peptidase inhibitor 16

Overview
Namepeptidase inhibitor 16
Smed IDSMED30009891
Length (bp)409
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of peptidase inhibitor 16 (SMED30009891) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for peptidase inhibitor 16 (SMED30009891) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009891

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30009891h1SMcG0009011 SmedASXL_017329SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30009891h1SMcG0009055 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30009891h1SMcG0009076 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30009891h1SMcG0009011 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30009891h1SMcG0009056 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
secretory systemSMED30009891h1SMcG0009055 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30009891h1SMcG0009011 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30009891h1SMcG0009056 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30009891h1SMcG0009076 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 85.1149 bits (209), Expect = 1.108e-19
Identity = 47/112 (41.96%), Postives = 61/112 (54.46%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSP--TCEHYAQMVWADSQELGCGTSICETSQ----IKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +  ++W  E ++YN+   TC SP   C HY Q+VWA ++ +GCG+  CE  Q         L+C Y P G+VK K PY  G PCSQCP G  C N
Sbjct:   86 GENLFAITD--EGMDVPLAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN 194          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 85.1149 bits (209), Expect = 1.108e-19
Identity = 47/112 (41.96%), Postives = 61/112 (54.46%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSP--TCEHYAQMVWADSQELGCGTSICETSQ----IKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +  ++W  E ++YN+   TC SP   C HY Q+VWA ++ +GCG+  CE  Q         L+C Y P G+VK K PY  G PCSQCP G  C N
Sbjct:   86 GENLFAITD--EGMDVPLAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN 194          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 85.1149 bits (209), Expect = 1.108e-19
Identity = 47/112 (41.96%), Postives = 61/112 (54.46%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSP--TCEHYAQMVWADSQELGCGTSICETSQ----IKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +  ++W  E ++YN+   TC SP   C HY Q+VWA ++ +GCG+  CE  Q         L+C Y P G+VK K PY  G PCSQCP G  C N
Sbjct:   86 GENLFAITD--EGMDVPLAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN 194          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 68.9366 bits (167), Expect = 1.721e-14
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSIC-ETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCV 326
            P      W+ E  +Y+  + +C S  C HY Q+VWA+S  +GC  ++C        +  +C YGP G+    PPY+RG  CS C     CV
Sbjct:  110 PRHAITAWYNETQFYDFDSLSC-SRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCV 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1 (GLI pathogenesis related 1 [Source:HGNC Symbol;Acc:HGNC:17001])

