Acid-sensing ion channel 1C

Overview
NameAcid-sensing ion channel 1C
Smed IDSMED30009886
Length (bp)1958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acid-sensing ion channel 1C (SMED30009886) t-SNE clustered cells

Violin plots show distribution of expression levels for Acid-sensing ion channel 1C (SMED30009886) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acid-sensing ion channel 1C (SMED30009886) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acid-sensing ion channel 1C (SMED30009886) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009886

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009886h1SMcG0006391 dd_Smed_v4_8949_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009886h1SMcG0006391 dd_Smed_v6_8949_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009886h1SMcG0006391 OX_Smed_1.0.06851ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30009886h1SMcG0006391 dd_Smed_v4_8949_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 53.1434 bits (126), Expect = 9.963e-8
Identity = 23/60 (38.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            E+++  N + + +   +L  + +E+   Y +S LLGDIGG +GL+IGASL+T+ E +D +
Sbjct:   32 EAYIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYL 91          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:HGNC Symbol;Acc:HGNC:21263])

HSP 1 Score: 56.225 bits (134), Expect = 1.485e-7
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+
Sbjct:  533 ETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIY 593          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:HGNC Symbol;Acc:HGNC:21263])

HSP 1 Score: 56.225 bits (134), Expect = 1.516e-7
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+
Sbjct:  514 ETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIY 574          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 53.5286 bits (127), Expect = 8.788e-7
Identity = 30/97 (30.93%), Postives = 55/97 (56.70%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFR-FGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRC 1811
            E+++  N + + +   +L  + +E+   Y +S LLGDIGG +GL+IGASL+T+ E +D +   F D +  Y      N+   +  + T+L++  + C
Sbjct:  401 EAYIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGY----FWNRQHSQRHSSTNLTSHPSLC 493          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 53.1434 bits (126), Expect = 1.371e-6
Identity = 23/60 (38.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            E+++  N + + +   +L  + +E+   Y +S LLGDIGG +GL+IGASL+T+ E +D +
Sbjct:  401 EAYIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYL 460          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: asic-2 (Degenerin-like protein asic-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22851])

HSP 1 Score: 70.4774 bits (171), Expect = 1.787e-12
Identity = 114/534 (21.35%), Postives = 201/534 (37.64%), Query Frame = 3
Query:  186 FSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFL-------CVYMQSPCNWTHFEVRHVWP-YGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTP--SGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNK------CDMQRLNYEYY-DFRTKKSAKFAG-RQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCL-AVEVNETINNRDVD-LNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEES----FVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFG 1715
            FS  ST+  + H+A A N   R+FW  I L     F   L  +I K++  P   N    +   +FP ++ C +NP  +  V +       +     +           +  L     + Y LD   +D L ++  +        A++        C +   PC+ + F  + + P YG C++F       +  ++  +  R   +  +   LT T   +    ++L T   +G  + V+   + P  D   I D+    +  ++  +  NV  K       D +  + +YY DF       F G +Q D +    + Q AN    L       +  K    CL  ++ N+T +  ++D L EC                C+   C   ++T  VS +++P+                                          Y +++ S A     +S N  F  +S    + + N M I+V   +L  +   ET  YT+S ++ D+GG  GLW+G S+I+V E   L+   G
Sbjct:   13 FSNWSTVAVVPHVANANNKISRIFWIAIFLFVLGMFAYELYILIAKFFSYPATVNTEILFEKQIFPVVTVCNMNPYKYSVVKSNSAFSSVNTLMTTYSDATVGTFSTDKWGLYADNDETYDLDSRAADALVLEANLISDTAKVPALYTYADLIQDCSFAGIPCSESDF-TKFIDPVYGACYSF------NEDASLNYSVSREGIQFGLKLMLTVTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGI-DAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKDFIYTLETCFNGCKQRDTI---AKCQCANPRLALGSTDTACQPIKADLDCLQTLKGNQTSSTPNIDLLVEC---------------NCNPP-CDESTYTPTVSLAQFPST----------------------------------------SYYVATSSTAGVGSCSSTNSKFSSKSDCQKWYNNNGMIIQVFLETLSYELYTETAGYTVSNVINDLGGQAGLWLGLSVISVVEMTGLMLVMG 479          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 51.9878 bits (123), Expect = 1.422e-6
Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 3
Query: 1539 RNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            +N   +++    L  + ++E+  YTL+ +L D+GG  GLWIGAS++++ E V LI
Sbjct:  710 KNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI 764          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 51.9878 bits (123), Expect = 1.463e-6
Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 3
Query: 1539 RNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            +N   +++    L  + ++E+  YTL+ +L D+GG  GLWIGAS++++ E V LI
Sbjct:  710 KNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI 764          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 51.9878 bits (123), Expect = 1.463e-6
Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 3
Query: 1539 RNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            +N   +++    L  + ++E+  YTL+ +L D+GG  GLWIGAS++++ E V LI
Sbjct:  710 KNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI 764          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 51.9878 bits (123), Expect = 1.538e-6
Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 3
Query: 1539 RNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            +N   +++    L  + ++E+  YTL+ +L D+GG  GLWIGAS++++ E V LI
Sbjct:  737 KNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI 791          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 71.633 bits (174), Expect = 1.081e-12
Identity = 113/530 (21.32%), Postives = 186/530 (35.09%), Query Frame = 3
Query:  186 FSRQSTIHSLSHLAQARNIKQRM-FWTIIALSASIGFLINLVNIIEKYYERPVLTNVYH-DYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDI--DLSDYLFIQPEVHY---------GHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNS---RRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAK------FAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFR 1709
            F+  ST+H +SH+     I  +   W +  LS+    +   ++ I+ Y E P +T +        VFP ++ C +N I F  +            A+         L +R E     + +   +++    +D+   +P  H+         GH     +  C +  SPC    F V     YG C+TF    +   R  VK  + N       I   + L    +     F      +G+ V +H  D  P+ D         Q+   +       V+  C  QRL Y    + + KS         A     C  D     +   C C + +MP        P+C  V              EC   +  F+ +         D CS  +   +  +SK                       ++    I     KA    L K+Y+ S                   E ++  N M + V   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E  D ++ 
Sbjct:   26 FAHTSTLHGISHIFSYEKITAKCCLWVVFFLSSLTFLMYVCIDRIQFYLEYPHVTKLDEITTPVMVFPAVTICNLNSIRFSRITRNDLYHAGELLAL---------LNSRHEVREAHLVEESVMEVLKSKTDFRSFKPR-HFNMWEFYNRTGHDIKDMLLSCQFRGSPCRPEDFSVVFTR-YGKCYTFNSGETGPPRVSVKGGMGNGLEIMLDIQQDEYLPVWGESDESSFE-----AGIKVQIHSQDEPPFID---------QLGFGVAPGFQTFVS--CQEQRLVYLPAPWGSCKSTPPSSDYFRAYSISACRTDCETRYLVENCNCRMVHMP-----GDAPYCTPVL-----------YKECAHPALDFLVET------DSDYCSCETPCNITRYSK-----------------------ELSFVKIPS---KASVKYLAKKYSKS-------------------EKYITENVMVLDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYE 461          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic4b (acid-sensing (proton-gated) ion channel family member 4b [Source:NCBI gene;Acc:407667])

