L   + + G  Y+ I  L E Q K D  ++     E  G     P I+    GAL  +     + + SK+ ++   N+ + V +++  + AE++   + R +   SV+  +L+ QI+ +  I   L   L  F V
Sbjct:  182 ASMKIPLSKFPGFAKSGVDQYLMAKQIPKTKEKIPIIIGDYGPMWVYP----TSTYDCIVADPRKGTKLYGLKSYIEYQLTATNTNRSVNHRYKHFDWLYERLLIKFGLAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMSRMCRHPVISESETFQQFLNFRDEKEWKIGKRKAEKDEIVGSMIFSTVEPEAQDLDMTEVEQKCEAVSRF-------TRAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQTLSQVFSTSGYQGET--ELNSAIIEAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVATSKITQQDKVNMMKRVSVMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALSQFPV 577          
BLAST of Sorting nexin-33 vs. Ensembl Xenopus
Match: snx9 (sorting nexin 9 [Source:NCBI gene;Acc:100145698])

HSP 1 Score: 138.658 bits (348), Expect = 3.546e-34
Identity = 107/409 (26.16%), Postives = 194/409 (47.43%), Query Frame = 3
Query:  348 SSVKIPNS----FLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYP-CIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRF------HKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            +S+KIP S    F K G   +L  K+      +  + +   G   +Y      + + C +   +  +K  G+K+++ Y++T++ + + V HRY  FDWLY +   K+   I +P LP +QV GRF+ EFI+ R   LQ W++ +  HPV+S S   + F +  D+K+WKI K K + D       ++ V+     LD+ ++ ++ + V+ F       +  + DG +        H  +  G L KE+ KI K    +++  + +  Q +   +L   + + G  Y+ I  L E Q K D  ++     E  G     P I+    GAL  +     + + SK+ ++   N+ + V +++  + AE++   + R +   SV+  +L+ QI+ +  I   L   L  F V
Sbjct:  153 ASMKIPLSKFPGFAKSGVDQYLMAKQIPKTKEKIPIIIGDYGPMWVYP----TSTYDCIVADPRKGTKLYGLKSYIEYQLTATNTNRSVNHRYKHFDWLYERLLIKFGLAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMSRMCRHPVISESETFQQFLNFRDEKEWKIGKRKAEKDEIVGSMIFSTVEPEAQDLDMTEVEQKCEAVSRF-------TRAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQTLSQVFSTSGYQGET--ELNSAIIEAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVATSKITQQDKVNMMKRVSVMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALSQFPV 548          
BLAST of Sorting nexin-33 vs. Ensembl Mouse
Match: Snx33 (sorting nexin 33 [Source:MGI Symbol;Acc:MGI:2443239])

HSP 1 Score: 169.474 bits (428), Expect = 6.620e-45
Identity = 108/390 (27.69%), Postives = 185/390 (47.44%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            + F++ G + F+ G   +   I AE   ++ G     QWK   +   C+I+     +K+KGIK++++Y++T +++   V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W++H+T HPVLS     + F S  D K+WK+ K + + D      F    + PT+  D+  + +R+     F      +   LS+      +    G  KE  K+   F  I+ +   +P    D   L   ++  G  Y+ +G +F  Q K D   +   L    G+    P I+ L  GA   +     MS E ++ +E    + R  ++V   + AE++    RR+   + +M  +L+ QI  + ++   L  TL  +D
Sbjct:  187 SCFVRSGVEAFILGDVPMMAKI-AETYSIEMGP-RGPQWKANPHPFACSIEDPTKQTKFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSNVAAELVRKHVGGFRKEFQKLGSAFQAISHAFQMDPPFRSDA--LNNAISHTGRTYETVGEMFAEQPKHDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMAQEEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQSYLRQQILFYQRVGQQLEKTLHMYD 572          

HSP 2 Score: 54.6842 bits (130), Expect = 3.016e-7
Identity = 41/123 (33.33%), Postives = 59/123 (47.97%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLSVISPRMMSSVKIPNSFLKGGGQNFL 401
            K +ALYD+   + E+I    DE L+I      +GW +G+N+R E G+ P+SY E++ P  I +  VD           S+ P  +   +GS    L S  SP M S  +       GGG  FL
Sbjct:    4 KGRALYDFHSENKEEISIQQDEELVIFSETSLDGWLQGQNSRGETGLFPASYVEIVRP-GISTNHVD----------YSNSPAGSLGTQGS----LYS--SPSMASPAR------SGGGSGFL 103          
BLAST of Sorting nexin-33 vs. Ensembl Mouse
Match: Snx18 (sorting nexin 18 [Source:MGI Symbol;Acc:MGI:2137642])

HSP 1 Score: 162.155 bits (409), Expect = 3.646e-42
Identity = 111/395 (28.10%), Postives = 185/395 (46.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF---SESDXXXXXXXXXXXXNDVFKNGGFYNAVKA-PTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S   +D +    VL  G +   +W++      C ID     +K+KG+K++++Y++  +++   V  RY  FDWLY++ AEK+P I VP LP +Q  GRF+ +FI  RR  L  W+NH+  HPVL+     + F    S +D+K WK  K K + D      F+  +   P   LD+ ++  ++     F      ++  L+     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G+AY  IG LF  Q + D   V   L    G     P I+ +  GAL  +        E K++ +    +      ++    AE+      R    +S M   L+ QI  F ++T  L + L  +D
Sbjct:  224 STFVKSGGEAFVLGEASGFVKDGDKLCVVL--GPYGP-EWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAF--ELDQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKYD 613          
BLAST of Sorting nexin-33 vs. Ensembl Mouse
Match: Snx9 (sorting nexin 9 [Source:MGI Symbol;Acc:MGI:1913866])

HSP 1 Score: 135.961 bits (341), Expect = 3.328e-33
Identity = 107/409 (26.16%), Postives = 183/409 (44.74%), Query Frame = 3
Query:  348 SSVKIP----NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKY-PCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRF------HKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            SS+K+P      F K G + +L  K+      +  + V   G   +Y    F     C +   +  SK  G+K+++ Y++T + + + V HRY  FDWLY +   K+   I +P LP +QV GRF+ EFI+ R   LQ W+  +  HPV+S S   + F +  D+K+WK  K K + D       ++ ++     LD+ +I ++   V  F          + DG +        H  +  G L KE+ KI K    +    + +  Q +   DL   + + G  Y+EI  L   Q K D  F+     E  G     P I+    GA+  +     + + SK+  +  + + + V  ++  + AE++   + R +   SV+  +L+ Q++ +  I   L   L  F V
Sbjct:  199 SSMKLPLNKFPGFAKPGMEQYLLAKQLAKPKEKIAIIVGDYGPMWVYPTSTF----DCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVVSESEVFQQFLNFRDEKEWKTGKRKAEKDELVGVMIFSTMEPEAPDLDLIEIEQKCDAVGKFTK-------AMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLAAVFSSSGYQGE--TDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGAHKGAIEKVKESDKLVATSKITPQDKQTMVKRVGTMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPV 594          
BLAST of Sorting nexin-33 vs. Ensembl Mouse
Match: Snx30 (sorting nexin family member 30 [Source:MGI Symbol;Acc:MGI:2443882])

HSP 1 Score: 71.633 bits (174), Expect = 9.963e-13
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = 3
Query:  495 NRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGR----QVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESD 824
             +H C +++Y +  +     T V +++   YS ++   RY  FDWL ++  E  P  ++PPLP +     V  RF  EF+E+RR  L  +L  IT+HPVLS +    +F +  D
Sbjct:   99 KKHVCTMETY-ITYRITTKSTRVEFDL-PEYSVRR---RYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNVFLTAKD 207          
BLAST of Sorting nexin-33 vs. Ensembl Mouse
Match: Snx7 (sorting nexin 7 [Source:MGI Symbol;Acc:MGI:1923811])

HSP 1 Score: 68.5514 bits (166), Expect = 8.438e-12
Identity = 35/106 (33.02%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  531 DSKYKGIKTFVNYEITSSYSTKK-------VVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAG----RFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFS 815
            +S    I+TF+ Y I +  S  +       V  RY  F WL  +  E +P +++PPLP + +      RF  +FIE+RR  L  +LN I +HP L+ +   K+F +
Sbjct:   90 ESHVTTIETFITYRIVTKTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDFKVFLT 195          
BLAST of Sorting nexin-33 vs. UniProt/SwissProt
Match: sp|Q4VAA7|SNX33_MOUSE (Sorting nexin-33 OS=Mus musculus OX=10090 GN=Snx33 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.631e-44
Identity = 108/390 (27.69%), Postives = 185/390 (47.44%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            + F++ G + F+ G   +   I AE   ++ G     QWK   +   C+I+     +K+KGIK++++Y++T +++   V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W++H+T HPVLS     + F S  D K+WK+ K + + D      F    + PT+  D+  + +R+     F      +   LS+      +    G  KE  K+   F  I+ +   +P    D   L   ++  G  Y+ +G +F  Q K D   +   L    G+    P I+ L  GA   +     MS E ++ +E    + R  ++V   + AE++    RR+   + +M  +L+ QI  + ++   L  TL  +D
Sbjct:  187 SCFVRSGVEAFILGDVPMMAKI-AETYSIEMGP-RGPQWKANPHPFACSIEDPTKQTKFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSNVAAELVRKHVGGFRKEFQKLGSAFQAISHAFQMDPPFRSDA--LNNAISHTGRTYETVGEMFAEQPKHDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMAQEEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQSYLRQQILFYQRVGQQLEKTLHMYD 572          