HSP 1 Score: 69.3218 bits (168), Expect = 1.749e-14
Identity = 42/113 (37.17%), Postives = 56/113 (49.56%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICET-----SQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            S+G N  + T S  +   S     W+ EI  Y+ KT  CK   C HY Q+VWADS ++GC    C       +    ++ IC YGPGG+     PY RG  CS CP    C++
Sbjct:   95 SLGEN--IWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKK-VCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTW-PYKRGATCSACPNNDKCLD 203          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 63.1586 bits (152), Expect = 2.112e-12
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 3
Query:   27 LITDSFDVSDP-SIIY---QQWFQEIDYYNIKTNTCKSP--------TCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCS---QCPIGTSC 323
            L   SF   DP S+I+   ++W+QE++ +    +   +P           HY QM W  +  LGCG + C     K SY++C YGP G+ K    Y  G PC     CPIGT C
Sbjct:  387 LYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCP----KMSYVVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDC 496          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 63.1586 bits (152), Expect = 2.145e-12
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 3
Query:   27 LITDSFDVSDP-SIIY---QQWFQEIDYYNIKTNTCKSP--------TCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCS---QCPIGTSC 323
            L   SF   DP S+I+   ++W+QE++ +    +   +P           HY QM W  +  LGCG + C     K SY++C YGP G+ K    Y  G PC     CPIGT C
Sbjct:  353 LYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCP----KMSYVVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDC 462          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 62.3882 bits (150), Expect = 3.222e-12
Identity = 40/114 (35.09%), Postives = 55/114 (48.25%), Query Frame = 3
Query:   27 LITDSFDVSDP-SIIY---QQWFQEIDYYNIKTNTCKSP--------TCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCS---QCPIGTSC 323
            L   SF   DP S+I+   ++W+QE++ +    +   +P           HY QM W  +  LGCG + C     K SY++C YGP G+ K    Y  G PC     CPIGT C
Sbjct:  257 LYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCP----KMSYVVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDC 366          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 54.6842 bits (130), Expect = 8.305e-10
Identity = 28/88 (31.82%), Postives = 43/88 (48.86%), Query Frame = 3
Query:   66 IYQQWFQEIDYY-NIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLI-CIYGPGGDVKLKPPYIRGRPCSQCPIGTSC 323
            +++  FQ   +  N+ T    +    H  QM WA + ++GCG S C +      Y++ C+Y P G+      Y  G  CS CP GT+C
Sbjct:  117 LWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNC 204          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 52.7582 bits (125), Expect = 3.936e-9
Identity = 29/88 (32.95%), Postives = 43/88 (48.86%), Query Frame = 3
Query:   78 WFQEIDYYNIKTNTCK----SPTCEHYAQMVWADSQELGCGTSIC--ETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSC 323
            W +E   Y   +NT      +    H  QM WA +  +GCG   C  +T+ + +  ++C Y P G+   +  Y  G  CS+CP GTSC
Sbjct:  113 WEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSC 200          
BLAST of peptidase inhibitor 16 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 58.5362 bits (140), Expect = 1.107e-10
Identity = 36/101 (35.64%), Postives = 52/101 (51.49%), Query Frame = 3
Query:    6 SVGNNSALI--TDSFDVSD---PSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRP 293
            ++G N A+I  T   D  D   PS I Q WF E+  Y+       SP   HY+Q+VW ++  +GCG +  + +       +C YGPGG+V    PY  G+P
Sbjct:   99 TMGQNLAIIWSTAPLDADDGDFPSRI-QSWFNEVQKYSF--GDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKP 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: CU914487.1 (peptidase inhibitor 16-like [Source:NCBI gene;Acc:101883528])

HSP 1 Score: 68.9366 bits (167), Expect = 2.197e-15
Identity = 37/106 (34.91%), Postives = 58/106 (54.72%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTC-KSPTCEHYAQMVWADSQELGCGTSICETSQI----KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            ++G N  + T  F+ +   +    WF E   YN  TN C +   C HY Q+VWA++ ++GC +  C+T +     K + LIC Y P G+++ + PY  G  CS+CP
Sbjct:   36 TMGENLFVGTGPFNATKAVM---DWFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKIGCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCP 138          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 67.781 bits (164), Expect = 7.507e-14
Identity = 37/116 (31.90%), Postives = 51/116 (43.97%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            S+G N A+    +    P+   Q W+ E+  Y               C  P C HY Q+VWA +  +GC   +C    +         YL+C Y P G+   + PY  GRPCSQCP
Sbjct:  118 SIGQNLAVHWGRY--RSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCP 231          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 63.5438 bits (153), Expect = 1.532e-12
Identity = 32/78 (41.03%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  120 CKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            C  P C HY QMVWA S ++GC  + C    +      + +YL+C Y P G+   + PY  G PCS CP   G SC N
Sbjct:  167 CYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSN 244          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: crispld1b (cysteine-rich secretory protein LCCL domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1204])