HSP 1 Score: 54.6842 bits (130), Expect = 2.751e-7
Identity = 24/61 (39.34%), Postives = 41/61 (67.21%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E +D I+
Sbjct:  404 EEYIRDNFLILDIFFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIY 464          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 53.5286 bits (127), Expect = 4.480e-7
Identity = 23/61 (37.70%), Postives = 41/61 (67.21%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E +D ++
Sbjct:  208 EDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYVY 268          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 53.5286 bits (127), Expect = 6.281e-7
Identity = 23/61 (37.70%), Postives = 41/61 (67.21%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E +D ++
Sbjct:  400 EDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYVY 460          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 52.7582 bits (125), Expect = 9.739e-7
Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  N M + +   +L  + IE+   Y L+ LLGDIGG +GL+IGAS++T+ E  D ++
Sbjct:  411 EQYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLY 471          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 60.8474 bits (146), Expect = 5.188e-9
Identity = 99/447 (22.15%), Postives = 173/447 (38.70%), Query Frame = 3
Query:  480 FRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRD---VKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNN-LNTPSGVLVMVHEADTYPY-PDEGFIVDSYTQ--IDLKITTKVHL-NVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNEC-IKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF--RFGDLLSSYRHRPVINQWDEKSKNKTD 1787
            F  S+ + A QE    + Y N    I + D      ++  G+ A   I  C +    C+  +F + H   YGNC+TF  N++ R    V +M    +    K+++Y           D +N  L+T +G  ++VH+ D YP+  D G  +++ T+  I +++T    L +  + C M   +    +  +KK          C+    Q ++   C C   + P+    K   +C   E    I         C  K    FV +    +   R+ CS   +T   S +K+P++   Q                          L+ L   L ++ N          +N +KN           +   + +    L    I E+  Y +  LL + GG +GLW+  S+I V E V++ F   F  +L   + R + N W  +  N+ +
Sbjct:  228 FTFSSGVNAIQEWYR-LHYTNVLAKISMED------KIAMGYKADELIVTCFFDGLSCDARNFTLFHHPLYGNCYTF--NSAERGNLLVSSMGGAEY--GLKVVLY--------IDEDEYNPYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKKYTLQI-----CLNSCFQREMVRTCGCAHYDQPLPNGAK---YCNYEEYPSWIY--------CYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKWPSLNSEQ------------------------WMLRVLSWELGEKLN----------KNLTKN-----------DLANLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFFIDSFWVVLRQ-QWRKLCNWWKHRKDNQEE 593          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 54.6842 bits (130), Expect = 2.969e-7
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLL-SSYRHRPVI 1751
            E+++  NF+ + +   +L  + IE+   Y L  LLGDIGG +GL+IGAS +T+ E +D ++    +L   YR + +I
Sbjct:  357 ETYIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMYEVIQVLFYYYREKGII 433          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 53.9138 bits (128), Expect = 6.055e-7
Identity = 24/61 (39.34%), Postives = 40/61 (65.57%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E+++  NF+ + +   +L  + IE+   Y L  LLGDIGG +GL+IGAS +T+ E +D ++
Sbjct:  357 ETYIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMY 417          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 53.5286 bits (127), Expect = 7.252e-7
Identity = 26/80 (32.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWD 1763
            E+++  NF+ + +   +L  + IE+   Y L  LLGDIGG +GL+IGAS +T+ E +D ++       +    PV+  ++
Sbjct:  357 ETYIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMYEVRGCGGAGSIGPVLVSYE 436          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: cspg4 (chondroitin sulfate proteoglycan 4 [Source:Xenbase;Acc:XB-GENE-5893460])