HSP 2 Score: 54.6842 bits (130), Expect = 2.110e-6
Identity = 41/123 (33.33%), Postives = 59/123 (47.97%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLSVISPRMMSSVKIPNSFLKGGGQNFL 401
            K +ALYD+   + E+I    DE L+I      +GW +G+N+R E G+ P+SY E++ P  I +  VD           S+ P  +   +GS    L S  SP M S  +       GGG  FL
Sbjct:    4 KGRALYDFHSENKEEISIQQDEELVIFSETSLDGWLQGQNSRGETGLFPASYVEIVRP-GISTNHVD----------YSNSPAGSLGTQGS----LYS--SPSMASPAR------SGGGSGFL 103          
BLAST of Sorting nexin-33 vs. UniProt/SwissProt
Match: sp|Q8I4E2|LST4_CAEEL (Sorting nexin lst-4 OS=Caenorhabditis elegans OX=6239 GN=lst-4 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 9.506e-44
Identity = 112/393 (28.50%), Postives = 188/393 (47.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEV-LKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYST--KKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K G + ++ G+      I    EV +  GI    QWK     +TC +D  K +SK KG+K+F+ Y ITSS +   ++V  RY  FDWL+ Q + KY  I +PPLP +QVAGR++ + I+ R+ +LQ W+N I  HPVLS S     F S +D+K WK  K + + D +  G F N +  P   LD   +  ++++    +         + +    F K     + +   K+   F  + +S     D+    + LT+ L    + Y EIG +F++  K D   V  NL    G  + +P I+++   A+          SE +L     + + + +  ++ TV AE+      +   M+S M  +LK Q   + ++   L+     +D
Sbjct:  184 SNFVKSGVEAYVIGESKTTSQISERHEVVMNNGII---QWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSF--EIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFR-----DSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 566          
BLAST of Sorting nexin-33 vs. UniProt/SwissProt
Match: sp|Q8WV41|SNX33_HUMAN (Sorting nexin-33 OS=Homo sapiens OX=9606 GN=SNX33 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.654e-43
Identity = 109/393 (27.74%), Postives = 188/393 (47.84%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWF---IDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            + F++ G + F+ G   +   I AE   ++ G     QWK   +   C+++     +K+KGIK++++Y++T +++   V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W++H+T HPVLS     + F S  D K+WK+ K + + D      F    + PT+  D+  + +R+     F   +DD       ++    R H     G  KE  K+   F  I+ S   +P    +   L   ++  G  Y+ IG +F  Q K D   +   L    G+    P I+ L  GA   +     MS E ++ ++    + R  ++V   + AE++    RR+   + +M  +L+ QI  + ++   L  TL+ +D
Sbjct:  187 SCFVRSGVEAFILGDVPMMAKI-AETYSIEMGP-RGPQWKANPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHV---GGFRKEFQKLGSAFQAISHSFQMDPPFCSEA--LNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYD 572          
BLAST of Sorting nexin-33 vs. UniProt/SwissProt
Match: sp|Q6NRL2|SNX33_XENLA (Sorting nexin-33 OS=Xenopus laevis OX=8355 GN=snx33 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.335e-41
Identity = 104/394 (26.40%), Postives = 181/394 (45.94%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIY----QWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            +SF++ G + F+ G      D+     V +    E+     QWK       C+++     +K+KGIK++++Y +T  +S   V  RY  FDWLY++   K+  I +P LP +Q  GRF+ +FI+ R+  L  W++H+T HPVLS     + F    D+K+WK  K + + D      F   ++ PT+  D+  + ER+     F      +   LS       +    G  KE  K+   F  ++ S   +P  +   + L   ++  G  Y+ +G +F  Q K D       L    G+    P I+ L  GA   +     MS E +++++    V +  ++V   + AE++    RR    +  +  +LK QI  + +++  L  TL  +D
Sbjct:  163 SSFVRSGVEAFVLG------DVPQFGGVAESHAIEMAPKGPQWKANPRPFNCSVEEPTKQTKFKGIKSYISYRLTPDHSNSPVYRRYKHFDWLYNRLLHKFTVISLPHLPEKQATGRFEEDFIQKRKRRLVLWMDHMTSHPVLSQYDGFQHFLGCQDEKQWKAGKRRAERDELVGASFLLTLQLPTEHQDLQDVEERVDVFKAFSKKMDESVLQLSSVVSELARKHLGGFRKEFQKLGAAFQGLSHSFQLDPPYS--SEPLVGAISHTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKDSQRMSDEGRMEQDEADGVRKRCRVVGFALQAEINHFHQRRLLDFKQAIQHYLKEQIIFYRRVSQELEKTLHLYD 548          
BLAST of Sorting nexin-33 vs. UniProt/SwissProt
Match: sp|Q28GP7|SNX33_XENTR (Sorting nexin-33 OS=Xenopus tropicalis OX=8364 GN=snx33 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.707e-41
Identity = 102/390 (26.15%), Postives = 181/390 (46.41%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            +SF++ G + F+ G       + +E   ++ G  +  QWK      +C+++     +K+KGIK++++Y +T       V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FI+ R+  L  W++H+T HPVLS     + F S  D+K+WK  K + + D      F   ++ PT+  D+  + ER+     F      N   LS       +    G  KE  ++      ++ S   +P  + +   L   ++  G  Y+ +G +F  Q K D       L    G+    P I+ L  GA   +     MS E +++++    + +  ++V   + AE++    RR    +  +  +LK QI  + +++  L  TL  +D
Sbjct:  162 SSFVRSGVEAFVLGDVPQFGGV-SESHAIEMGP-KGPQWKANPRPFSCSVEEPTKQTKFKGIKSYISYRLTPDPCNSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIQKRKRRLVLWMDHMTSHPVLSQYDGFQHFLSCQDEKQWKAGKRRAERDELVGASFLLTLQLPTEHQDLQDVEERVDVFKAFSKKMDENVLQLSSVVSELARKHLGGFRKEFQRLGAALQGLSHSFQLDPPYSSE--PLVGAISHTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMEQDEADGIRKRCRVVGFALQAEINHFHQRRLQDFKQAIQHYLKEQILFYRRVSQELEKTLHMYD 547          
BLAST of Sorting nexin-33 vs. TrEMBL
Match: A0A3B4BQ72 (Sorting nexin OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 7.330e-57
Identity = 156/553 (28.21%), Postives = 247/553 (44.67%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELI----------------------SPFEIESTTV--------------------DNQXXXXXXXXXXXEPVPTEN---RKGSDSPRLLSVISPRMMSSVKIP----NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERL---KKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            KAKALY +   + E+I    +E L+I D N  +GW RG N+R E G+ P+SY E+I                      SP+ + ST+                     D      +       P P  N   R      R  S+ S R  S V       +SF++ G + F+ G   +   I AE   ++ G  +  QWK+      C+I+     +K+KGIKT+++Y +T S++ + V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W+NH+T HPVLS     + F    D K+WK+ K + + D      F   +  P +  D+  + ER+   K  A  +DD       ++    R H     G  KE  ++   F  I+++   +P  + D   L   ++  G  Y+ IG +F  Q K D   +   L    G+    P I+ L  GA   +     MS E K+D+E    + +  + V   + AE++   +RR+   + +M  +L+ QI  + ++   L  TL  +D
Sbjct:    4 KAKALYTFQSENKEEISIQENEELVIFDENSVDGWLRGENSRGERGLFPASYVEIIRPRSNSNLTDCSLSPAGSPGKDSPYFLHSTSYDDDDDDWDDWDDSSTVVEDEDPHRAVGANGHAHQTPYPNPNVHYRAKPHMERQDSISSSRKGSMVGRNLNRFSSFVRSGVEAFVLGDVPMMAKI-AESYCIEMGP-QGPQWKESPQPFCCSIEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMNHMTSHPVLSQYEGFEHFLMCGDDKQWKLGKRRAEKDEMVGAHFMLTLHIPNEHQDLQDVEERIDSFKAFAKKMDDSVMQLTHVTSELVRKHL---GGFRKEFQRLGNAFQSISQAFMLDPPCSSD--TLNNAISHTGRTYENIGEMFAEQPKYDLFHMLDKLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGKMDQEEADGIRKRCRTVGFALQAEMNHFHHRREVDFKEMMQAYLRQQIAFYQRVGQQLERTLHMYD 549          
BLAST of Sorting nexin-33 vs. TrEMBL
Match: A0A1S3H3H5 (Sorting nexin OS=Lingula unguis OX=7574 GN=LOC106151671 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 8.166e-57
Identity = 135/397 (34.01%), Postives = 209/397 (52.64%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRF-HKYQN-----EGMLK-EHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G  SVAR  E E+  + E   E + W+   +  TCN+ S K +SK+KG+K+F+ Y+IT ++S  +V  RY QFDWL+ +   K+PCIVVPPLP +QV GRF+ EFI+ R   LQ W++ + +HPV+S S     F + +D+K+WK  K K + D F+ G F   ++ P   LD      +       ID++ + +  + DG R   H +Q+     +G  K E  KI     ++  S  +  D++     LT  +   G  Y EIG LFE Q K DS  V   L E  GI +  P +L     A+  +  C     E K+ E   + V +   +V+ +V AE++  Q+ R    + +   +LK QIE   +IT  L + L  ++
Sbjct:  217 STFVKTGGEAFMLGTTSVARVPENEMVKIIE-TSEGFMWEPNPHPFTCNVASPKKESKFKGMKSFIAYQITPTFSGIQVSRRYKQFDWLHKRLEIKFPCIVVPPLPDKQVTGRFEEEFIQERMRQLQEWIDRLVKHPVVSRSETFIHFLTTTDEKQWKQGKRKAEKDEFQGGKFMLTIQVPPQPLDATDTEAK-------IDEFGKFTKNMEDGCRHLMHVFQDNARKHQGPFKREFQKIGNSITNLASSF-EMADESYSA-PLTDAIKYTGKTYDEIGGLFEQQPKFDSYSVIETLHEYKGILQAFPEVLTTHKAAMTKVRECQKSQEEGKMSESDYQAVVQRGDIVSYSVLAEINHFQHERAVDYKMMFQNYLKAQIEFHKKITTKLEEALNRYN 603          
BLAST of Sorting nexin-33 vs. TrEMBL
Match: K7J7C0 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 GN=100117499 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.559e-56
Identity = 153/546 (28.02%), Postives = 257/546 (47.07%), Query Frame = 3
Query:   21 MSERKAKALYDYS--PSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXX-----------------XXXXEPV---PTENRKGSDSPRLLSVISPRMMSSV----KIPN---------SFLKGGGQNFLFGKKSVARDIEAE---VEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFI---DDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            M   + +ALYD+S  P SAE +   A E+L ++  N+ +GW  G N   + G+ P++Y +LI   E  + T  N  ++                          PV   P+     S S      +S   + SV     IPN         + +K G + FL   K V    E+E   VE ++ G F    W Q G  + C + S K +SK KG+K+F+ Y++T +++  +V  RY  FDWL+ +  EK+  I +PPLP +Q++GR++ +FIE RR  LQ +++++  HPVLS S   + F + +D+K+WK  K   + D F    +++ V+ P   LD  K+  +    A FI   D   ++   ++    + H+   +   +E  KI + F+ +  +L  + D  +    L Q L   G AY EIG L+E Q K D   +        GI    P ++ +   A+     C  + +E K++   ++ ++    ++ R + AE +  Q+ R+  +   M  HL  QI  + +I   L + L +FD
Sbjct:    1 MDGHQVRALYDFSGEPGSAE-LSITAGEVLTVMRDNVGDGWCEGFNQGGQSGLFPAAYVQLI---EATAPTTGNMVNSQQSTGDYWDDDWDDDSEIGQTQAYVPPVQQQPSLQSAQSGSTEYGDSVSMHTVHSVIPERSIPNVPKKNNKFTALVKSGEEGFLLSSKLVVVP-ESEKIYVEEVESGRFS---WAQTGESYNCVVTSPKKESKLKGLKSFIVYQLTPTFNNIQVSRRYKHFDWLHERLEEKFCFIPIPPLPDKQISGRYEEQFIEHRRTQLQEFVDYVCRHPVLSRSRVWQHFITCTDEKRWKAGKRAAEKDEFLGVTYFHGVQCPDTPLDAIKVEFQTDAFARFIAGLDPVVKSFMAMATDQAKKHQVLYK---REFQKIGQCFVSLGNALEAD-DAGRSRHTLNQALKDTGEAYNEIGKLYEEQPKYDWEPLADKFHIYRGIISSFPDVIGIHKSAVQKRKDCERLVNEHKMESAQLRELNHRTDVIARALGAEETHFQSEREIHITQAMKSHLVEQINFYQKIVDKLQEALNSFD 534          
BLAST of Sorting nexin-33 vs. TrEMBL
Match: V4BYZ5 (Sorting nexin OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215869 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 4.661e-56
Identity = 151/556 (27.16%), Postives = 268/556 (48.20%), Query Frame = 3
Query:   21 MSERKAKALYDY-SPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELIS----------------PFEIESTTVDN-----------------------QXXXXXXXXXXXEPVPTENRKGSDSPRLLSVISPR--------MMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIY---QWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            M+  +A+ LY +   +S  +I F ADEIL I+  +I EGW   R    E+G+IP +Y EL+S                   +++ T +N                        S      ++++EP  T N   S   R    ISP         + SS    + F+K GG  ++ G+  V  ++  E +++K  I E     +W    + +TC + S K +SK KG+K+F+ Y +T S+S  +V  RY  FDWL+ +  EK+ CI +P LP +Q++GR++ +FI+ R  +LQ W++ +  HPV+++S  +  F + ++ KKWK  K K + D +  G F+  ++ P    D+  +  +++    F+ +   N   +      F K       +E  KI   + +++ + A   ++      LT+ ++ +G++Y  IG +FE Q   D   +  +L E  GI +  P +L++  GA+     C+ +  E K+ +  ++NV +    ++    AE+    + R    + +M  +LK+QIE + QIT+ L  +L  FD
Sbjct:    1 MAAVQARGLYQFDGDASNGEISFLADEILTIVRQDIGEGWWEARKETGEQGLIPETYVELLSIPEPQFPPPPPPNFPVDLPVQTPTYNNVNHGDGQTEDWDDEWDDDDDQSSNSTAKQSYNNNNEPQGTGNFGLSAPKRERKQISPTSDMSKYGTVKSSFNRFSHFVKLGGDAYIMGQ--VNHEVR-ETDLIK--IIETNDGPEWTPLQSPYTCTVSSPKKESKMKGLKSFITYHLTPSFSNIQVSRRYKHFDWLHERLVEKFICIPIPALPDKQISGRYEEDFIQERMRMLQQWIDRMVRHPVIAHSDVMLHFLTCTNDKKWKEGKRKAEKDPYLAGKFFLCLQTPPHSCDMKAVEAQMEVFCRFVMNMNENCKSIIAINNDFSKKHMGPFKREFQKIGHSYKNLSTTFAL--EEGAYSLQLTKAIDFMGDSYCSIGDMFEKQPPKDLFPLIESLSEYRGILQTYPDVLKVHEGAVGKTKDCLKLQEEGKMTDGEVQNVMQRADTISFGTLAEMHNFHHERVKDYKDMMQNYLKSQIEFYKQITSKLEASLAMFD 549          
BLAST of Sorting nexin-33 vs. TrEMBL
Match: A0A232EK67 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_008357 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 6.600e-56
Identity = 151/546 (27.66%), Postives = 256/546 (46.89%), Query Frame = 3
Query:   21 MSERKAKALYDYS--PSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXX-----------------XXXXEPV---PTENRKGSDSPRLLSVISPRMMSSV----KIPN---------SFLKGGGQNFLFGKKSVARDIEAE---VEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFI---DDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            M   + +ALYD+S  P SAE +   A E+L ++  N+ +GW  G N   + G+ P++Y +LI   E  + T  N  ++                          PV   P+     S S      +S   + SV     IPN         + +K G + FL   K V    E+E   VE ++ G F    W Q G  + C + S K +SK KG+K+F+ Y++T +++  +V  RY  FDWL+ +  EK+  I +PPLP +Q++GR++ +FIE RR  LQ +++++  HPVLS S   + F + +D+K+WK  K   + D      +++ ++ P   LD  K+  +    A FI   D   ++   ++    + H+   +   +E  KI + F+ +  +L  + D  +    L Q L   G AY EIG L+E Q K D   +        GI    P ++ +   A+     C  + +E K++   ++ ++    ++ R + AE +  Q+ R+  +   M  HL  QI  + +I   L + L +FD
Sbjct:    1 MDGHQVRALYDFSGEPGSAE-LSITAGEVLTVMRDNVGDGWCEGFNQGGKSGLFPAAYVQLI---EATAPTTGNMVNSQQSTGDYWDDDWDDDSEIGQTQAYVPPVQQQPSLQSAQSGSTEYGDSVSVHTVHSVIPERSIPNVPKRNNKFTALVKSGEEGFLLSSKLVVVP-ESEKIYVEEIESGCFS---WAQTGESYNCVVTSPKKESKLKGLKSFIVYQLTPTFNNIQVSRRYKHFDWLHERLEEKFCFIPIPPLPDKQISGRYEEQFIEHRRTQLQEFVDYVCRHPVLSRSRVWQHFITCTDEKRWKAGKRAAEKDELLGVTYFHGIQCPDTPLDAIKVEFQTDAFARFIAGLDPVVKSFMAMATDQAKKHQVLYK---REFQKIGQCFVSLGNALEAD-DAGRSRHTLNQALKDTGEAYNEIGKLYEEQPKYDWEPLADKFHIYRGIISSFPDVIGIHKSAVQKRKDCERLVNEHKMESAQLRELNHRTDVIARALGAEETHFQSEREIHITQAMKSHLVEQINFYQKIVNKLQEALNSFD 534          
BLAST of Sorting nexin-33 vs. Ensembl Cavefish
Match: snx33 (sorting nexin 33 [Source:NCBI gene;Acc:103035633])