HSP 1 Score: 62.7734 bits (151), Expect = 4.625e-12
Identity = 35/108 (32.41%), Postives = 48/108 (44.44%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            P+   Q W+ E+  ++              C  P C HY Q+VWA S ++GC  ++C    +      K  YL+C Y P G+     PY  G PCS CP   G  C N
Sbjct:  131 PTFHVQAWYDEVRDFSYPYPQECNPHCPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGTPCSACPPSYGGGCRN 238          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 60.8474 bits (146), Expect = 1.263e-11
Identity = 32/78 (41.03%), Postives = 39/78 (50.00%), Query Frame = 3
Query:  120 CKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            C  P C HY QMVWA S  +GC    C    +      + +YL+C Y P G+   + PY  G PCS CP   G SC N
Sbjct:  164 CYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSN 241          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 67.781 bits (164), Expect = 1.200e-13
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            S+G N A+    +    P+   Q W+ E+  Y               C  P C HY Q+VWA + ++GC  ++C+   +         YL+C Y P G+   + PY  GRPCS+CP   G +C N
Sbjct:  110 SIGQNLAVHWGRY--RQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQN 232          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 67.781 bits (164), Expect = 1.257e-13
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            S+G N A+    +    P+   Q W+ E+  Y               C  P C HY Q+VWA + ++GC  ++C+   +         YL+C Y P G+   + PY  GRPCS+CP   G +C N
Sbjct:  110 SIGQNLAVHWGRY--RQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQN 232          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 67.781 bits (164), Expect = 1.343e-13
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            S+G N A+    +    P+   Q W+ E+  Y               C  P C HY Q+VWA + ++GC  ++C+   +         YL+C Y P G+   + PY  GRPCS+CP   G +C N
Sbjct:  110 SIGQNLAVHWGRY--RQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQN 232          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.497e-12
Identity = 38/111 (34.23%), Postives = 55/111 (49.55%), Query Frame = 3
Query:    9 VGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKS-PTCEHYAQMVWADSQELGCGTSIC---ETSQIKQSY-LICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCV 326
            +G N  L   S    D ++    W +E  YYN  T  C+    C HY QMVWA ++ +GCG + C   E    +  Y L+C Y P G+ + + PY  G  C++CP    C+
Sbjct:   87 IGEN--LFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVCI 195          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 63.5438 bits (153), Expect = 1.515e-12
Identity = 33/96 (34.38%), Postives = 45/96 (46.88%), Query Frame = 3
Query:   66 IYQQWFQEIDYYNIKT---------NTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            + + W+ E  +Y+            N C    C HY QMVWA S  +GC  +IC    +      + SYL+C Y   G+   + PY  GRPCS CP
Sbjct:  129 LVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACP 224          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 88.5817 bits (218), Expect = 4.330e-22
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN  T TC  +  C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   88 GENLFAITD--EGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 88.5817 bits (218), Expect = 8.273e-22
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN  T TC  +  C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   88 GENLFAITD--EGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 88.5817 bits (218), Expect = 8.273e-22
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN  T TC  +  C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   88 GENLFAITD--EGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 88.5817 bits (218), Expect = 3.879e-21
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN  T TC  +  C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   88 GENLFAITD--EGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 71.633 bits (174), Expect = 4.230e-15
Identity = 40/126 (31.75%), Postives = 55/126 (43.65%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            +S+G N A+    +    P    Q W+ E+  Y               C  P C HY QMVWA + ++GC    C    +         YL+C Y P G+   + PY  GRPCS+CP   G  C+N
Sbjct:  108 RSIGQNLAVHWGRY--RSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLN 231          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 2.713e-20
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN  T TC  +  C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   88 GENLFAITD--EGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.319e-19
Identity = 47/112 (41.96%), Postives = 61/112 (54.46%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSP--TCEHYAQMVWADSQELGCGTSICETSQ----IKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +  ++W  E ++YN+   TC SP   C HY Q+VWA ++ +GCG+  CE  Q         L+C Y P G+VK K PY  G PCSQCP G  C N
Sbjct:   86 GENLFAITD--EGMDVPLAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN 194          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q58D34|PI16_BOVIN (Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.348e-18
Identity = 38/97 (39.18%), Postives = 59/97 (60.82%), Query Frame = 3
Query:   54 DPSIIYQQWFQEIDYYNIKTNTCKS-PTCEHYAQMVWADSQELGCGTSICETSQ-IKQS---YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            D  +  ++W  E ++YN+   +C +   C HY Q+VWA ++ +GCG+  CE  Q ++++    L+C Y P G+VK + PY  G PCSQCP+G  C N
Sbjct:   98 DVPLAMEEWHHEREHYNLSAISCAAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGYHCKN 194          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q8BZQ2|CRLD2_MOUSE (Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus OX=10090 GN=Crispld2 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.961e-14