HSP 1 Score: 51.6026 bits (122), Expect = 3.625e-6
Identity = 27/72 (37.50%), Postives = 42/72 (58.33%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRH 1739
            E ++  N + + V   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E  D I+     L S  H
Sbjct:  424 EKYILDNILVLDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYIYEVITFLKSCEH 495          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 56.6102 bits (135), Expect = 7.279e-8
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFG-DLLSSYRHRP 1745
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+    D L     RP
Sbjct:  406 ETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRP 480          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 56.6102 bits (135), Expect = 7.477e-8
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFG-DLLSSYRHRP 1745
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+    D L     RP
Sbjct:  387 ETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRP 461          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 56.225 bits (134), Expect = 1.043e-7
Identity = 91/383 (23.76%), Postives = 140/383 (36.55%), Query Frame = 3
Query:  615 SAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNN-LNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKS---------AKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNEC---IKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLL 1724
            S IF C + Q+PCN  ++   H   YGNC+TF   N+         N W       V  GL+ T +   + F   L+T +G  VMVH  D     +  F+ D    +   + T + +    K  +  L   Y D     S         +K+   Q  C+    Q  +  +C C     P   K K + FC  +        +      C   ++++FS    G  + KC R  CS  ++     +S++P+VK +                        D   + L           SL     I N    V  L   F + N+      PS             T+  LL ++G    LW G+S+++V E  +LIF   DLL
Sbjct:  279 SFIFTCRFNQAPCNQANYSQFHHPMYGNCYTFNNKNN--------SNLWMSSMP-GVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQD-----EPAFMDDGGFNVRPGVETSISM---RKEALDSLGGNYGDCTENGSDVPVKNLYPSKYT--QQVCIHSCFQENMIKKCGCAYIFYP---KPKGVEFCDYL--------KQSSWGYCYYKLQAAFSLDSLGCFS-KC-RKPCSVTNYKLSAGYSRWPSVKSQ------------------------DWIFEML-----------SLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPS------------VTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIF---DLL 579          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 56.225 bits (134), Expect = 1.043e-7
Identity = 91/383 (23.76%), Postives = 140/383 (36.55%), Query Frame = 3
Query:  615 SAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNN-LNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKS---------AKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNEC---IKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLL 1724
            S IF C + Q+PCN  ++   H   YGNC+TF   N+         N W       V  GL+ T +   + F   L+T +G  VMVH  D     +  F+ D    +   + T + +    K  +  L   Y D     S         +K+   Q  C+    Q  +  +C C     P   K K + FC  +        +      C   ++++FS    G  + KC R  CS  ++     +S++P+VK +                        D   + L           SL     I N    V  L   F + N+      PS             T+  LL ++G    LW G+S+++V E  +LIF   DLL
Sbjct:  279 SFIFTCRFNQAPCNQANYSQFHHPMYGNCYTFNNKNN--------SNLWMSSMP-GVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQD-----EPAFMDDGGFNVRPGVETSISM---RKEALDSLGGNYGDCTENGSDVPVKNLYPSKYT--QQVCIHSCFQENMIKKCGCAYIFYP---KPKGVEFCDYL--------KQSSWGYCYYKLQAAFSLDSLGCFS-KC-RKPCSVTNYKLSAGYSRWPSVKSQ------------------------DWIFEML-----------SLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPS------------VTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIF---DLL 579          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 56.225 bits (134), Expect = 1.073e-7
Identity = 91/383 (23.76%), Postives = 140/383 (36.55%), Query Frame = 3
Query:  615 SAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNN-LNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKS---------AKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNEC---IKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLL 1724
            S IF C + Q+PCN  ++   H   YGNC+TF   N+         N W       V  GL+ T +   + F   L+T +G  VMVH  D     +  F+ D    +   + T + +    K  +  L   Y D     S         +K+   Q  C+    Q  +  +C C     P   K K + FC  +        +      C   ++++FS    G  + KC R  CS  ++     +S++P+VK +                        D   + L           SL     I N    V  L   F + N+      PS             T+  LL ++G    LW G+S+++V E  +LIF   DLL
Sbjct:  198 SFIFTCRFNQAPCNQANYSQFHHPMYGNCYTFNNKNN--------SNLWMSSMP-GVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQD-----EPAFMDDGGFNVRPGVETSISM---RKEALDSLGGNYGDCTENGSDVPVKNLYPSKYT--QQVCIHSCFQENMIKKCGCAYIFYP---KPKGVEFCDYL--------KQSSWGYCYYKLQAAFSLDSLGCFS-KC-RKPCSVTNYKLSAGYSRWPSVKSQ------------------------DWIFEML-----------SLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPS------------VTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIF---DLL 498          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.399e-14
Identity = 117/562 (20.82%), Postives = 212/562 (37.72%), Query Frame = 3
Query:  159 KRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLT-NVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFM-----MYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYP-DEGFIVDSYTQIDLKITTKVHLNVN---NKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAV----EVNETINNRDVDLNECIKS-------SFSFVDQGAINKKCHRDL-------CSHPSFTTVVSHSKYP-------AV-----KERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLL 1724
            +  + ++     +S  H L+ +  +R+ K+++ W ++ ++      + L  ++ KY +  V+  +   D     +P +S C + PI    +    +         + +F      K R E  SFM      Y+N   D                H     +  C + +  C+ ++F       Y NCFTF      +      +N     F +     L P T    +  NN+   +GV V+VH   + P P D G  +       + +   +H  +      C    LN      +  K   FA     C+    Q  I  RC C    +P    + +  FC  +    E+N   +N D + +E  ++       +    +Q  +N     +L       CS  S+   VS S +P       AV     +ERQ       K       ++ H +      K L  N     +I S S ++  +  +K  + L    + +N +++ +    L +    +   Y L+ L  DIGG +GLW+G S++T+ E ++L+ R   L+
Sbjct:   37 RSAIDIIAELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNESQNLITWLRFIQ----KFRFEQDSFMNSIRAFYENLGQDAK-----------KLSHNLEDMLMHCRFNRELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPL-PGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLN----GIKQYKYTFFA-----CLQLCKQRLIIQRCGCKSSALPEVPSY-NATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPS-----QKHLARNDSHMDDILSKSYSLSEKEMAKEASDL----IRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIRLTGLV 563          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q9JHS6|ASIC4_RAT (Acid-sensing ion channel 4 OS=Rattus norvegicus OX=10116 GN=Asic4 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.092e-7
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFG-DLLSSYRHRP 1745
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+    D L     RP
Sbjct:  406 ETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRP 480          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q7TNS7|ASIC4_MOUSE (Acid-sensing ion channel 4 OS=Mus musculus OX=10090 GN=Asic4 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.092e-7
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFG-DLLSSYRHRP 1745
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+    D L     RP
Sbjct:  406 ETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRP 480          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q96FT7|ASIC4_HUMAN (Acid-sensing ion channel 4 OS=Homo sapiens OX=9606 GN=ASIC4 PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 7.278e-7
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E+++  NF+ + V   +L  + +E+   Y LS LLGD+GG +GL+IGAS++T+ E +D I+
Sbjct:  514 ETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIY 574          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q61180|SCNNA_MOUSE (Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 9.123e-7
Identity = 91/383 (23.76%), Postives = 140/383 (36.55%), Query Frame = 3
Query:  615 SAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNN-LNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKS---------AKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNEC---IKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLL 1724
            S IF C + Q+PCN  ++   H   YGNC+TF   N+         N W       V  GL+ T +   + F   L+T +G  VMVH  D     +  F+ D    +   + T + +    K  +  L   Y D     S         +K+   Q  C+    Q  +  +C C     P   K K + FC  +        +      C   ++++FS    G  + KC R  CS  ++     +S++P+VK +                        D   + L           SL     I N    V  L   F + N+      PS             T+  LL ++G    LW G+S+++V E  +LIF   DLL
Sbjct:  304 SFIFTCRFNQAPCNQANYSQFHHPMYGNCYTFNNKNN--------SNLWMSSMP-GVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQD-----EPAFMDDGGFNVRPGVETSISM---RKEALDSLGGNYGDCTENGSDVPVKNLYPSKYT--QQVCIHSCFQENMIKKCGCAYIFYP---KPKGVEFCDYL--------KQSSWGYCYYKLQAAFSLDSLGCFS-KC-RKPCSVTNYKLSAGYSRWPSVKSQ------------------------DWIFEML-----------SLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPS------------VTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIF---DLL 604          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A564Z6I1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12764 PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 9.008e-135
Identity = 225/570 (39.47%), Postives = 327/570 (57.37%), Query Frame = 3
Query:  144 LTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTF----VVNNSRRDVKNMIK-NAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQT-QYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDL----------LSSYRHRPVINQWDEKSKNKTDLSNKSN 1805
            L  M        + FSR+ST+H L+HLAQAR  ++R+FW  I+++A +GF  N+  +IEKY + PVLTNV HD   F++PD++FC +NPI+FPP  T ++K++      + KF+ STH    +              ++L+DYLF++    Y HP W  I  C YMQ+PC++ HF+ + +WPYG C+TF    ++NN  R++    + N +RPDFKIIVYK L    ++ MDP  ++N PSG+L+M+HE  TYP+     IVD   QI+L++T   HL    KC  +R +  Y +  T +S  F   Q DC+   +QT +A  C C +  MPV  ++ +LPFC +  +N +           I+S FS V      + C RD+C H +   VV H+K+PA+ ER T Q          E+ + Q+   SD+   AL  +     N++     IK   AS N + L   FV+RNFM +R+VP+SLFMD +EET EY  SRLL DIGGC+GLWIGASLIT+FEF DLI  F DL          LS ++ +   ++++  ++   D+  KSN
Sbjct:   68 LIYMAAACGASFLRFSRRSTMHGLNHLAQARTAQRRLFWLCISIAALVGFFFNMFFLIEKYIQVPVLTNVLHDSDNFIYPDVTFCNINPIYFPPKETAEFKRMIAAIEKFKKFKKSTHPHVHR--------------LELADYLFVERNTFYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEEYRMDPHGSVNVPSGILLMIHEPGTYPHIGHSSIVDECAQIELRMTYVKHLAKLGKCVPEREHISYVNTATNESQNFLSSQSDCLDAAVQTALAENCGCQMHTMPVMYRYNNLPFCFSDSLNFSF----------IESCFSNVSNAVDRQHCFRDVCEHFTIDRVVVHAKFPAIAERHTYQNWLRLLARLEEREKAQYRGKSDIAKLALNADFTANPNLT-----IKDIFASGNTSLLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDFMDLGNISFPNVDELSVHKFQKSKSRFNNSNEKILDVCEKSN 608          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A0R3SIE1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4705 PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 9.105e-135
Identity = 225/570 (39.47%), Postives = 327/570 (57.37%), Query Frame = 3
Query:  144 LTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTF----VVNNSRRDVKNMIK-NAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQT-QYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDL----------LSSYRHRPVINQWDEKSKNKTDLSNKSN 1805
            L  M        + FSR+ST+H L+HLAQAR  ++R+FW  I+++A +GF  N+  +IEKY + PVLTNV HD   F++PD++FC +NPI+FPP  T ++K++      + KF+ STH    +              ++L+DYLF++    Y HP W  I  C YMQ+PC++ HF+ + +WPYG C+TF    ++NN  R++    + N +RPDFKIIVYK L    ++ MDP  ++N PSG+L+M+HE  TYP+     IVD   QI+L++T   HL    KC  +R +  Y +  T +S  F   Q DC+   +QT +A  C C +  MPV  ++ +LPFC +  +N +           I+S FS V      + C RD+C H +   VV H+K+PA+ ER T Q          E+ + Q+   SD+   AL  +     N++     IK   AS N + L   FV+RNFM +R+VP+SLFMD +EET EY  SRLL DIGGC+GLWIGASLIT+FEF DLI  F DL          LS ++ +   ++++  ++   D+  KSN
Sbjct:   68 LIYMAAACGASFLRFSRRSTMHGLNHLAQARTAQRRLFWLCISIAALVGFFFNMFFLIEKYIQVPVLTNVLHDSDNFIYPDVTFCNINPIYFPPKETAEFKRMIAAIEKFKKFKKSTHPHVHR--------------LELADYLFVERNTFYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEEYRMDPHGSVNVPSGILLMIHEPGTYPHIGHSSIVDECAQIELRMTYVKHLAKLGKCVPEREHISYVNTATNESQNFLSSQSDCLDAAVQTALAENCGCQMHTMPVMYRYNNLPFCFSDSLNFSF----------IESCFSNVSNAVDRQHCFRDVCEHFTIDRVVVHAKFPAIAERHTYQNWLRLLARLEEREKAQYRGKSDIAKLALNADFTANPNLT-----IKDIFASGNTSLLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDFMDLGNISFPNVDELSVHKFQKSKSRFNNSNEKILDVCEKSN 608          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A0R3TJX9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7422 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.067e-132
Identity = 219/521 (42.03%), Postives = 310/521 (59.50%), Query Frame = 3
Query:  177 LIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTF----VVNNSRRDVKNMIK-NAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYX-XXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDL 1721
             + FSR+ST+H L+HL+QAR  ++R+FW  I+++A  GF  N+  ++EKY + PVLTNV HD   F++PD++FC +NPI+FPP GT +++++      + +F+ S H    +              ++L+DYLF++   +Y HP W  I  C YMQ+PC++ HF+ + +WPYG C+TF    ++NN  R++    + N +RPDFKIIVYK L    +F MDP  ++N PSGVL+M+HE  TYP+     IVD  TQI+L++T   HL    KC  +R    Y +  T KS  F   QPDC+   +QT +A  C C +  MPV  K+ HLPFC +  +N T           I++ FS V      K C RD+C H +   VV+H+K+PA++ER T Y          E+ + Q+   SD+   AL  +     N++     IK    S N + L   FV+RNFM +R+VP+SLFMD +EET EY  SRLL DIGGC+GLWIGASLIT+FEF DLI    DL
Sbjct:   81 FLRFSRRSTMHGLNHLSQARTAQRRLFWLCISIAALFGFFFNMFFLVEKYVQVPVLTNVLHDSDNFIYPDVTFCTINPIYFPPEGTTEFERMSSAIEKFKEFKRSNHPHVHR--------------LELADYLFVERNTYYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEKFRMDPHGSVNVPSGVLLMIHEPGTYPHIGHSSIVDECTQIELRMTYVKHLAKLGKCVPEREYISYVNTATNKSQIFLSSQPDCLDAAVQTALAENCGCQMHTMPVMYKYHHLPFCFSDALNFTF----------IENCFSNVANTVDRKHCFRDVCEHFTIDRVVAHAKFPAIEERHTYYNWLHLLARLEEREEAQYKGKSDIAKLALNADFTVNPNLT-----IKEVLVSGNTSLLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDCVDL 572          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A448WRB3 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS11667 PE=3 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.065e-130
Identity = 222/552 (40.22%), Postives = 321/552 (58.15%), Query Frame = 3
Query:  162 RMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVN--NSRRDVKNM-IKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECI---KSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHY-NISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPV-----INQWDEKSKNK 1781
            R+ T LI FS++ST H L+HLAQAR+  +R+FW  I+L ASIGF  NL  +I KY + P+LTNV HD + F++PD++FC VN I+FPP  +  Y++L   F+ Y +                ++ K  +  I LSDYL++QP  +Y HPAWSA+  C Y   PCNW HF+VR +WP+G+CFT      N +RD+++  IK  +RPDFK+I+YK L     F+ D  N ++ P G+ +M+HE  T+P  DE  IV+  TQ+D+K+T   HL   +KC  +R   + +D  +  S     RQ DC+  ++Q  +A  C CL+ ++P+S    HL FC     N +       LN+C+   ++ FS        + C  DLC H S T VVS S YP +++R T   WL  L  +E  +++H+ N SDL  KAL P+         L++ ++       V+ L   FV+RNF+ +R+ PS  FMD + ET+EY LS LL DIGGC+GLWIGASLIT+FE VDL+    D+  S+  R V      ++W  ++  K
Sbjct:   99 RVGTTLIRFSQRSTFHGLNHLAQARSAHRRIFWLAISLFASIGFFTNLYFLIYKYMQTPILTNVLHDAQPFIYPDVTFCFVNSIYFPPRNSSAYQELVRHFSAYDQ----------------LVAKGLNNKIKLSDYLYMQPHANYTHPAWSAVVQCHYQHQPCNWQHFDVRRLWPWGSCFTLNATKMNMKRDIRHREIKKKFRPDFKLIIYKALDRPADFTRDLHNGVDLPPGIALMIHEPGTFPPRDECAIVNGCTQVDIKMTWVSHLAHLSKCSSKRDILDLFDIGSGTSYSVLARQADCIDTIVQQSVALECHCLIHSLPISNNISHLDFCFNGRFNISY------LNDCLLRSQAHFSV-------EHCFLDLCEHFSMTRVVSQSSYPGIRDRFTHRDWLRVLAGIEVSELEHFGNTSDLAEKALLPHANATGPPMRLTEVVR----QGRVDLLNTDFVERNFLMLRIQPSGFFMDKVLETVEYPLSHLLSDIGGCVGLWIGASLITLFECVDLVL---DMAESWSMRVVGPLRLTSRWKAQADQK 614          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A183SCX1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS2069 PE=3 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 2.283e-119
Identity = 209/508 (41.14%), Postives = 306/508 (60.24%), Query Frame = 3
Query:  186 FSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTF----VVNNSRRDVKNMIK-NAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNI-SDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEF 1691
            FSR+ST+H L+HLAQAR  ++R+FW  I+L++S GF  NL  ++EKY + PVLTNV HD   F+FPD++FC VNPI+FPP GT ++++++     +  F+ S++  A++ A              L+DYLFI+   +Y HP W  I  C YMQ+PC+  HF+ + +WPYG C+TF    + +N  R++    + N +RPD +IIVYK L     +  DP ++   P GVL+M+HE  TYP+     IVD  TQ++LK+T+  HL    KC   R    Y +  + +S  F   Q DC+   +Q+ +A  C C +  MP+  ++ H PFC +  +  +       L  C   + + VD+    K C  D+C H +   V++H+K+PAV++R T+  WL+ L +LE  +++ Y+  SDL   ALK   V   NI +L++A K     + ++ L   FV+RNFM +RVVP SLFMD +EET EY  SRLL DIGGC+GLWIGASLIT+FE 
Sbjct:   80 FSRRSTMHGLNHLAQARTAQRRLFWLCISLASSFGFFFNLFFLMEKYIQVPVLTNVLHDSDNFIFPDVTFCNVNPIYFPPNGTPEFERIKENIHAFEDFKRSSNPFAKRLA--------------LADYLFIKRNTYYVHPKWLTIVECSYMQTPCSSEHFDEKIIWPYGACYTFNATRMPHNMSREISTRTRYNRFRPDLRIIVYKALEFPEGYRFDPHDSFQVPPGVLLMIHEPGTYPHIGHSGIVDECTQVELKMTSVTHLAKLGKCIPMRSRIAYVNVASNESQTFLSSQSDCLDAEVQSALAKYCGCQMHTMPIMYEYHHQPFCFSGALEPSF------LETCFNKATASVDR----KHCFLDVCEHYTIDRVIAHTKFPAVEDRHTEQHWLQLLADLEDRELKQYSGRSDLAKMALKD--VPGGNI-TLAEAAK----KRQIDLLNIDFVNRNFMMLRVVPDSLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEL 556          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 55.0694 bits (131), Expect = 1.598e-7
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++TV E +D I+
Sbjct:  403 EDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYIY 463          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: asic4b (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103044180])