HSP 1 Score: 176.022 bits (445), Expect = 1.956e-47
Identity = 120/422 (28.44%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  285 TENRKGSDSPRLLSVISPRMMSSVKIPNSFLKGGGQNFLFGK-KSVARDIEA-EVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERL---KKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            + +RKGS   R L+  S           SF++ G + F+ G    +A+  EA  +E+   G     QWK+      C+++     +K+KGIKT+++Y +T S++ + V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W++H+T HPVLS     + F    D K+WK+ K + + D      F   +  P +  D+  + ER+   K  A  +DD       ++    R H     G  KE  ++   F  I+++   +P  + D   L   ++  G  Y+ IG +F  Q K D   +   L    G+    P I+ L  GA   +     MS E K+D++    + +  + V   + AE++    RR+   + +M  +L+ QI  + ++   L  TL  +D
Sbjct:  148 SSSRKGSMVGRNLNRFS-----------SFVRSGVEAFVLGDVPMMAKIAEAYSIEMGPRGP----QWKESPQPFCCSVEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFEHFLMCGDDKQWKLGKRRAEKDEMVGAHFMLTLHIPNEHQDLQDVEERIDTFKSFAKKMDDSVLQLTHVASELVRKHL---GGFRKEFQRLGNSFQSISQAFMLDPPYSSDA--LNNAISHTGRTYENIGEMFAEQPKFDLFHMLDKLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGKMDQDEADGIRKRCRTVGFALQAEMNHFHQRREVDFKEMMQAYLRQQIAFYQRVGQQLERTLHMYD 549          

HSP 2 Score: 56.225 bits (134), Expect = 7.705e-8
Identity = 25/58 (43.10%), Postives = 37/58 (63.79%), Query Frame = 3
Query:   33 KAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISP 206
            KAKALY +   + E+I    +E L+I + N  +GW RG N+R E G+ P++Y E+I P
Sbjct:    4 KAKALYTFQSENKEEISIQENEELLIFEENSVDGWLRGENSRGERGLFPATYVEIIRP 61          
BLAST of Sorting nexin-33 vs. Ensembl Cavefish
Match: snx18a (sorting nexin 18 [Source:NCBI gene;Acc:103026104])