Identity = 40/126 (31.75%), Postives = 55/126 (43.65%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            +S+G N A+    +    P    Q W+ E+  Y               C  P C HY QMVWA + ++GC    C    +         YL+C Y P G+   + PY  GRPCS+CP   G  C+N
Sbjct:  108 RSIGQNLAVHWGRY--RSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLN 231          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|P48060|GLIP1_HUMAN (Glioma pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1 PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 8.402e-14
Identity = 42/113 (37.17%), Postives = 56/113 (49.56%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICET-----SQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            S+G N  + T S  +   S     W+ EI  Y+ KT  CK   C HY Q+VWADS ++GC    C       +    ++ IC YGPGG+     PY RG  CS CP    C++
Sbjct:   95 SLGEN--IWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKK-VCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTW-PYKRGATCSACPNNDKCLD 203          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: A0A1W2Q6N3 (Peptidase inhibitor 16 OS=Rattus norvegicus OX=10116 GN=Pi16 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.611e-19
Identity = 48/111 (43.24%), Postives = 64/111 (57.66%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN+ T TC     C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SCVN
Sbjct:   92 GENLFAITD--EGMDVPLAVGNWHEEHEYYNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCVN 200          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: M7B9U3 (RRM domain-containing protein OS=Chelonia mydas OX=8469 GN=UY3_10522 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 7.175e-19
Identity = 45/111 (40.54%), Postives = 65/111 (58.56%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQ-IKQS---YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  DV    +  +QW+ E ++YN+ T+ C     C HY Q+VWA+S+ +GCG   C+T   ++ S    L+C Y P G+V+ + PY  G PCS+CP G +C N
Sbjct: 1204 GENLFAITDEMDVE---VALEQWYTEHEHYNLTTSKCTVGQMCGHYTQVVWANSERVGCGMQFCKTLHGVEDSDLYLLVCNYDPPGNVRGRKPYKEGPPCSKCPEGYTCRN 1311          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: A0A1A6I0F6 (SCP domain-containing protein OS=Neotoma lepida OX=56216 GN=A6R68_22270 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.727e-19
Identity = 46/111 (41.44%), Postives = 65/111 (58.56%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD     D  +  + WF+E ++YN+ T TC+    C HY Q++W+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   84 GENLFAITDQG--MDVLLAVENWFEEREHYNLSTATCEPGQMCGHYTQVIWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPVGYSCEN 192          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: D3ZGM7 (Peptidase inhibitor 16 OS=Rattus norvegicus OX=10116 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 1.461e-18
Identity = 48/111 (43.24%), Postives = 64/111 (57.66%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN+ T TC     C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SCVN
Sbjct:   92 GENLFAITD--EGMDVPLAVGNWHEEHEYYNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCVN 200          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: D3Z6T6 (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.715e-18
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQS----YLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            G N   ITD  +  D  +    W +E +YYN  T TC  +  C HY Q+VW+ ++ +GCG+  CET Q  +      L+C Y P G+VK + PY  G PCSQCP+G SC N
Sbjct:   88 GENLFAITD--EGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 73.1738 bits (178), Expect = 2.584e-16
Identity = 38/105 (36.19%), Postives = 56/105 (53.33%), Query Frame = 3
Query:    9 VGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTC-KSPTCEHYAQMVWADSQELGCGTSICETSQI----KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            +G N  + T   D+         WF E  +Y+   NTC ++  C HY QMVWA ++E+GCG+ +CET +       + L+C Y P G+   + PY  G  CS+CP
Sbjct:   83 MGENLFITTGPLDIEKA---LSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCP 184          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 73.1738 bits (178), Expect = 2.723e-16
Identity = 38/105 (36.19%), Postives = 56/105 (53.33%), Query Frame = 3
Query:    9 VGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTC-KSPTCEHYAQMVWADSQELGCGTSICETSQI----KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            +G N  + T   D+         WF E  +Y+   NTC ++  C HY QMVWA ++E+GCG+ +CET +       + L+C Y P G+   + PY  G  CS+CP
Sbjct:   83 MGENLFITTGPLDIEKA---LSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCP 184          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 72.7886 bits (177), Expect = 6.012e-16
Identity = 38/105 (36.19%), Postives = 56/105 (53.33%), Query Frame = 3
Query:    9 VGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTC-KSPTCEHYAQMVWADSQELGCGTSICETSQI----KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            +G N  + T   D+         WF E  +Y+   NTC ++  C HY QMVWA ++E+GCG+ +CET +       + L+C Y P G+   + PY  G  CS+CP
Sbjct:   83 MGENLFITTGPLDIEK---ALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCP 184          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 67.3958 bits (163), Expect = 1.064e-13
Identity = 37/116 (31.90%), Postives = 50/116 (43.10%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            S+G N A+    +    P+   Q W+ E+  Y               C  P C HY Q+VWA +  +GC    C    +         YL+C Y P G+   + PY  GRPCSQCP
Sbjct:  114 SIGQNLAVHWGRY--RSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCP 227          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: crispld1b (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:103033853])