HSP 1 Score: 54.299 bits (129), Expect = 3.531e-7
Identity = 24/61 (39.34%), Postives = 41/61 (67.21%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E +D I+
Sbjct:  407 EDYIRDNFLILDIYFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIY 467          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 52.373 bits (124), Expect = 1.170e-6
Identity = 24/55 (43.64%), Postives = 38/55 (69.09%), Query Frame = 3
Query: 1542 NFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++TV E +D I+
Sbjct:  392 NFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYIY 446          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 51.6026 bits (122), Expect = 1.358e-6
Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF-----RFGDLLS 1727
            E ++  N + + V   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E  D  +     R  DLLS
Sbjct:  188 EKYITDNILVLDVFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILELFDYAYEVVKERLLDLLS 260          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: ENSAMXT00000038299.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 51.6026 bits (122), Expect = 1.843e-6
Identity = 23/61 (37.70%), Postives = 39/61 (63.93%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  N + + +   +L  + IE+   Y L+ LLGDIGG +GL+IGAS++T+ E  D ++
Sbjct:  403 EQYISDNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLY 463          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Sea Lamprey
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 47.3654 bits (111), Expect = 9.014e-6
Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVV-PSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  N + + +   ++L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E  D ++
Sbjct:  412 EDYIRENVLVLDIFFEAALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILEIFDYLY 473          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 62.7734 bits (151), Expect = 2.180e-10
Identity = 47/216 (21.76%), Postives = 90/216 (41.67%), Query Frame = 3
Query: 1059 CVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVD-RNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            C +  +  +   RC C   N P  +K +++P C         N  +  + +C+  ++   + G+ +++C    CS  SF   VS +++PA                                        + + ++  +  ++++  +K  +   + FV+  N  Q+ V    L    ++ETL YT   LL DIGG +G+WIG S +T  E ++L+
Sbjct:  321 CKYSCLNARKIERCGCTNYNTPEMQK-RNIPLC---------NRLNSTIIDCLNKAYDTFEDGSCDRECPPS-CSEVSFDLTVSSARWPA----------------------------------------RSFEVTKYAYFLRVRVLNKIASSSSKYFVNSENIAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELV 485          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO36191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB5])