HSP 1 Score: 172.94 bits (437), Expect = 3.227e-46
Identity = 108/393 (27.48%), Postives = 190/393 (48.35%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF--SESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S   +D +    V+ +   E   W++     +C ID     +K+KG+K++++Y++T +++  +V  RY  FDWLY++  EK+P I VP +P +Q  GRF+ +FI  RR  L  W+NH+T HPVL+     + F   S +D+K WK  K K + D      F+  +  P   LD+ ++  ++     F      +   ++     F + Q  G  KE+ K+ + F  ++++     DQ      L Q +   G AY+ IG  F  Q K D   V   L    G     P I+ +  GAL  +        E K++ +    ++    +++    AE+    + R    ++ M  +L+ QI  F ++T  L + L+ +D
Sbjct:  198 STFVKSGGEAFVLGEASGFVKDGDKICVVMGQYGPE---WQENPYPFSCTIDDPTKQTKFKGMKSYISYKLTPTHTQSQVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLARCDVFQHFLTCSSTDEKAWKQGKRKAEKDEMVGANFFLTISTPAAPLDLQEVESKIDGFKAFTKKMDDSVIQVNATLNEFARKQIAGFKKEYQKVGQSFKYLSQAF--ELDQQAYSTGLNQAIAYTGEAYEAIGDYFAEQPKQDVDPVMDLLALYQGHLANYPDIIHVQKGALTKVKESQKHVEEGKMERQQADGINERCNIISFATLAEIQHFHHIRVRDYKAQMQHYLQQQISFFQKVTGKLEEALRKYD 585          
BLAST of Sorting nexin-33 vs. Ensembl Cavefish
Match: snx18b (sorting nexin-18-like [Source:NCBI gene;Acc:103036978])

HSP 1 Score: 165.236 bits (417), Expect = 1.279e-43
Identity = 113/392 (28.83%), Postives = 185/392 (47.19%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF--SESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ S     E ++ V+  G F   +W+Q     TC ID     +K+KG+K++++Y +T S++  +V  RY  FDWLY++  E++P I VP LP +Q  GRF+ +FI  RR  L  W+NH+T HPVLS     + F   S +D+K WK  K K + D      F+  +  P   LD+ ++  ++     F      N   ++     F + Q  G  KE+ ++ + F  + ++     DQ +    L Q +     AY+ IG  F  Q + D   V   L    G     P I+ +  GAL         S E    ++    +     +++    AE+      R    ++ M  +L+ QI  + +IT  L +TL  FD
Sbjct:  183 STFVKSGGEAFVLGEASGFVREEDKICVVM-GQFGP-EWQQNPVPFTCTIDDPTKQTKFKGMKSYMSYGLTPSHTQSQVNRRYKHFDWLYARLVERFPVISVPHLPEKQATGRFEEDFITKRRKGLVWWMNHMTTHPVLSRCDVFQHFLTCSSTDEKAWKQGKRKAERDCLVGANFFLTIVPPVAPLDLQEVESKVDGFKAFAKKMDENLTQVNVTLGEFARKQVTGFRKEYQRVGQAFQLLGQAF--ELDQQEYSVKLNQAIGFTSQAYEAIGDYFAEQPRQDLEPVSDLLAIYQGHLANFPDIIHVQKGALTKTKESQRHSEE----KDGPAGIHERCNIISCATLAEMQHFHRTRVRDFKAQMQHYLQQQIIFYQRITGKLEETLHMFD 566          
BLAST of Sorting nexin-33 vs. Ensembl Cavefish
Match: snx9a (sorting nexin-9-like [Source:NCBI gene;Acc:103023149])

HSP 1 Score: 150.984 bits (380), Expect = 6.390e-39
Identity = 125/522 (23.95%), Postives = 226/522 (43.30%), Query Frame = 3
Query:   33 KAKALYDYSPSSAE-DIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLS----------------VISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPC-IVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWF---IDDYYRNSCCLSDGFRRFHKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNF 1532
            KA+ LYD++      ++     E+L +++  +  GW   +N++ + G++P  Y + I+  E   T    Q+   S D    +    E    S SP   S                   PR +S  K P        + +L      A +    + + + G   +Y   Q      C +   K  +K  G+K+++ Y+I  + + K V HRY  FDWLY +  EK+ C I +P LP +QV GRF+ EFI+ R   LQ W++ +  HPV+SNS   ++F +  D+K WK  K K + D       ++ +      LD  ++ ++ +  + F   +DD  ++   +       H  +  G L KE+ +I K F  ++     N    Q    LT  L   G  Y+EI  +   Q K D  F+     E  G+    P ++ +   A+  +     + + +K+  +  + + + +  ++  + AE++   + R +    VM  +L+ Q++ +  I   L   L  +
Sbjct:    4 KAQVLYDFTAEPGNNELSVQEGEMLTVMNQAVGGGWVEAQNSKGQTGLVPEDYIQQINNSEASGTQQPAQAYQGSIDYYDDDGEWDEESDDSKSPSGYSWSQSDGGGGAAQQGAAAHHPRKISLNKFPGLSKTPNPEVYLLKNYMCAENDRLPIYMGEVGPVWLYPQTQL----DCVVAHPKKGTKMYGLKSYIEYQIAPNTTHKSVNHRYKHFDWLYERLLEKFGCAIPIPSLPDKQVTGRFEDEFIKMRMERLQGWMSRMCRHPVVSNSEVFQLFLTYKDEKDWKEGKRKAEKDERVGVMVFSTMDPEMRELDPTEVEKKCETFSHFSRSMDDGVKDLLAVG----HLHWKRCAGPLQKEYQRIGKAFQSLSSVF--NTSAYQGEATLTDALTATGKTYEEIAEIVAGQPKKDLHFLLETNNEYKGLLGCFPDLIGVHRAAIEKVKEADRLVAMNKIGPQDKQTMQKNLSTMSYALQAEMNHFHSNRIYDYNRVMQLYLQEQVQFYETIAGKLKHALSQY 515          
BLAST of Sorting nexin-33 vs. Ensembl Cavefish
Match: snx9a (sorting nexin-9-like [Source:NCBI gene;Acc:103023149])

HSP 1 Score: 134.035 bits (336), Expect = 6.762e-33
Identity = 117/468 (25.00%), Postives = 204/468 (43.59%), Query Frame = 3
Query:   33 KAKALYDYSPSSAE-DIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLS----------------VISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPC-IVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWF---IDDYYRNSCCLSDGFRRFHKYQNEGML-KEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKL---DEETIK 1361
            KA+ LYD++      ++     E+L +++  +  GW   +N++ + G++P  Y + I+  E   T    Q+   S D    +    E    S SP   S                   PR +S  K P        + +L      A +    + + + G   +Y   Q      C +   K  +K  G+K+++ Y+I  + + K V HRY  FDWLY +  EK+ C I +P LP +QV GRF+ EFI+ R   LQ W++ +  HPV+SNS   ++F +  D+K WK  K K + D       ++ +      LD  ++ ++ +  + F   +DD  ++   +       H  +  G L KE+ +I K F  ++     N    Q    LT  L   G  Y+EI  +   Q K D  F+     E  G+    P ++ +   A+  +     + + +K+   D++T++
Sbjct:    4 KAQVLYDFTAEPGNNELSVQEGEMLTVMNQAVGGGWVEAQNSKGQTGLVPEDYIQQINNSEASGTQQPAQAYQGSIDYYDDDGEWDEESDDSKSPSGYSWSQSDGGGGAAQQGAAAHHPRKISLNKFPGLSKTPNPEVYLLKNYMCAENDRLPIYMGEVGPVWLYPQTQL----DCVVAHPKKGTKMYGLKSYIEYQIAPNTTHKSVNHRYKHFDWLYERLLEKFGCAIPIPSLPDKQVTGRFEDEFIKMRMERLQGWMSRMCRHPVVSNSEVFQLFLTYKDEKDWKEGKRKAEKDERVGVMVFSTMDPEMRELDPTEVEKKCETFSHFSRSMDDGVKDLLAVG----HLHWKRCAGPLQKEYQRIGKAFQSLSSVF--NTSAYQGEATLTDALTATGKTYEEIAEIVAGQPKKDLHFLLETNNEYKGLLGCFPDLIGVHRAAIEKVKEADRLVAMNKIGPQDKQTMQ 461          
BLAST of Sorting nexin-33 vs. Ensembl Sea Lamprey
Match: snx18b (sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213-6])

HSP 1 Score: 149.828 bits (377), Expect = 6.032e-39
Identity = 108/409 (26.41%), Postives = 182/409 (44.50%), Query Frame = 3
Query:  372 FLKGGGQNFLFGKKS---VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKA-PTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEG----------MLKEHS--------KISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNF 1532
            ++K GG+ F+ G  +   V       V++   G      W       TC+I+     +K+KG+K+F++Y +T +++ + V  RY  FDWLY +  +K+P + VP LP +Q  GRF  +F++ RR  L  W+NH+T HPVL+   A + F + +D+K WK  K + + D      FY  + A PT  LD+  +  R                  +D FR F K  +E           M ++H         K+ + F ++ +S  ++     D  +LT+ +   GN Y  IG LF  Q + D   +        G+    P I+ +  GA+  +      + E K+D   +  V      V+    AE +     R      +M  +L+ QI  +  I   L ++L+ +
Sbjct:  161 YVKAGGEAFISGDVTGCTVNVGDRVRVDIADRGP----AWPDNPFPFTCSIEDPTKQTKFKGMKSFISYRLTPTFTGRAVSRRYKHFDWLYGRLVQKFPVVSVPHLPEKQATGRFVEDFVQKRRRGLILWMNHMTGHPVLAQCDAFQHFLTCTDEKAWKQGKRRAEKDDAVGAKFYLTISAPPTSHLDLQDVEAR------------------TDSFRSFSKRMDESVVLLNGTAGEMARKHCIDYKRDFQKMGQVFENLGQSFEQDDQHYSD--NLTKAITHTGNTYVAIGELFAQQPQQDLQPLMDVTCLYQGLLANFPDIIHIQKGAVAKVKESQRAADEGKMDAGQLTEVQTRTNTVSHATLAEFNHFHCTRVKDFGQIMQLYLQQQIAFYQAIAGRLDESLQKY 545          