HSP 1 Score: 66.6254 bits (161), Expect = 1.738e-13
Identity = 33/99 (33.33%), Postives = 46/99 (46.46%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            P+   Q W+ E+ Y++              C  P C HY Q+VWA S ++GC  ++C    +      K  YL+C Y P G+     PY  G PCS CP
Sbjct:  130 PTFHVQAWYDEVQYFSYPYPQECDPYCPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGHPCSACP 228          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 2.309e-14
Identity = 36/101 (35.64%), Postives = 51/101 (50.50%), Query Frame = 3
Query:   72 QQWFQEIDYYNIKT---------NTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQS------YLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSC 323
            Q WF E ++Y             +TC+ P C HY Q+VWA+S+ +GC    C    +  +      YL+C Y P G+   + PY +G PCS+CP   G SC
Sbjct:   79 QAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSC 179          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 6.588e-12
Identity = 36/108 (33.33%), Postives = 45/108 (41.67%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIKTN---------TCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            PS   Q W+ E   Y               C    C HY Q+VWA +  +GC  + C    +      K  YL+C Y P G+     PY  GR CS+CP   G SC N
Sbjct:   61 PSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRN 168          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 51.9878 bits (123), Expect = 4.223e-9
Identity = 24/68 (35.29%), Postives = 32/68 (47.06%), Query Frame = 3
Query:   66 IYQQWFQEIDYYNIKTNTCK-SPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKL 266
            +   WF E   Y+     C  + TC HY QMVWA +  +GC    C     +     C+Y PG DV+L
Sbjct:  143 VLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYLPGNDVRL 210          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000359.1 (pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene:ENSPMAG00000000319.1 transcript:ENSPMAT00000000359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 2.950e-8
Identity = 26/67 (38.81%), Postives = 40/67 (59.70%), Query Frame = 3
Query:  138 EHYAQ-MVWADSQELGCGTSICETSQIKQSYLICIYGPGGDV--KLKPPYIRGRPCSQCPIGTSCVN 329
            EHY Q +VW  S ++GC  + C T+  K+ + +C Y P G++  ++  PY +G  C+ CP   SCVN
Sbjct:   44 EHYTQQLVWYSSFQIGCSVNFCATA--KKYFYVCHYCPAGNLNTRVFRPYDKGSACTSCP--KSCVN 106          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 47.3654 bits (111), Expect = 6.742e-8
Identity = 24/58 (41.38%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  141 HYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDV--KLKPPYIRGRPCSQCP 308
            HY Q+VW  S +LGC  + C  +  K  Y +C Y P G++  +L  PY  G PC  CP
Sbjct:   44 HYTQVVWYSSFQLGCAVNYCPEAIYKYVY-VCHYCPAGNLNTRLSRPYNEGSPCRSCP 100          
BLAST of peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 43.1282 bits (100), Expect = 3.401e-6
Identity = 22/60 (36.67%), Postives = 33/60 (55.00%), Query Frame = 3
Query:   78 WFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGD 257
            W+ EI  YN   N   S +  H+ Q+VW  + E+GCG   C T+    +Y++C Y P G+
Sbjct:   93 WYGEISKYNYS-NPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTW--NNYIVCSYNPPGN 149          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 46.2098 bits (108), Expect = 7.332e-7
Identity = 19/62 (30.65%), Postives = 35/62 (56.45%), Query Frame = 3
Query:   72 QQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGD 257
            + W+QE++ YN +    +S T  H+ Q+VW  S+ELG   +  +   +   +++  Y PGG+
Sbjct:   77 ESWYQEVERYNFQRGGHQSGTG-HFTQVVWKSSEELGVARAKSKKGAV---FVVARYSPGGN 134          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO31682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX85])