HSP 1 Score: 56.6102 bits (135), Expect = 2.108e-8
Identity = 26/70 (37.14%), Postives = 43/70 (61.43%), Query Frame = 3
Query: 1521 EESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSS 1730
            + S + +NF+++++    L  + I  +L Y +  LLGD+GG +GLWIG S+IT  EF+ L+      L+S
Sbjct:  391 DASILRKNFLRVKLYYEELNRETITYSLSYPVENLLGDVGGQLGLWIGVSVITCAEFLKLLVDLAWYLAS 460          

HSP 2 Score: 51.6026 bits (122), Expect = 6.918e-7
Identity = 65/291 (22.34%), Postives = 112/291 (38.49%), Query Frame = 3
Query:  186 FSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFV-FPDISFCLVNPI------HFPPVGTRQYKQLEHQFAMYF---------KFRNSTHLKARQEALSF--------MMYKNYSLDID------LSDYLFIQPE---VHYGHPAWSAIFLCVYMQSPCN-------WTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNN-------LNTPSGVLVMVHEADTYPYP-DEGFIV 914
            FS +++ H +  +  ++++  R+ W +I L+     L   + +++ Y  +P  T V   Y     FP ++ C +N I      HFP     Q K+L   F              F ++   KA ++ LS         ++  N ++D+       +  YL +      +  GH     +F CV+    CN       W  F     W YGNC+TF   N   DV          +   +      P    ++D F +       L+  +GV V++ +    P+P   GF V
Sbjct:   17 FSDRTSCHGIGQIGGSQSVMWRVSWLMIFLAGLGMVLYQGLTLLDTYLNKPTATAVDITYSEVTNFPSVTICNMNMIKKSQLQHFP-----QVKRLVDTFNNMTSSNSSLNSSAFMDTNREKAEKDRLSLNTKNSKNKVILNNVNIDMQRYIEDKIVQYLSMSDTTKLMKAGHVFRELVFRCVWNGFVCNKGDFLKYWRPF---WHWRYGNCYTF---NQGVDVNGT-------ELPSLASSKPGPMYGLTLDLFIDQEQYIIPLSQEAGVKVLLSDQRNIPFPFTHGFTV 289          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO48658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI84])

HSP 1 Score: 52.373 bits (124), Expect = 1.884e-7
Identity = 24/58 (41.38%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 1530 FVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            F+  N+  I +    L +D I++T  Y   RL+GD+GG +GL +GAS+IT+ E +DL+
Sbjct:  154 FILENYSVINLFFDELRLDTIQQTPAYGFFRLVGDVGGQLGLVLGASVITIVEIIDLV 211          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO37654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF66])