HSP 2 Score: 50.8322 bits (120), Expect = 6.307e-7
Identity = 19/60 (31.67%), Postives = 35/60 (58.33%), Query Frame = 3
Query:   21 MSERKAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELI 200
            M  R+A+ALYD+   +  +I     ++L + +  + +GW  G N+R E G+ P++Y E +
Sbjct:    1 MVSRRARALYDFQSENEGEISIRERDVLTVFNEGVGDGWFEGTNSRGERGLFPATYVEFL 60          
BLAST of Sorting nexin-33 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001438.1 (pep scaffold:Pmarinus_7.0:GL485280:2234:11313:-1 gene:ENSPMAG00000001299.1 transcript:ENSPMAT00000001438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.472e-17
Identity = 43/127 (33.86%), Postives = 64/127 (50.39%), Query Frame = 3
Query:  477 QWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKK----------VVHRYNQFDWLYSQFAEKYPCIVVPPLPGR-QVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESD 824
            +W     R TC + +    SK+ GIK+++ YE+T+S +             V  RY QF WL ++  EK+P +VVP LPG    A R+  E +  R   L  WL H+T HP L+    ++ F +  D
Sbjct:    2 EWLDDPARFTCAVSAPSKRSKFGGIKSYLAYELTTSSAAAAAAADSPAPSPVWRRYKQFAWLRARLEEKFPAVVVPRLPGTLPAAARYAPECVRRRVGELSLWLEHVTGHPALAGCDVLRHFLTCGD 128          
BLAST of Sorting nexin-33 vs. Ensembl Sea Lamprey
Match: snx30 (sorting nexin family member 30 [Source:NCBI gene;Acc:550496])

HSP 1 Score: 63.1586 bits (152), Expect = 6.739e-11
Identity = 37/114 (32.46%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  525 KVDSKYK---GIKTFVNYEIT-----SSYSTKKVV--HRYNQFDWLYSQFAEKYPCIVVPPLPG----RQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESD 824
            +VDS  K    ++T++ Y +T     S Y   + V   RY  FDWL ++  E  P  ++PPLP     + V  RF  +F+ +R+  L  +LN +  HP LS S     F +  D
Sbjct:   29 RVDSPEKHVTAMETYITYRVTVRTTRSEYDGMEFVVRRRYQDFDWLRTKLEETQPTHIIPPLPEKFVMKGVVDRFTEDFVTTRQKALDKFLNRLANHPTLSFSSYFHSFLTAKD 142          
BLAST of Sorting nexin-33 vs. Ensembl Sea Lamprey
Match: snx3 (sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-921])

HSP 1 Score: 53.1434 bits (126), Expect = 4.923e-9
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  600 VVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVA---------GRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSE 818
            V  RY+ F+WL ++  E+   IVVPPLPG+            G F   FI  RR  L+ ++N I  HP+  N   + MF  +
Sbjct:   14 VRRRYSDFEWLKNEL-ERDSKIVVPPLPGKAFTRLLPFRGDDGIFDDSFIAERRSGLEQFINKIAGHPLAQNERCLHMFLQD 94          
BLAST of Sorting nexin-33 vs. Ensembl Sea Lamprey
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 50.447 bits (119), Expect = 1.021e-6
Identity = 50/241 (20.75%), Postives = 96/241 (39.83%), Query Frame = 3
Query:  546 GIKTFVNYEITSSYSTK-------KVVHRYNQFDWLYSQFAEKYP--CIVVPPLPGRQVAGRFKS----------EFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKID 1211
            G+  ++ Y +T++ S          V  R++ F  LY +  EK+     +VPP P + V G  K           EF+E RR  L+ +L   ++HP L      + F    +          V        G    V    D ++  K++ ++ +   + ++       L    R+ H    EG++    ++S       +S A   + ++D   L++ L+++    ++I  L + QA  D
Sbjct:  182 GMNAYMAYNVTTTTSLPMFKRKEFTVKRRFSDFLGLYEKLTEKFSHSGFIVPPAPEKSVLGMTKVKVGKDDPSSVEFVERRRAALERYLQRTSKHPTLMQDPDFRDFLERDE------LPRAVNTQALSGAGILRMVTKAADAVN--KMTIKMNESDSWFEEKQLEFENLETQLRKLHG-NFEGLVNHRKEMSLNTAAFAKSAAMLGN-SEDNTALSRALSQLAEVEEKIDALHQEQANAD 412          
BLAST of Sorting nexin-33 vs. Ensembl Yeast
Match: VPS5 (Nexin-1 homolog; required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to late Golgi; structural component of retromer membrane coat complex; forms a retromer subcomplex with Vps17p; required for recruiting the retromer complex to the endosome membranes; VPS5 has a paralog, YKR078W, that arose from the whole genome duplication [Source:SGD;Acc:S000005595])

HSP 1 Score: 61.2326 bits (147), Expect = 2.555e-10
Identity = 28/76 (36.84%), Postives = 38/76 (50.00%), Query Frame = 3
Query:  597 KVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESD 824
            +V  RY  F WLY Q    +   V+PP P +Q  G FK  FIE+RR  ++  L  I + PVL       +F +  D
Sbjct:  316 QVSRRYRDFRWLYRQLQNNHWGKVIPPPPEKQSVGSFKENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLTSDD 391          
BLAST of Sorting nexin-33 vs. Ensembl Yeast
Match: MVP1 (Protein required for sorting proteins to the vacuole; Mvp1p and Vps1p act in concert to promote membrane traffic to the vacuole; participates in transcription initiation and/or early elongation of specific genes; interacts with "foot domain" of RNA polymerase II; deletion results in abnormal CTD-Ser5 phosphorylation of RNA polymerase II at specific promoter regions; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004606])

HSP 1 Score: 54.6842 bits (130), Expect = 2.613e-8
Identity = 26/90 (28.89%), Postives = 48/90 (53.33%), Query Frame = 3
Query:  549 IKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSE-FIESRRVLLQHWLNHITEHPVLSNSYAIKMFFS 815
            +K  +    TS    + VV RY+ F WL     ++YP  ++P LP +++  +   + F++ RR+ L  ++N + +HP LSN   +  F +
Sbjct:  152 VKHLIALPSTSPSEERTVVRRYSDFLWLREILLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLSNDDLVLTFLT 241          
BLAST of Sorting nexin-33 vs. Ensembl Yeast
Match: SNX4 (Sorting nexin; involved in retrieval of late-Golgi SNAREs from post-Golgi endosomes to the trans-Golgi network and in cytoplasm to vacuole transport; contains a PX phosphoinositide-binding domain; forms complexes with Snx41p and with Atg20p [Source:SGD;Acc:S000003573])

HSP 1 Score: 48.9062 bits (115), Expect = 1.401e-6
Identity = 53/236 (22.46%), Postives = 99/236 (41.95%), Query Frame = 3
Query:  600 VVHR-YNQFDWLYSQFAEKYPCIVVPPLPGRQV----AG-RFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESD-------XXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKY--QNEGMLKEHSKISKRFLDITESL-AKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITK 1259
            VVHR Y+    L+     ++P  ++PPLP ++V    AG RF   F + R   LQ++L  ++ HP LS S   K F    D        +           D F N  F    K   +  +I + S++L +    ID             + FHK   +N+ M ++++K+     ++ E +  +N +     +   +G+ ++    Q++    + +  +D   +E  +  M  + K
Sbjct:   74 VVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQNFLRRVSLHPDLSQSKVFKTFLVSKDWESHRKVLQDSLQPNKDEVTDAFMN-AFKTVHKQNEEFTEIREKSDKLDRTVTKID-------------KLFHKVVKKNDSMSEDYTKLGSNLQELQELVTGENEELAAKLKIFNEGVTQLSYGLQDLTKYLDYEYIVDLKDLEHYIDSMRQLIK 295          
BLAST of Sorting nexin-33 vs. Ensembl Yeast
Match: SNX3 (Sorting nexin for late-Golgi enzymes; required to maintain late-Golgi resident enzymes in their proper location by recycling molecules from the prevacuolar compartment; contains a PX domain and sequence similarity to human Snx3p [Source:SGD;Acc:S000005884])

HSP 1 Score: 46.2098 bits (108), Expect = 2.201e-6
Identity = 29/102 (28.43%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  558 FVNYEITSSYS-------TKKVVHRYNQFDWLYSQFAEK-----YPCIVVPPLPGR-QVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESD 824
            F +YEI    +         KV  RY+ F++      ++     +P ++VP LPG+  ++ RF +E IE RR  L  W+  +  HP+L +   + + F E++
Sbjct:   57 FTDYEIICRTNLPSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAE 158          
BLAST of Sorting nexin-33 vs. Ensembl Nematostella
Match: EDO49827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REN9])

HSP 1 Score: 188.348 bits (477), Expect = 1.250e-52
Identity = 141/534 (26.40%), Postives = 250/534 (46.82%), Query Frame = 3
Query:   21 MSERKAKALYDYSPSSAE-DIQFFADEILIILDINISEGWSRGRNARDEEGIIPSSYYELIS-PFEIESTTVDNQXXXXXXXXXXXEPVPTENR------------------KGSDSPRLLSVISPRMMSSVKIPNS----------FLKGGGQNFLFG--KKSVARDIEAEVEVLK---EGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXX-XXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFI---DDYYRNSCCLSDGFRRFHKYQNEGMLK-EHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQIT 1502
            M+ +K + LYD+   +A  ++    DE+L +   ++ EGW  G      +G+ P +Y E+IS P      TV  Q+ ++ +     +P P+ +                    G D P+  ++      SS+    +          F+K GG+ ++ G  ++S+    E  V V+    EG   I  W+      TC++   +  SK+KG+K+F++Y +  + + + V  R+  FDWLY++  +KY  I +PPLP +Q+ GRF  +F+E RR  L+ W+  + +HPVLS S  +  F + +D +K  K  K K +ND F  G F+ AV+ P   L +  I   +     F+   +D  +N   +  G    H  +  G  K E+ KI   F  +++S A + D  ++ Q LT+ +   G  Y +IG +F  Q + D   +   L E +G+  + P IL++  G +  +  CI +  + K++   +  V      +T    AE++     R    + +M   L+ QI    +++
Sbjct:    1 MAGQKVRVLYDFDGDTATGELIVSVDEVLTVTRTDVGEGWWEGITQSGIKGLFPEAYVEVISEPVAPPMPTVPIQTPSAPY-----QPPPSNDYYDAEDFDDDWDDDTGSSYSGGD-PQASTMQRRDTGSSIHRTGTVRKSMNRFSVFVKSGGEAYVLGTAEESLQVPPEETVRVITRSGEGAASIV-WEPSSAPFTCSVTEPEKKSKFKGMKSFISYNVVPTNTMRPVSRRFKHFDWLYNRLVDKYTLIAIPPLPDKQITGRFGEDFVEKRREKLEKWVGRLCQHPVLSKSPVVNHFLTCADSEKEWKAGKRKAENDKFTGGAFFRAVECPPTKLSLYAIDSHIDNFGKFVRSMEDSVKN--IVDRG--TTHCEKCIGSYKTEYKKIGGTFTALSQSFAVD-DITENSQALTKAVEHTGKTYDDIGEMFAEQPRQDFLPLIDGLKEYSGMLSQYPEILQIHKGTIGKVKECIKLKEDEKMEVRIVDTVSSRADTITAVSFAEMNHFHQLRVADFKVMMQSFLQEQIAFHQRVS 522          
BLAST of Sorting nexin-33 vs. Ensembl Nematostella
Match: EDO31460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXV9])