HSP 1 Score: 45.0542 bits (105), Expect = 7.851e-7
Identity = 18/64 (28.12%), Postives = 37/64 (57.81%), Query Frame = 3
Query:   72 QQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVK 263
            + W+QE+  Y+ K N    P+  H++Q+VW  +++LG G +  ++      +L+  Y P G+++
Sbjct:   75 RNWYQEVKNYDFK-NPHSDPSTSHFSQLVWKGTKKLGVGEAQSKSGNF---FLVARYHPKGNME 134          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 43.8986 bits (102), Expect = 2.048e-6
Identity = 24/84 (28.57%), Postives = 44/84 (52.38%), Query Frame = 3
Query:    9 VGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDV 260
             G N A+ +  +D +   +  + W++E   Y+      +  T  H+ QMVW  S+ELG G +  +TS  + +Y++  Y P G++
Sbjct:   57 AGENLAMFSGRYDTAG-DMACEMWYEESKKYSFVRGGSQMGTG-HFTQMVWKGSKELGMGRA--KTSDGRCTYVVARYQPAGNI 136          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 42.743 bits (99), Expect = 8.095e-6
Identity = 23/83 (27.71%), Postives = 42/83 (50.60%), Query Frame = 3
Query:   12 GNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDV 260
            G N A+ T  ++ +        W++E  YYN      +S T  H+ Q+VW  ++ELG G    +T   + ++++  Y P G++
Sbjct:   95 GENLAMFTGKYESAGEEAT-NMWYEESAYYNFNRPGYQSNTG-HFTQVVWKGTKELGLGR--AKTPDGRLTFVVGRYRPSGNM 173          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 70.0922 bits (170), Expect = 8.604e-15
Identity = 38/107 (35.51%), Postives = 55/107 (51.40%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTC-KSPTCEHYAQMVWADSQELGCGTSICETSQIKQ----SYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            +  G N    T   D+S+     ++WF E   Y+ + N+C +   C HY QMVWAD+  +GC    C T +       SYL+C Y P G+   + PY+ G  CS+CP
Sbjct:  112 EDTGENLFAGTGKLDLSE---AVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCP 215          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 70.0922 bits (170), Expect = 1.125e-14
Identity = 40/125 (32.00%), Postives = 54/125 (43.20%), Query Frame = 3
Query:    6 SVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP--IGTSCVN 329
            S+G N A+    +    P+   Q W+ E+  Y               C  P C HY Q+VWA +  +GC   +C    +         YL+C Y P G+   + PY  GRPCSQCP   G  C N
Sbjct:  129 SIGQNLAVHWGRY--RSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRN 251          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 64.6994 bits (156), Expect = 7.172e-13
Identity = 33/99 (33.33%), Postives = 44/99 (44.44%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            P+   Q W+ E+  Y+              C  P C HY Q+VWA S  +GC  ++C    +      K  YL+C Y P G+     PY  G PCS CP
Sbjct:  157 PTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACP 255          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 64.6994 bits (156), Expect = 7.531e-13
Identity = 33/99 (33.33%), Postives = 44/99 (44.44%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIK---------TNTCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            P+   Q W+ E+  Y+              C  P C HY Q+VWA S  +GC  ++C    +      K  YL+C Y P G+     PY  G PCS CP
Sbjct:  129 PTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACP 227          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1b (cysteine-rich secretory protein LCCL domain-containing 1 [Source:NCBI gene;Acc:101169145])