HSP 1 Score: 51.6026 bits (122), Expect = 2.820e-7
Identity = 32/114 (28.07%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  159 KRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLT--NVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNST 494
            K+++T +  F   +T H  + L +++N  QR FW +  L A + F + +  +  K+  +PV T   V H+     FP ++ C +NPI        + K L      YFK+   T
Sbjct:    6 KKIVTKIKDFLGYTTAHGFARLVESKNPVQRAFWVLACLGAFVAFGLQVHKLFSKFNRKPVDTYITVKHEM-NLEFPAVTICNLNPI--------RKKHLPESLREYFKYSLGT 110          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO48656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI82])

HSP 1 Score: 51.9878 bits (123), Expect = 5.628e-7
Identity = 23/58 (39.66%), Postives = 39/58 (67.24%), Query Frame = 3
Query: 1530 FVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLI 1703
            ++  N ++I++    L    +++   Y L  LLGD+GG IGL++GASL+TV E++DL+
Sbjct:  515 YLRDNLIEIKIYYEDLTYFDVQQVPSYDLYSLLGDVGGQIGLFLGASLLTVVEYLDLL 572          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Match: ENSORLT00000031246.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 69.3218 bits (168), Expect = 5.397e-12
Identity = 115/533 (21.58%), Postives = 194/533 (36.40%), Query Frame = 3
Query:  186 FSRQSTIHSLSHL-AQARNIKQRMFWTIIALSASIGFLINL-VNIIEKYYERPVLTNVYHDYRTF-VFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMY---FKFRN-----STHLKARQEALSFMMYKNYSLDI-DLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPF-------NNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAG------RQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFR 1709
            F+ +ST+H +SH+    R   +R  W I+    S+G L+ + V+ ++ Y+E P +T +     +  VFP I+FC +N   F  V            A+    ++ R+        L+  +E   F  YK  S ++ +  D          GH     +  C Y  + C+  +F+V     YG C+TF   NS +D + ++        K     GL        D +       +  +  +G+ V +H  +  P+ D         Q+   +       V+  C  QRL Y    +   KS               C  D     +   C C + +MP        P+C   +             EC   +  F+ +   +       C+   +   +S  K P+                                KA    L K++N +        Q  + N+  L+  F   N+            + IE+   Y L+ LLGDIGG +GL+IGAS++TV E  D ++ 
Sbjct:   21 FATRSTLHGISHMFTYERMCLKRTLW-ILFFMLSVGVLVMVCVDRVQFYFEYPHVTKLDEVAASMIVFPAITFCNLNSFRFSRVTRNDLYHAGELLALLNGRYEIRDPHLVEENVLQVLRERADFESYKPRSFNMREFYD--------RTGHDIKDMLLSCSYRGTECSAENFKVIFTR-YGKCYTF---NSGKDGQPLMVT-----MKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQEEPPFID---------QLGFGVAPGFQTFVS--CQEQRLTYLPPPWGDCKSTPMDSDFFNSYSITACRIDCETRYLVENCNCRMVHMP-----GDAPYCSPEQY-----------KECADPALDFLVERDNDYCVCETPCNLTRYGKELSFVKIPS--------------------------------KASAKYLAKKFNKTE-------QYIADNILVLDIFFEALNY------------ETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYE 457          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Match: asic4a (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:101159336])

HSP 1 Score: 57.3806 bits (137), Expect = 3.529e-8
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKS 1802
            E ++  NF+ + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++TV E +D +F   +++     R +  Q +EK + K+ ++  S
Sbjct:  400 EDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYVF---EVIRHRLQRLLRPQKEEKKQPKSAVATVS 489          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Match: ENSORLT00000008662.2 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 51.6026 bits (122), Expect = 1.884e-6
Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  N + + +   +L  + IE+   Y L+ LLGDIGG +GL+IGAS++TV E  D ++
Sbjct:  413 EQYIADNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLY 473          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Match: ENSORLT00000031708.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 51.6026 bits (122), Expect = 2.182e-6
Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIF 1706
            E ++  N + + +   +L  + IE+   Y L+ LLGDIGG +GL+IGAS++TV E  D ++
Sbjct:  430 EQYIADNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLY 490          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Match: ENSORLT00000021925.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 51.2174 bits (121), Expect = 2.647e-6
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 3
Query: 1524 ESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFR-FGDLLSSY---RHRP 1745
            E ++  N + + +   +L  + IE+   Y ++ LLGDIGG +GL+IGAS++T+ E  D ++  F D +  Y   + RP
Sbjct:  395 EQYIGDNILVLDIFFEALNYEKIEQKKAYEIAGLLGDIGGQMGLFIGASVLTILEIFDYLYEVFKDKVLGYFLRKKRP 472          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000056126.1 (SMESG000056126.1)

HSP 1 Score: 1286.17 bits (3327), Expect = 0.000e+0
Identity = 628/629 (99.84%), Postives = 629/629 (100.00%), Query Frame = 3
Query:   63 MIKSNGHKMTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLEDEINLTLLQPISLIKGSRSYFYKHMKLEDI 1949
            MIKSNGHKMTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQM+HYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLEDEINLTLLQPISLIKGSRSYFYKHMKLEDI
Sbjct:    1 MIKSNGHKMTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQMRHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLEDEINLTLLQPISLIKGSRSYFYKHMKLEDI 629          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000056126.1 (SMESG000056126.1)

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 620/621 (99.84%), Postives = 621/621 (100.00%), Query Frame = 3
Query:   87 MTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLEDEINLTLLQPISLIKGSRSYFYKHMKLEDI 1949
            MTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQM+HYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLEDEINLTLLQPISLIKGSRSYFYKHMKLEDI
Sbjct:    1 MTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQMRHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLEDEINLTLLQPISLIKGSRSYFYKHMKLEDI 621          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000029022.1 (SMESG000029022.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 261/549 (47.54%), Postives = 377/549 (68.67%), Query Frame = 3
Query:  123 KPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTR---QYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNN-----SRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETIN-NRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHR 1742
            + +  +Y+  +CKR+ TVL+  SRQST+HSL+HL+QA+N KQ++ W +I  +A  GF INL ++I KY ERPVLTN++HD+ +FV+PDI+ C VNP++F   G+R     K L   F++  K     H  +     +F  ++ +  + D+SD LFIQ  + Y HPAWS I  CVYMQ+ C+W+ FE+RH+WP+GNC TF V       SR   K M+KN WRPDFKI+VYKG++   +F  DPFNN+NTP+G+L+M+HEA+T+PY DEG  VD++TQIDLK TTKVH+NVN +C+ Q++ YEYYDF+T K   F GRQ DC+ +++Q +I   C C+L  +PV    + LPFC+ ++ +  I+ ++   LN+C++ + + +     +K CH+DLC H +FTTVVSHS YP+V+E+Q  YLWL  L EL++ +++    SDL+   ++  ++ ++N++S+  AI++         L E F++RNFMQ+R+VPSSLFMDHIEET+EY L RLL DIGGCIGLW+GASLIT+FE + L  R  D    Y+ +
Sbjct:   43 QETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKI---VHRNSSDSTNNF--FEGFD-NPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEHTTFTTVVSHSSYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFK 585          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000047581.1 (SMESG000047581.1)