HSP 1 Score: 95.9005 bits (237), Expect = 1.056e-21
Identity = 47/126 (37.30%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  594 KKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXX-XXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFI 968
            + V  R+  FDWLY++  +KY  I +PPLP +Q+ GRF  +F+E RR  L+ W+  + +HPVLS S  +  F + +D +K  K  K K +ND F  G F+ AV+ P   L +  I   +     F+
Sbjct:    2 RPVSRRFKHFDWLYNRLVDKYTLIAIPPLPDKQITGRFGEDFVEKRREKLEKWVGRLCQHPVLSKSPVVNHFLTCADSEKEWKAGKRKAENDKFTGGAFFRAVECPPTKLSLYAIDSHIDNFGKFV 127          
BLAST of Sorting nexin-33 vs. Ensembl Nematostella
Match: EDO40294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7T4])

HSP 1 Score: 69.707 bits (169), Expect = 5.597e-13
Identity = 29/71 (40.85%), Postives = 47/71 (66.20%), Query Frame = 3
Query:  600 VVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF 812
            V  RY++F WL  + AE++P   +PPLPG++V GRF +EFI++R+  L+HWL  +       N+Y +++F 
Sbjct:   69 VRRRYSEFTWLRKKLAEEFPNASIPPLPGKRVLGRFDTEFIKNRQQGLEHWLRSLLSDTYKENAY-LQLFL 138          
BLAST of Sorting nexin-33 vs. Ensembl Nematostella
Match: EDO38324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD93])

HSP 1 Score: 58.5362 bits (140), Expect = 4.475e-10
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  513 IDSYKVDSKYKGIKTFVNYEITSSYST-------KKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVA---------GRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSE 818
            ID    ++   G K + +YE+    +          V  RY+ F+WL S+  E+   IVVP LPG+ +          G F+ EFIE RR  L+ ++N +  HP+  N   + MF  E
Sbjct:   37 IDVVNPETHGVGKKRYTDYELRMRTNLPVFKQKESSVRRRYSDFEWLRSEL-ERDSKIVVPALPGKALKRMLPFRGDDGIFEDEFIEDRRQGLEAFINRVAGHPLAQNEKCLHMFLQE 153          
BLAST of Sorting nexin-33 vs. Ensembl Nematostella
Match: EDO46895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ3])

HSP 1 Score: 58.151 bits (139), Expect = 3.790e-9
Identity = 30/108 (27.78%), Postives = 54/108 (50.00%), Query Frame = 3
Query:  525 KVDSKYKGIKTFVNYEITSSYSTKKVVH-------RYNQFDWLYSQFAEKYPCIVVPPLPGRQVAG----RFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFS 815
            +VD   K +  +V+Y + +  +  +  H       RY  F WL  +  E YP  ++PPLP +        RF  EF+++R + L  ++  I +HPV+S +  + +F +
Sbjct:   30 RVDDPEKHVGGYVSYNVITKTTRNQFDHPEYSVRRRYQDFLWLRQRMQESYPTHIIPPLPEKHSFTKHFDRFSPEFLKARELALNKFMTRIADHPVMSFNDHLHVFLT 137          
BLAST of Sorting nexin-33 vs. Ensembl Medaka
Match: snx33 (sorting nexin 33 [Source:NCBI gene;Acc:101171161])

HSP 1 Score: 184.111 bits (466), Expect = 2.517e-50
Identity = 118/393 (30.03%), Postives = 192/393 (48.85%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERL---KKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            +SF++ G + F+ G   +   I AE   ++ G     +WK+  N   C+I+     +K+KGIKT+++Y +T S++ + V  RY  FDWLY++   K+  I VP LP +Q  GRF+ +FIE R+  L  W+NH+T HPVLS     + F   +D K+WK+ K + + D      F   ++ P +  D+  + ER+   K  A  +DD       ++    R H     G  KE  ++   F  I+++   +P    DG  L   ++  G  Y+ IG LF  Q K D   +   L    G+    P I+ L  GA   +     MS E K+D+     + +  + V   + AE+S    RR+   + +M  +LK QI  + ++   L  TL+ +D
Sbjct:  170 SSFVRSGVEAFVLGDVPMMAKI-AESYTIEMGPLGP-KWKENPNPFICSIEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLNKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMNHMTSHPVLSQYEGFEHFLMCADDKQWKLGKRRAEKDEMVGAHFMLTLQIPNEHQDLQDVEERVDNFKTFAKKMDDSVMQLTNVASELVRKHL---GGFRKEFQRLGNAFQSISQAFMLDPPHRSDG--LNNAISHTGRTYENIGELFAEQPKYDLFQMLDKLSLYQGLLANFPDIIHLQKGAFAKVKESQRMSDEGKMDQGEADGIRKRCRTVGFALQAEMSHFHERREVDFKDMMQAYLKEQIAFYQRVVQQLERTLRMYD 555          
BLAST of Sorting nexin-33 vs. Ensembl Medaka
Match: snx18b (sorting nexin-18 [Source:NCBI gene;Acc:101159837])

HSP 1 Score: 176.792 bits (447), Expect = 1.010e-47
Identity = 119/397 (29.97%), Postives = 189/397 (47.61%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS--VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSES-DXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNK----IGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ FL G+ S  V    +  V V K G     +W++     TC ID     +K+KG+K++++Y +T +++  +V  RY  FDWLY +  E++P I VP LP +Q  GRF+ +F+  RR  L  W+NH+T HPVL++    + F + S D+K WK+ K K + D      F+  +  P   LD+ ++  ++     F      N   ++     F + Q  G  KE+ K+ + F  ++++         D Q  + GLN+     G AY++IG  F  Q   D   +   L    G     P IL +  GAL  +  C     E  L E           +++    AE+      R    RS M  HL+ QI  F +ITA L + L+ +D
Sbjct:  167 STFVKSGGEAFLLGEASAFVKDGDKICVVVGKYGP----EWQEDPYPFTCTIDDPTRQTKFKGMKSYMSYGLTPTHTNTQVNRRYKHFDWLYGRLVERFPVISVPHLPEKQATGRFEEDFLSKRRKGLMWWMNHMTSHPVLAHCNVFQHFLTCSPDEKAWKMGKRKAEKDDLVGANFFLTISPPAVPLDLQEVENKIDNFKMFTKKLDENIVVMNATINEFARKQTTGFQKEYHKVGQSFKLLSQAF------ELDQQIFSLGLNRAIAYTGEAYEKIGDYFAEQPHQDLDHISDLLDLYRGHLANFPDILHVQKGALTKVKECPK--QEGGLQER--------CNIISCATMAEIQHFHRTRVRDFRSQMQHHLRQQISFFQKITAKLENALQKYD 543          
BLAST of Sorting nexin-33 vs. Ensembl Medaka
Match: SNX18 (sorting nexin 18 [Source:NCBI gene;Acc:101166878])

HSP 1 Score: 162.925 bits (411), Expect = 9.428e-43
Identity = 105/393 (26.72%), Postives = 183/393 (46.56%), Query Frame = 3
Query:  366 NSFLKGGGQNFLFGKKS-VARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFS--ESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFD 1535
            ++F+K GG+ F+ G+ +   +D +    V+     E   W++     +C ID     +K+KG+K++++Y++T +++   V  RY  FDWLY++  EK+P I VP +P +Q  GRF+ +FI  RR  L  W+NH+T HPVL+     + F +   +D+K WK  K K + D      F+  +  P   LD  ++  ++     F      ++  L      F + Q  G  KE+ K+   F  ++++     DQ      L   ++  G+ Y+ IG  F  Q   D   +   L    G     P I+ +  GAL  +        E K+D    + +     +++    AE+      R    ++ M  +L+ QI  F +IT  L + L+ +D
Sbjct:  178 STFVKSGGEAFVLGEAAGFVKDGDKICVVMGNYGPE---WQENPYPFSCAIDDPTKQTKFKGMKSYISYKLTPTHTQNPVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLARCDVFQHFLTCNSADEKAWKQGKRKAEKDDMVGANFFLTISPPAVPLDFQEVESKVDGFKTFSKRMDDSALQLHATVSEFARKQISGFRKEYQKVGMSFKFLSQAFEM--DQQAYSSGLNHAISFTGDTYEAIGEYFSEQPSKDLDPIMDLLALYQGHMANYPDIIHVQKGALTKVKESQKHVEEGKMDRAQAEGISDRCNIISYATLAEIQHFHQIRVRDFKTQMQHYLQQQIAFFQKITGKLEEALQKYD 565          
BLAST of Sorting nexin-33 vs. Ensembl Medaka
Match: snx9b (sorting nexin 9 [Source:NCBI gene;Acc:101165023])