HSP 1 Score: 64.3142 bits (155), Expect = 1.163e-12
Identity = 33/99 (33.33%), Postives = 46/99 (46.46%), Query Frame = 3
Query:   57 PSIIYQQWFQEIDYYNIKTN---------TCKSPTCEHYAQMVWADSQELGCGTSICETSQI------KQSYLICIYGPGGDVKLKPPYIRGRPCSQCP 308
            P+   Q W+ E+ +Y+   +          C  P C HY Q+VWA S  +GC  ++C    +      K  YL+C Y P G+     PY  G PCS CP
Sbjct:  134 PTYHVQAWYDEVRHYSYPYSQECNPHCPLRCSGPVCTHYTQLVWATSNRIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKYGTPCSACP 232          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072864.1 (SMESG000072864.1)

HSP 1 Score: 216.083 bits (549), Expect = 1.366e-72
Identity = 103/109 (94.50%), Postives = 104/109 (95.41%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            KSVGNNS L+TDSFDVSD SIIYQQ FQEIDYYNIKTNTC SPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGT CVN
Sbjct:   95 KSVGNNSELVTDSFDVSDTSIIYQQCFQEIDYYNIKTNTCTSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTHCVN 203          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072813.1 (SMESG000072813.1)

HSP 1 Score: 185.267 bits (469), Expect = 5.820e-61
Identity = 88/109 (80.73%), Postives = 94/109 (86.24%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            K+VGNNSALITDSF   +PS IYQQWF E  YY+IKTNTC SPTCEHY Q+VWADSQELGCG S C+TS IKQSY ICIYGPGGDVKLKPPYI G PCSQCPIGTSCV+
Sbjct:   62 KTVGNNSALITDSFPFINPSRIYQQWFPEAYYYDIKTNTCSSPTCEHYTQIVWADSQELGCGMSNCDTSHIKQSYFICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVD 170          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072813.1 (SMESG000072813.1)

HSP 1 Score: 186.037 bits (471), Expect = 9.281e-61
Identity = 88/109 (80.73%), Postives = 94/109 (86.24%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            K+VGNNSALITDSF   +PS IYQQWF E  YY+IKTNTC SPTCEHY Q+VWADSQELGCG S C+TS IKQSY ICIYGPGGDVKLKPPYI G PCSQCPIGTSCV+
Sbjct:   91 KTVGNNSALITDSFPFINPSRIYQQWFPEAYYYDIKTNTCSSPTCEHYTQIVWADSQELGCGMSNCDTSHIKQSYFICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVD 199          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072813.1 (SMESG000072813.1)

HSP 1 Score: 186.037 bits (471), Expect = 9.426e-61
Identity = 88/109 (80.73%), Postives = 94/109 (86.24%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            K+VGNNSALITDSF   +PS IYQQWF E  YY+IKTNTC SPTCEHY Q+VWADSQELGCG S C+TS IKQSY ICIYGPGGDVKLKPPYI G PCSQCPIGTSCV+
Sbjct:   95 KTVGNNSALITDSFPFINPSRIYQQWFPEAYYYDIKTNTCSSPTCEHYTQIVWADSQELGCGMSNCDTSHIKQSYFICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVD 203          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072679.1 (SMESG000072679.1)