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 272/539 (50.46%), Postives = 365/539 (67.72%), Query Frame = 3
Query:  159 KRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNNSR------RDVK-NMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLY-LKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVI 1751
            +R+ TVL+ FSR+STIH L+HLAQAR+ K R+FW  I+ SAS+GF +NL  +IEK+ + PVLTNV+HD+  F +PD+S C+VNPI+FPP  TR   +L      Y++  NS+   ++        Y      I+LSDYLF+  ++ Y HP+WSAI LC Y++  CN+THFE RH+WPYGNCFTF  N ++      RDVK N + N WRPDFK+++YK L       +DPFN++N PSGVLVM+HE +TYP+  E F+VDS+TQ+DLKITTK HL+   KC+  R NY YYDF+T  S  F GRQ DC+F +IQT IAN C C L  MP+ +K K LPFC           R+ +L  C+ +S   VD+  + + C++DLC HPSF+TVVSHSKYPAV+ERQT  LWLE L +LE L+++HY  S+L  +  LK N   ++N  S+ +          ++ L E F+++NFM +R VPSSLFMDH+EET EY LSRLL DIGGC+GLW+GASLITVFEF+DL+    +++  YR +  +
Sbjct:   51 RRLGTVLLHFSRRSTIHGLNHLAQARSAKHRLFWLTISCSASLGFCVNLFYLIEKFLQTPVLTNVFHDFNNFTYPDLSICIVNPIYFPPENTRYRNELISTIEEYYRLTNSSFHDSKSS------YNANLQKIELSDYLFMHSKLEYSHPSWSAIILCRYLKKKCNYTHFETRHIWPYGNCFTF--NGTKMGLEGTRDVKKNTVLNGWRPDFKLVIYKALEYPVNLQIDPFNDINKPSGVLVMIHEPNTYPHIGESFVVDSFTQVDLKITTKSHLSSLKKCESIRNNYTYYDFKTNTSNIFVGRQGDCLFSIIQTNIANYCGCQLHKMPILEKHKQLPFCYDKRF------RNENLTYCLHASLDDVDREQLRQLCYKDLCEHPSFSTVVSHSKYPAVRERQTHMLWLEHLKDLELLEIEHYGQSELINMAILKSNSSLKHNYKSIREIYD----KGRIDLLNEKFINKNFMHLRFVPSSLFMDHVEETEEYPLSRLLSDIGGCVGLWVGASLITVFEFIDLLLDLSEII-RYRSQATV 570          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000009914.1 (SMESG000009914.1)