HSP 1 Score: 139.428 bits (350), Expect = 1.406e-34
Identity = 118/479 (24.63%), Postives = 212/479 (44.26%), Query Frame = 3
Query:  120 NISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLSVISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKY-PCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNE-------GMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNF 1532
            N  E WS G ++  +    P  Y     P+ I+ T  ++      +D   S    +E  +G    R  +  S   +S  K P  F K G + FL  K++     +  + + + G    Y   Q      C +   K  SK  G+K+++ Y+IT + + + V HRY  FDWLY +  +K+   I +P LP +QV GRF+ EFI+ R   LQ W+  +  HPV+S+S   ++F S  D+K WK+ K K + D       +  ++A    LD+ ++ ++ ++ + F          + DG +      NE        + KE+ +I K F +++     +  Q +    LT  +   G  Y+EI  +   Q K D  F+     E  G+    P  + +   A++ +     + + +K+  +    + +    ++  + AE++   + R +    VM Q+L+ Q++ +  I A L      F
Sbjct:  135 NAPEPWSSGTHSHPQAYQGPDIY-----PYLIDHTGAEDDEWDDEWDEMKSTSGYSEPGEGGAIQRGGTHASSMKISLNKFPG-FSKSGPELFLLCKQAAKGKEKISIYLGEVGPVWFYPEAQL----DCIVADPKKGSKMYGLKSYIEYQITPNTTNRPVNHRYKHFDWLYERLLDKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQGWMTRMCRHPVVSSSEVFQLFLSYKDEKDWKMGKRKAEKDETVGVMIFTTIEAEAPDLDLAEVEQKCEQFSRFTK-------AMDDGVKEILTVGNEHWKRCTGPLPKEYQRIGKAFQNLSSVFTSSGYQGE--ATLTDAMTAAGKTYEEIAQIVAEQPKKDLHFLMETNNEYKGLLGCFPDTIGVHKAAIDKVKEADKLVNTNKITAQDKVTMAKRASTMSYALQAEMNHFHSNRIYDYNRVMQQYLEEQVKFYETIAAKLRHAHSQF 594          
BLAST of Sorting nexin-33 vs. Ensembl Medaka
Match: snx9b (sorting nexin 9 [Source:NCBI gene;Acc:101165023])

HSP 1 Score: 139.043 bits (349), Expect = 2.336e-34
Identity = 118/479 (24.63%), Postives = 212/479 (44.26%), Query Frame = 3
Query:  120 NISEGWSRGRNARDEEGIIPSSYYELISPFEIESTTVDNQXXXXXXXXXXXEPVPTENRKGSDSPRLLSVISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKY-PCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNE-------GMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNF 1532
            N  E WS G ++  +    P  Y     P+ I+ T  ++      +D   S    +E  +G    R  +  S   +S  K P  F K G + FL  K++     +  + + + G    Y   Q      C +   K  SK  G+K+++ Y+IT + + + V HRY  FDWLY +  +K+   I +P LP +QV GRF+ EFI+ R   LQ W+  +  HPV+S+S   ++F S  D+K WK+ K K + D       +  ++A    LD+ ++ ++ ++ + F          + DG +      NE        + KE+ +I K F +++     +  Q +    LT  +   G  Y+EI  +   Q K D  F+     E  G+    P  + +   A++ +     + + +K+  +    + +    ++  + AE++   + R +    VM Q+L+ Q++ +  I A L      F
Sbjct:  161 NAPEPWSSGTHSHPQAYQGPDIY-----PYLIDHTGAEDDEWDDEWDEMKSTSGYSEPGEGGAIQRGGTHASSMKISLNKFPG-FSKSGPELFLLCKQAAKGKEKISIYLGEVGPVWFYPEAQL----DCIVADPKKGSKMYGLKSYIEYQITPNTTNRPVNHRYKHFDWLYERLLDKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQGWMTRMCRHPVVSSSEVFQLFLSYKDEKDWKMGKRKAEKDETVGVMIFTTIEAEAPDLDLAEVEQKCEQFSRFTK-------AMDDGVKEILTVGNEHWKRCTGPLPKEYQRIGKAFQNLSSVFTSSGYQGE--ATLTDAMTAAGKTYEEIAQIVAEQPKKDLHFLMETNNEYKGLLGCFPDTIGVHKAAIDKVKEADKLVNTNKITAQDKVTMAKRASTMSYALQAEMNHFHSNRIYDYNRVMQQYLEEQVKFYETIAAKLRHAHSQF 620          
BLAST of Sorting nexin-33 vs. Planmine SMEST
Match: SMESG000005938.1 (SMESG000005938.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 304/312 (97.44%), Postives = 309/312 (99.04%), Query Frame = 3
Query:  603 VHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 1538
            +HRYNQFDWLY+QFAEKYPCIVVPPLPGRQVAGRFKSEFIESR+VLLQHWLNHITEHPVLSNSYAIKMFFSESDKKKWKIAKLKVKNDVFKNGGFYNAVKAPTDILDIPKISE L KVA FIDDYY+NSCCLSDGFRRFHKYQNEGMLKE+SKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV
Sbjct:    1 MHRYNQFDWLYNQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRKVLLQHWLNHITEHPVLSNSYAIKMFFSESDKKKWKIAKLKVKNDVFKNGGFYNAVKAPTDILDIPKISEHLNKVALFIDDYYKNSCCLSDGFRRFHKYQNEGMLKEYSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNFDV 312          
BLAST of Sorting nexin-33 vs. Planmine SMEST
Match: SMESG000005937.1 (SMESG000005937.1)