HSP 1 Score: 175.637 bits (444), Expect = 1.346e-56
Identity = 80/109 (73.39%), Postives = 93/109 (85.32%), Query Frame = 3
Query:    3 KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQMVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQCPIGTSCVN 329
            KSVG+NSAL+TDS  +S+P   + +W Q+   Y++ TNTCKSPTCEH+AQM+WADSQELGCG S C+TSQ+KQSYLICIYGPGGDVKLKPPYI G PCSQCPIGT CVN
Sbjct:   95 KSVGSNSALLTDSLYISNPVFKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTYCVN 203          
The following BLAST results are available for this feature:
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI161.108e-1941.96peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.108e-1941.96peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.108e-1941.96peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
GLIPR1L11.721e-1435.16GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR11.749e-1437.17GLI pathogenesis related 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vap-22.112e-1235.09Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
vap-22.145e-1235.09Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
vap-23.222e-1235.09Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
scl-108.305e-1031.82SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-143.936e-932.95SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG84831.107e-1035.64gene:FBgn0038126 transcript:FBtr0082782[more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU914487.12.197e-1534.91peptidase inhibitor 16-like [Source:NCBI gene;Acc:... [more]
crispld27.507e-1431.90cysteine-rich secretory protein LCCL domain contai... [more]
pi15a1.532e-1241.03peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
crispld1b4.625e-1232.41cysteine-rich secretory protein LCCL domain contai... [more]
pi15b1.263e-1141.03peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld21.200e-1331.20cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.257e-1331.20cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.343e-1331.20cysteine-rich secretory protein LCCL domain contai... [more]
ENSXETT00000036788.11.497e-1234.23pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
R3HDML1.515e-1234.38R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi164.330e-2242.34peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi168.273e-2242.34peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi168.273e-2242.34peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.879e-2142.34peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Crispld24.230e-1531.75cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE2.713e-2042.34Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q6UXB8|PI16_HUMAN5.319e-1941.96Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q58D34|PI16_BOVIN2.348e-1839.18Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI... [more]
sp|Q8BZQ2|CRLD2_MOUSE2.961e-1431.75Cysteine-rich secretory protein LCCL domain-contai... [more]
sp|P48060|GLIP1_HUMAN8.402e-1437.17Glioma pathogenesis-related protein 1 OS=Homo sapi... [more]
back to top
BLAST of peptidase inhibitor 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W2Q6N31.611e-1943.24Peptidase inhibitor 16 OS=Rattus norvegicus OX=101... [more]
M7B9U37.175e-1940.54RRM domain-containing protein OS=Chelonia mydas OX... [more]
A0A1A6I0F68.727e-1941.44SCP domain-containing protein OS=Neotoma lepida OX... [more]
D3ZGM71.461e-1843.24Peptidase inhibitor 16 OS=Rattus norvegicus OX=101... [more]
D3Z6T61.715e-1842.34Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036030.12.584e-1636.19peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.12.723e-1636.19peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.16.012e-1636.19peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
crispld21.064e-1331.90cysteine-rich secretory protein LCCL domain contai... [more]
crispld1b1.738e-1333.33cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.12.309e-1435.64pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
ENSPMAT00000002250.16.588e-1233.33pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CLEC18A4.223e-935.29C-type lectin domain family 18 member A [Source:HG... [more]
ENSPMAT00000000359.12.950e-838.81pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene... [more]
CRISP26.742e-841.38cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRY33.401e-636.67Cell wall-associated protein involved in export of... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO493107.332e-730.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316827.851e-728.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486632.048e-628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493098.095e-627.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.28.604e-1535.51peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
crispld21.125e-1432.00cysteine rich secretory protein LCCL domain contai... [more]
crispld1a7.172e-1333.33cysteine rich secretory protein LCCL domain contai... [more]
crispld1a7.531e-1333.33cysteine rich secretory protein LCCL domain contai... [more]
crispld1b1.163e-1233.33cysteine-rich secretory protein LCCL domain-contai... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072864.11.366e-7294.50SMESG000072864.1[more]
SMESG000072813.15.820e-6180.73SMESG000072813.1[more]
SMESG000072813.19.281e-6180.73SMESG000072813.1[more]
SMESG000072813.19.426e-6180.73SMESG000072813.1[more]
SMESG000072679.11.346e-5673.39SMESG000072679.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009891 ID=SMED30009891|Name=peptidase inhibitor 16|organism=Schmidtea mediterranea sexual|type=transcript|length=409bp
ACAAAAGCGTTGGGAATAATAGTGCTCTGATTACAGATAGTTTTGATGTC
AGCGATCCTTCAATCATTTACCAACAGTGGTTTCAAGAAATTGATTATTA
CAACATTAAAACAAATACATGCAAATCTCCTACTTGTGAACATTATGCTC
AAATGGTATGGGCTGATTCTCAAGAACTTGGATGTGGTACGTCCATATGT
GAAACTTCCCAGATAAAGCAAAGTTATTTAATCTGCATTTACGGACCTGG
AGGAGATGTGAAACTCAAACCTCCATATATAAGAGGACGTCCTTGCTCGC
AATGTCCAATTGGAACATCTTGTGTCAATTCATTATGCAGCTGACTTTTA
AAATGAATTTCTCTCATTTATCAAATGAAAATATTTTAAAATAAATGTTT
TTCATTTTC
back to top

protein sequence of SMED30009891-orf-1

>SMED30009891-orf-1 ID=SMED30009891-orf-1|Name=SMED30009891-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
KSVGNNSALITDSFDVSDPSIIYQQWFQEIDYYNIKTNTCKSPTCEHYAQ
MVWADSQELGCGTSICETSQIKQSYLICIYGPGGDVKLKPPYIRGRPCSQ
CPIGTSCVNSLCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR014044CAP_domain
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0061052negative regulation of cell growth involved in cardiac muscle cell development
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014044CAP domainPFAMPF00188CAPcoord: 24..80
e-value: 5.4E-8
score: 33.7
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 1..113
e-value: 4.1E-29
score: 103.5
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 18..99
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 18..107
NoneNo IPR availablePANTHERPTHR10334:SF414coord: 18..107
NoneNo IPR availableCDDcd05381CAP_PR-1coord: 27..92
e-value: 3.48454E-15
score: 64.5773