HSP 1 Score: 514.998 bits (1325), Expect = 1.380e-175
Identity = 271/578 (46.89%), Postives = 374/578 (64.71%), Query Frame = 3
Query:  150 IMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLD------IDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTF----VVNNSRRDV-KNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYXXXXXXXXXXXXQMQHYNISDLYLKALK---------PNLVK-QYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNK 1820
            I+ KR+ T+ + F+R+STIH L+HLAQAR+ K+R+FW  I+  A++GF +NL  ++EK+ + P+LTN +HDY +F++PDI+FCLVNPI+FPP  + QYK L      Y           R E   F  Y N S +      ++L DYLFI+  + Y H  WSAI  C Y+  PC+W HF+V  VWPYGNCFTF    +  N  RDV +NM  N +RPDF+II+YK +   +    DPFN++  PSGVLVM+HE +TYP+  + FIVDSYTQ+DLKITTK HL    KC+  R NY Y D+R+KK   F GR  DCVF++IQ +IA  CKC +  MPV  K +  PFC ++ ++  +N   +   +C+  +   VD+ +I+  C++DLCSHPS++TV+SHSKYPA+++RQT  LWL+KL  +EK ++++Y IS+L+ KA+K         PN ++ Q  I     +I         + ++E F+D+NFMQ+R VPSSLFMDHIEET EY +SRLL DIGGC+GLW+GASLIT+FEF DL+    D+L   R RP  N    K  N +   N +N   N+
Sbjct:   27 IIFKRLGTIFLHFTRRSTIHGLNHLAQARSAKRRLFWLFISTCATVGFFVNLFYLVEKFIQTPILTNTFHDYTSFIYPDITFCLVNPINFPPKTSAQYKYLIGIINNYI----------RNEESLFHKYINSSKNEDFLPKLELMDYLFIKENISYSHSPWSAIVDCRYLHYPCSWEHFDVHFVWPYGNCFTFNATKMQKNLTRDVQRNMQLNGFRPDFRIIIYKSINRLSSVVHDPFNDITKPSGVLVMIHEIETYPHVSDSFIVDSYTQVDLKITTKSHLESLKKCNPNRQNYTYCDYRSKKCQTFQGRNIDCVFEIIQNKIAKNCKCQMHTMPVLMKNRFYPFCYSLMLSNPLNVSSI--RKCLNQTIVGVDKQSIHSICYQDLCSHPSYSTVISHSKYPAIQDRQTHSLWLKKLIVIEKREIENYGISNLFQKAIKRNHSTLLRNPNFMENQIPIGKRFDSIDAVYRDMRDDLIDELFIDQNFMQLRFVPSSLFMDHIEETEEYPISRLLSDIGGCVGLWVGASLITIFEFFDLLMDLSDIL---RIRPFPNS--RKDVNDSKKENDANELENE 587          
The following BLAST results are available for this feature:
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASIC39.963e-838.33acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
ASIC41.485e-740.98acid sensing ion channel subunit family member 4 [... [more]
ASIC41.516e-740.98acid sensing ion channel subunit family member 4 [... [more]
ASIC38.788e-730.93acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
ASIC31.371e-638.33acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic-21.787e-1221.35Degenerin-like protein asic-2 [Source:UniProtKB/S... [more]
unc-1051.422e-638.18Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.463e-638.18Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.463e-638.18Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.538e-638.18Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic1a1.081e-1221.32acid-sensing (proton-gated) ion channel 1a [Source... [more]
asic4b2.751e-739.34acid-sensing (proton-gated) ion channel family mem... [more]
asic4a4.480e-737.70acid-sensing (proton-gated) ion channel family mem... [more]
asic4a6.281e-737.70acid-sensing (proton-gated) ion channel family mem... [more]
asic1b9.739e-739.34acid-sensing (proton-gated) ion channel 1b [Source... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh125.188e-922.15cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
ASIC42.969e-736.36acid sensing ion channel subunit family member 4 [... [more]
ASIC46.055e-739.34acid sensing ion channel subunit family member 4 [... [more]
ASIC47.252e-732.50acid sensing ion channel subunit family member 4 [... [more]
cspg43.625e-637.50chondroitin sulfate proteoglycan 4 [Source:Xenbase... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asic47.279e-838.67acid-sensing (proton-gated) ion channel family mem... [more]
Asic47.477e-838.67acid-sensing (proton-gated) ion channel family mem... [more]
Scnn1a1.043e-723.76sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.043e-723.76sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.073e-723.76sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP2.399e-1420.82FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|Q9JHS6|ASIC4_RAT5.092e-738.67Acid-sensing ion channel 4 OS=Rattus norvegicus OX... [more]
sp|Q7TNS7|ASIC4_MOUSE5.092e-738.67Acid-sensing ion channel 4 OS=Mus musculus OX=1009... [more]
sp|Q96FT7|ASIC4_HUMAN7.278e-740.98Acid-sensing ion channel 4 OS=Homo sapiens OX=9606... [more]
sp|Q61180|SCNNA_MOUSE9.123e-723.76Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Z6I19.008e-13539.47Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3SIE19.105e-13539.47Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3TJX92.067e-13242.03Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A448WRB31.065e-13040.22Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A183SCX12.283e-11941.14Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a1.598e-740.98acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4b3.531e-739.34acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4a1.170e-643.64acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic21.358e-638.36acid-sensing (proton-gated) ion channel 2 [Source:... [more]
ENSAMXT00000038299.11.843e-637.70acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic1a9.014e-635.48acid-sensing (proton-gated) ion channel 1a [Source... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421372.180e-1021.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361912.108e-837.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486581.884e-741.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376542.820e-728.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486565.628e-739.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031246.15.397e-1221.58acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
asic4a3.529e-833.33acid sensing ion channel subunit family member 4 [... [more]
ENSORLT00000008662.21.884e-639.34acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000031708.12.182e-639.34acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000021925.22.647e-634.62acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056126.10.000e+099.84SMESG000056126.1[more]
SMESG000056126.10.000e+099.84SMESG000056126.1[more]
SMESG000029022.10.000e+047.54SMESG000029022.1[more]
SMESG000047581.10.000e+050.46SMESG000047581.1[more]
SMESG000009914.11.380e-17546.89SMESG000009914.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009886 ID=SMED30009886|Name=Acid-sensing ion channel 1C|organism=Schmidtea mediterranea sexual|type=transcript|length=1958bp
GTAATCTTTTATGTTTATGATACTCTTGATTTATTTTGTAAATAGATTTG
CATTTTTAGATTATGATTAAAAGTAACGGACATAAAATGACTGTTAATGA
CAAACAACATAATGTTGTTACCAAGCCCTCAGTTTCTGATTATTTGACGA
TAATGTGTAAGAGGATGATGACAGTGCTCATTGGATTTTCAAGACAAAGC
ACTATTCATAGTTTAAGTCATCTTGCTCAAGCTCGAAATATTAAACAAAG
AATGTTCTGGACTATTATTGCTCTTTCAGCTTCAATTGGATTTTTAATTA
ACTTAGTAAACATCATTGAAAAATATTACGAGAGACCAGTTTTAACAAAT
GTTTATCACGATTACCGGACATTTGTTTTTCCTGATATTTCATTTTGTTT
GGTTAATCCGATTCATTTTCCTCCGGTTGGAACCAGACAATATAAACAAT
TAGAGCATCAATTCGCAATGTATTTTAAATTCCGAAATTCAACTCACTTG
AAAGCTAGACAAGAAGCGTTGTCGTTTATGATGTATAAAAACTATTCTTT
GGACATTGATTTATCAGATTATCTTTTCATTCAACCTGAAGTTCACTATG
GCCATCCTGCTTGGAGTGCAATATTTTTATGTGTATACATGCAATCGCCT
TGCAATTGGACTCATTTTGAAGTGCGACATGTTTGGCCATATGGAAACTG
TTTCACGTTTGTTGTGAATAATTCAAGGCGAGACGTTAAAAATATGATTA
AAAATGCTTGGCGTCCAGATTTCAAAATAATTGTCTACAAAGGTTTGACA
CCAACAACTCAGTTCAGTATGGATCCATTCAACAACCTCAACACACCCAG
TGGAGTTTTGGTAATGGTTCACGAAGCTGACACATATCCGTATCCGGATG
AAGGATTTATCGTTGATTCTTATACACAAATTGATTTGAAAATCACAACT
AAAGTCCATTTGAATGTTAATAACAAATGCGATATGCAGCGACTAAATTA
CGAGTATTACGATTTCCGAACGAAAAAATCTGCAAAATTTGCCGGCAGGC
AACCGGATTGTGTTTTTGACATGATTCAAACCCAGATTGCCAACCGATGT
AAGTGTTTGTTGCAAAATATGCCCGTGTCGAAAAAGTTTAAACATCTACC
GTTTTGTTTAGCGGTTGAAGTCAACGAAACAATTAATAATAGAGATGTTG
ACTTGAATGAATGCATTAAATCGAGTTTTTCTTTTGTCGATCAAGGTGCT
ATTAATAAAAAATGTCATCGAGATCTTTGCTCACATCCGTCATTCACTAC
TGTCGTATCTCACAGCAAGTATCCAGCAGTTAAAGAACGTCAAACCCAGT
ATTTATGGCTTGAAAAACTCGGCGAATTAGAAAAACTTCAGATGCAGCAT
TATAATATTTCGGATTTGTATTTGAAAGCATTGAAACCAAATTTGGTGAA
ACAATACAACATTTCTTCGTTGTCACAAGCAATTAAAATTCAGAACGCCA
GCAAAAACGTGAATTTTCTTGAAGAGAGCTTTGTTGATAGAAATTTCATG
CAAATAAGGGTCGTTCCATCTTCATTATTTATGGATCACATTGAAGAAAC
CCTCGAATACACCTTAAGCCGATTATTGGGCGACATTGGCGGTTGCATAG
GATTATGGATTGGCGCCAGCCTGATAACGGTATTTGAATTTGTAGATTTG
ATTTTTAGGTTTGGAGATTTATTATCATCTTATCGACATCGGCCGGTTAT
AAATCAGTGGGATGAAAAATCTAAAAATAAAACTGATTTGTCGAATAAAT
CCAATCGATGTTTGAATAAATTCAATTTCATTAGTGAAGACGAAACTGGA
GATTTGGAAGATGAAATTAATTTGACATTGCTTCAACCGATTTCTTTAAT
AAAAGGCAGTCGATCATATTTCTATAAACATATGAAATTAGAGGATATCT
AAAATATC
back to top

protein sequence of SMED30009886-orf-1

>SMED30009886-orf-1 ID=SMED30009886-orf-1|Name=SMED30009886-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=630bp
MIKSNGHKMTVNDKQHNVVTKPSVSDYLTIMCKRMMTVLIGFSRQSTIHS
LSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHD
YRTFVFPDISFCLVNPIHFPPVGTRQYKQLEHQFAMYFKFRNSTHLKARQ
EALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWT
HFEVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQ
FSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHL
NVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLL
QNMPVSKKFKHLPFCLAVEVNETINNRDVDLNECIKSSFSFVDQGAINKK
CHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQMQHYNIS
DLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRV
VPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRF
GDLLSSYRHRPVINQWDEKSKNKTDLSNKSNRCLNKFNFISEDETGDLED
EINLTLLQPISLIKGSRSYFYKHMKLEDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 339..356
score: 25.33
coord: 402..422
score: 22.86
coord: 102..118
score: 32.71
coord: 264..282
score: 32.84
coord: 187..198
score: 30.33
coord: 201..217
score: 38.59
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 42..546
e-value: 2.0E-57
score: 195.2
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 44..560
NoneNo IPR availableTMHMMTMhelixcoord: 65..84