HSP 1 Score: 358.992 bits (920), Expect = 4.383e-118
Identity = 177/402 (44.03%), Postives = 260/402 (64.68%), Query Frame = 3
Query:  327 VISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFEIYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFFSESDXXXXXXXXXXXXNDVFKNGGFYNAVKAPTDILDIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNF 1532
            V     ++++++P SFLK GG+ FL G   ++  IEA+VEVL +   E   WK  G+   C I ++   SK+KG+KTF+ Y++ SSY+   +  RY QFDWL+SQ +EKYPCIV+PPLP +QV GR++  FIE RR  LQ WL H+T HPVL+ S  +K F S  DK KW   K +++ D  K+G FY AV+AP D ++    S R++KV+ FID++ ++S  L + +  FHK Q+  + KE  KI     +++ S++  PD N     L  GL + G+ Y  IG LF  QA+ D   VE NL  +NG+ KE+P+++EL+  A+NT+ +    S+E K+  ET++ +DR V+++TRTVDAEL+WLQ  R+ Q+RS M Q+L+NQI+L+T IT IL++ L  F
Sbjct:   37 VTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 438          
BLAST of Sorting nexin-33 vs. Planmine SMEST
Match: SMESG000075553.1 (SMESG000075553.1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.038e-12
Identity = 36/96 (37.50%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  513 IDSYKVDSKYKGIKTFVNYEI--TSSYSTKKVVHRYNQFDWLYSQFAEKYPCIVVPPLPGRQ---VAGRFKSEFIESRRVLLQHWLNHITEHPVLS 785
            I+ YK  S +  ++TF+ Y I  T ++    V  RYN F WL+ + +++YP  +VPPLP +       RF   FIE RR  L+ +L  +T+H +LS
Sbjct:   44 IEDYKKASSF--LETFIVYTIQTTGNFRPYSVERRYNDFQWLFQRLSDRYPMAIVPPLPDKHNLTAIERFSGIFIELRRNALEKFLQRLTDHKILS 137          
BLAST of Sorting nexin-33 vs. Planmine SMEST
Match: SMESG000016684.1 (SMESG000016684.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.787e-7
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  600 VVHRYNQFDWLYSQFAEKYPCIVVPPLPGR-------QVAGRFK-SEFIESRRVLLQHWLNHITEHPVLSNSYAIKMFF 812
            V+ RY++FD L +   + YP  V+PPLP +        VA + + S+FI+SRR  L+ +LN I  HP L     I  F 
Sbjct:   83 VLRRYSEFDSLRASLTKLYPACVIPPLPSKINSLNPWNVAHQKRDSDFIDSRRQRLEMFLNRILSHPKLKTEILIFNFL 161          
The following BLAST results are available for this feature:
BLAST of Sorting nexin-33 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX333.444e-4427.74sorting nexin 33 [Source:HGNC Symbol;Acc:HGNC:2846... [more]
SNX185.276e-4228.10sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:1924... [more]
SNX95.780e-3526.65sorting nexin 9 [Source:HGNC Symbol;Acc:HGNC:14973... [more]
SNX181.023e-3428.42sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:1924... [more]
SNX181.334e-3429.72sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:1924... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lst-45.589e-4628.64Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-42.777e-4529.30Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-42.777e-4529.30Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-42.777e-4529.30Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-47.473e-4528.50Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SH3PX11.644e-3627.51gene:FBgn0040475 transcript:FBtr0076413[more]
Snx31.507e-935.19gene:FBgn0038065 transcript:FBtr0082641[more]
Snx31.507e-935.19gene:FBgn0038065 transcript:FBtr0082642[more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx331.576e-4628.44sorting nexin 33 [Source:ZFIN;Acc:ZDB-GENE-041111-... [more]
snx18a1.866e-4527.99sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705... [more]
snx18a1.866e-4527.99sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705... [more]
snx18b4.162e-4127.99sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213... [more]
snx18b2.050e-4027.74sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csrp25.111e-4226.15cysteine and glycine rich protein 2 [Source:Xenbas... [more]
snx185.829e-4026.63sorting nexin 18 [Source:NCBI gene;Acc:496591][more]
snx91.468e-3523.18sorting nexin 9 [Source:NCBI gene;Acc:100145698][more]
snx92.722e-3426.16sorting nexin 9 [Source:NCBI gene;Acc:100145698][more]
snx93.546e-3426.16sorting nexin 9 [Source:NCBI gene;Acc:100145698][more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx336.620e-4527.69sorting nexin 33 [Source:MGI Symbol;Acc:MGI:244323... [more]
Snx183.646e-4228.10sorting nexin 18 [Source:MGI Symbol;Acc:MGI:213764... [more]
Snx93.328e-3326.16sorting nexin 9 [Source:MGI Symbol;Acc:MGI:1913866... [more]
Snx309.963e-1333.33sorting nexin family member 30 [Source:MGI Symbol;... [more]
Snx78.438e-1233.02sorting nexin 7 [Source:MGI Symbol;Acc:MGI:1923811... [more]
back to top
BLAST of Sorting nexin-33 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4VAA7|SNX33_MOUSE4.631e-4427.69Sorting nexin-33 OS=Mus musculus OX=10090 GN=Snx33... [more]
sp|Q8I4E2|LST4_CAEEL9.506e-4428.50Sorting nexin lst-4 OS=Caenorhabditis elegans OX=6... [more]
sp|Q8WV41|SNX33_HUMAN1.654e-4327.74Sorting nexin-33 OS=Homo sapiens OX=9606 GN=SNX33 ... [more]
sp|Q6NRL2|SNX33_XENLA1.335e-4126.40Sorting nexin-33 OS=Xenopus laevis OX=8355 GN=snx3... [more]
sp|Q28GP7|SNX33_XENTR2.707e-4126.15Sorting nexin-33 OS=Xenopus tropicalis OX=8364 GN=... [more]
back to top
BLAST of Sorting nexin-33 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4BQ727.330e-5728.21Sorting nexin OS=Pygocentrus nattereri OX=42514 PE... [more]
A0A1S3H3H58.166e-5734.01Sorting nexin OS=Lingula unguis OX=7574 GN=LOC1061... [more]
K7J7C01.559e-5628.02Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
V4BYZ54.661e-5627.16Sorting nexin OS=Lottia gigantea OX=225164 GN=LOTG... [more]
A0A232EK676.600e-5627.66Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx331.956e-4728.44sorting nexin 33 [Source:NCBI gene;Acc:103035633][more]
snx18a3.227e-4627.48sorting nexin 18 [Source:NCBI gene;Acc:103026104][more]
snx18b1.279e-4328.83sorting nexin-18-like [Source:NCBI gene;Acc:103036... [more]
snx9a6.390e-3923.95sorting nexin-9-like [Source:NCBI gene;Acc:1030231... [more]
snx9a6.762e-3325.00sorting nexin-9-like [Source:NCBI gene;Acc:1030231... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx18b6.032e-3926.41sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213... [more]
ENSPMAT00000001438.11.472e-1733.86pep scaffold:Pmarinus_7.0:GL485280:2234:11313:-1 g... [more]
snx306.739e-1132.46sorting nexin family member 30 [Source:NCBI gene;A... [more]
snx34.923e-935.37sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
snx1a1.021e-620.75sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
VPS52.555e-1036.84Nexin-1 homolog; required for localizing membrane ... [more]
MVP12.613e-828.89Protein required for sorting proteins to the vacuo... [more]
SNX41.401e-622.46Sorting nexin; involved in retrieval of late-Golgi... [more]
SNX32.201e-628.43Sorting nexin for late-Golgi enzymes; required to ... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498271.250e-5226.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314601.056e-2137.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402945.597e-1340.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383244.475e-1031.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468953.790e-927.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin-33 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx332.517e-5030.03sorting nexin 33 [Source:NCBI gene;Acc:101171161][more]
snx18b1.010e-4729.97sorting nexin-18 [Source:NCBI gene;Acc:101159837][more]
SNX189.428e-4326.72sorting nexin 18 [Source:NCBI gene;Acc:101166878][more]
snx9b1.406e-3424.63sorting nexin 9 [Source:NCBI gene;Acc:101165023][more]
snx9b2.336e-3424.63sorting nexin 9 [Source:NCBI gene;Acc:101165023][more]
back to top
BLAST of Sorting nexin-33 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000005938.10.000e+097.44SMESG000005938.1[more]
SMESG000005937.14.383e-11844.03SMESG000005937.1[more]
SMESG000075553.19.038e-1237.50SMESG000075553.1[more]
SMESG000016684.13.787e-737.97SMESG000016684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009911 ID=SMED30009911|Name=Sorting nexin-33|organism=Schmidtea mediterranea sexual|type=transcript|length=1869bp
AAAATTGATACTTTTCAAAAATGTCTGAAAGAAAAGCCAAAGCATTGTAT
GATTATAGTCCTAGTTCTGCAGAAGACATTCAATTCTTTGCAGATGAAAT
TTTAATAATTTTAGATATAAATATTTCAGAAGGTTGGTCAAGAGGTCGAA
ACGCTCGAGACGAAGAAGGAATAATACCTTCAAGTTATTATGAACTGATA
AGCCCATTTGAAATTGAAAGCACTACAGTTGACAATCAGTCAGATACGAG
CTCCTTTGACAGTGATTCGAGTGAACCCGTCCCTACGGAAAACAGAAAAG
GATCGGATTCACCAAGATTATTATCTGTCATTTCACCAAGAATGATGAGT
AGCGTAAAAATACCTAATTCATTTTTAAAAGGTGGGGGTCAAAACTTCCT
ATTTGGTAAAAAATCTGTTGCAAGAGATATTGAAGCTGAAGTCGAAGTAC
TGAAAGAAGGGATATTTGAAATTTACCAATGGAAGCAGTTTGGAAATCGT
CATACCTGTAACATAGATTCTTATAAAGTAGATTCAAAATATAAAGGAAT
TAAAACCTTCGTGAATTACGAAATAACATCATCATATTCGACGAAAAAAG
TAGTGCATCGCTATAATCAATTTGATTGGCTCTACAGTCAGTTTGCCGAA
AAATACCCATGCATTGTAGTGCCTCCGTTGCCTGGAAGACAAGTTGCAGG
CAGATTTAAAAGTGAGTTTATCGAAAGTCGAAGAGTTCTTTTGCAACACT
GGCTAAATCACATAACTGAGCATCCGGTTTTATCGAATAGCTACGCAATT
AAAATGTTTTTCTCGGAATCCGATAAAAAAAAATGGAAAATCGCGAAACT
AAAAGTCAAAAATGATGTCTTCAAAAACGGTGGATTTTATAATGCTGTTA
AAGCACCAACAGATATTTTGGATATTCCGAAAATTTCTGAACGCTTAAAA
AAAGTGGCATGGTTCATAGATGACTATTATAGAAATTCTTGTTGCTTATC
TGACGGTTTTCGTCGTTTCCATAAATATCAAAATGAAGGTATGCTAAAAG
AACACTCAAAAATTAGCAAAAGGTTTCTCGATATTACTGAATCTCTCGCT
AAAAATCCAGATCAAAATCAGGATGGCCAAGATTTAACTCAAGGATTGAA
CAAAATCGGCAACGCCTACCAGGAAATTGGAGTTTTATTTGAAAGTCAAG
CCAAAATTGATTCAAGCTTCGTGGAACCTAATCTCGGAGAAATGAATGGT
ATAACCAAGGAGATCCCGTCAATATTGGAACTATCCAACGGTGCTTTAAA
TACTCTAAATTCATGCATCAACATGAGTTCCGAATCTAAGTTAGACGAGG
AAACAATCAAAAATGTCGACAGAGGTGTACAACTTGTGACACGAACTGTT
GATGCTGAGCTCAGTTGGCTTCAAAACCGAAGGCAGCACCAAATGAGATC
TGTTATGTGCCAACATTTGAAAAATCAAATTGAACTTTTTACTCAAATAA
CTGCGATTCTTTCCGATACTTTGAAGAATTTTGATGTCTAGCTCCTATTT
GAGTAATTGAGAATAGAATGTCAAGAAATCAAAATTCACTAACATATTTA
TATGATTTTTATTTTAAACACTTTGTTTTTGTTTCTTTTCATTTGTTTGA
ACATTATTTGATTATTATGGTCAGATAGAGGAATTATTGTGGATGAAGAT
GAAAAGTTCGTTGTTACGAAGTTAAGATCTTATTATAAGTTTATTAGTGT
AAACATTATAAAATTGGATTGAATTTGTTGAAGACATTTCGGATTGGATT
CTGAATTGATTTGCCCATAAAAAATTGTTTGAAATATTGTGAAATTGGAC
TAAATTTATCGAAATCGTC
back to top

protein sequence of SMED30009911-orf-1

>SMED30009911-orf-1 ID=SMED30009911-orf-1|Name=SMED30009911-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MSERKAKALYDYSPSSAEDIQFFADEILIILDINISEGWSRGRNARDEEG
IIPSSYYELISPFEIESTTVDNQSDTSSFDSDSSEPVPTENRKGSDSPRL
LSVISPRMMSSVKIPNSFLKGGGQNFLFGKKSVARDIEAEVEVLKEGIFE
IYQWKQFGNRHTCNIDSYKVDSKYKGIKTFVNYEITSSYSTKKVVHRYNQ
FDWLYSQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRRVLLQHWLNHITE
HPVLSNSYAIKMFFSESDKKKWKIAKLKVKNDVFKNGGFYNAVKAPTDIL
DIPKISERLKKVAWFIDDYYRNSCCLSDGFRRFHKYQNEGMLKEHSKISK
RFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSF
VEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVD
RGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDT
LKNFDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000136whole organism
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR036871PX_dom_sf
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR001683Phox
IPR019497Sorting_nexin_WASP-bd-dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0035091phosphatidylinositol binding
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0006886intracellular protein transport
GO:0006897endocytosis
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 163..267
e-value: 1.2E-19
score: 81.3
IPR001683Phox homologous domainPFAMPF00787PXcoord: 173..266
e-value: 6.4E-20
score: 71.2
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 161..271
score: 16.793
IPR001452SH3 domainSMARTSM00326SH3_2coord: 4..61
e-value: 5.7E-14
score: 62.4
IPR001452SH3 domainPFAMPF00018SH3_1coord: 7..54
e-value: 4.9E-10
score: 38.9
IPR001452SH3 domainPROSITEPS50002SH3coord: 1..62
score: 22.783
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 322..506
e-value: 7.6E-33
score: 115.6
IPR019497Sorting nexin protein, WASP-binding domainPFAMPF10456BAR_3_WASP_bdgcoord: 268..505
e-value: 8.5E-31
score: 107.2
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 147..273
e-value: 6.6E-35
score: 121.8
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 172..267
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 2..66
e-value: 6.1E-13
score: 50.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 71..92
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 71..85
NoneNo IPR availablePANTHERPTHR45827FAMILY NOT NAMEDcoord: 5..73
coord: 110..505
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 3..75