fas-binding factor 1 homolog

Overview
Namefas-binding factor 1 homolog
Smed IDSMED30009869
Length (bp)3125
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fas-binding factor 1 homolog (SMED30009869) t-SNE clustered cells

Violin plots show distribution of expression levels for fas-binding factor 1 homolog (SMED30009869) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fas-binding factor 1 homolog (SMED30009869) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fas-binding factor 1 homolog (SMED30009869) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009869

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009869SMESG000037546.1 SmedASXL_016870SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009869SMESG000037546.1 dd_Smed_v4_12422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009869SMESG000037546.1 dd_Smed_v4_12422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009869SMESG000037546.1 dd_Smed_v4_12735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009869SMESG000037546.1 dd_Smed_v4_12735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009869SMESG000037546.1 dd_Smed_v6_12422_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30009869SMESG000037546.1 dd_Smed_v6_12735_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30009869SMESG000037546.1 Contig46576newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009869SMESG000037546.1 Contig46576uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30009869SMESG000037546.1 dd_Smed_v4_12422_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009869SMESG000037546.1 dd_Smed_v4_12735_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fas-binding factor 1 homolog vs. Ensembl Human
Match: FBF1 (Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:24674])

HSP 1 Score: 97.8265 bits (242), Expect = 6.121e-20
Identity = 120/451 (26.61%), Postives = 245/451 (54.32%), Query Frame = 3
Query: 1278 AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            AE + +++KLE ER      L  + Q++  +LE+ E  +++RI++LE + + +E+RL  E + LS +   + Q  EQ R E+ ++  RR   I  +K QE+ R+RE  +  +  +R  +E+ +++LK  K  E      A   T  L S++ Q+   +  L  +  ++        +E++  ++ ++E L+ L+E+L +Q+ +  +ER   Q +I K+E +L EQ+R  ++ERW +  EQ+K  ++Q +LE++R +        RA LE  +  +L+EQK ++    EE+R +A E A+ + +     E ++  + +  Q   + EG   +L++E+ EL+   S+L  E ++  ++ +  +    E+R++ E+ N     + +R + +     +  E    GE +L++A+++ +E Q  +  +Q+Q   L ++EQ ++++ + L + R+ L
Sbjct:  604 AELEAQVRKLELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLSQCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLKDREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQLRALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKERAEREAERALQVDTQREGTLISLAKEQAELKIRASELRAEEKQLAAERAALEQERQELRLEKERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLRKQEQHMHQEHLSLAQQRLQL 1054          
BLAST of fas-binding factor 1 homolog vs. Ensembl Human
Match: FBF1 (Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:24674])

HSP 1 Score: 97.8265 bits (242), Expect = 6.176e-20
Identity = 120/451 (26.61%), Postives = 245/451 (54.32%), Query Frame = 3
Query: 1278 AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            AE + +++KLE ER      L  + Q++  +LE+ E  +++RI++LE + + +E+RL  E + LS +   + Q  EQ R E+ ++  RR   I  +K QE+ R+RE  +  +  +R  +E+ +++LK  K  E      A   T  L S++ Q+   +  L  +  ++        +E++  ++ ++E L+ L+E+L +Q+ +  +ER   Q +I K+E +L EQ+R  ++ERW +  EQ+K  ++Q +LE++R +        RA LE  +  +L+EQK ++    EE+R +A E A+ + +     E ++  + +  Q   + EG   +L++E+ EL+   S+L  E ++  ++ +  +    E+R++ E+ N     + +R + +     +  E    GE +L++A+++ +E Q  +  +Q+Q   L ++EQ ++++ + L + R+ L
Sbjct:  605 AELEAQVRKLELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLSQCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLKDREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQLRALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKERAEREAERALQVDTQREGTLISLAKEQAELKIRASELRAEEKQLAAERAALEQERQELRLEKERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLRKQEQHMHQEHLSLAQQRLQL 1055          
BLAST of fas-binding factor 1 homolog vs. Ensembl Human
Match: FBF1 (Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:24674])

HSP 1 Score: 97.4413 bits (241), Expect = 8.010e-20
Identity = 120/451 (26.61%), Postives = 245/451 (54.32%), Query Frame = 3
Query: 1278 AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            AE + +++KLE ER      L  + Q++  +LE+ E  +++RI++LE + + +E+RL  E + LS +   + Q  EQ R E+ ++  RR   I  +K QE+ R+RE  +  +  +R  +E+ +++LK  K  E      A   T  L S++ Q+   +  L  +  ++        +E++  ++ ++E L+ L+E+L +Q+ +  +ER   Q +I K+E +L EQ+R  ++ERW +  EQ+K  ++Q +LE++R +        RA LE  +  +L+EQK ++    EE+R +A E A+ + +     E ++  + +  Q   + EG   +L++E+ EL+   S+L  E ++  ++ +  +    E+R++ E+ N     + +R + +     +  E    GE +L++A+++ +E Q  +  +Q+Q   L ++EQ ++++ + L + R+ L
Sbjct:  549 AELEAQVRKLELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLSQCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLKDREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQLRALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKERAEREAERALQVDTQREGTLISLAKEQAELKIRASELRAEEKQLAAERAALEQERQELRLEKERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLRKQEQHMHQEHLSLAQQRLQL 999          
BLAST of fas-binding factor 1 homolog vs. Ensembl Human
Match: FBF1 (Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:24674])

HSP 1 Score: 95.9005 bits (237), Expect = 2.355e-19
Identity = 119/452 (26.33%), Postives = 242/452 (53.54%), Query Frame = 3
Query: 1278 AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIR-SQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            AE + +++KLE ER      L  + Q++  +LE+ E  +++RI++LE + + +E+RL  E + LS +   + Q  EQ R E+ ++  RR   I  +K QE+ R+RE  +  +  +R  +E+ +++LK  K  E      A   T  L S++ Q+   +  L  +  ++        +E++  ++ ++E L+ L+E+L +Q+ +  +ER   Q +I K+E +L EQ+R  ++ERW +  EQ+K  ++Q +LE++R +        RA LE  +  +L+EQK ++    EE+R +A E A+ + +     E ++  + +  Q   + EG    +S  ++    IR S+L  E ++  ++ +  +    E+R++ E+ N     + +R + +     +  E    GE +L++A+++ +E Q  +  +Q+Q   L ++EQ ++++ + L + R+ L
Sbjct:  591 AELEAQVRKLELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLSQCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLKDREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQLRALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKERAEREAERALQVDTQREGT--LISLAKQAELKIRASELRAEEKQLAAERAALEQERQELRLEKERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLRKQEQHMHQEHLSLAQQRLQL 1040          
BLAST of fas-binding factor 1 homolog vs. Ensembl Human
Match: FBF1 (Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:24674])

HSP 1 Score: 46.9802 bits (110), Expect = 6.279e-6
Identity = 28/80 (35.00%), Postives = 48/80 (60.00%), Query Frame = 3
Query: 1941 LTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLT 2180
            L EQ+R  ++ERW +  EQ+K  ++Q +LE++R +        RA LE  +  +L+EQK ++    EE+R +A E A+ +
Sbjct:    1 LNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFS 80          
BLAST of fas-binding factor 1 homolog vs. Ensembl Fly
Match: CG5964 (gene:FBgn0036206 transcript:FBtr0076085)

HSP 1 Score: 59.3066 bits (142), Expect = 1.747e-8
Identity = 130/510 (25.49%), Postives = 236/510 (46.27%), Query Frame = 3
Query: 1185 LERPKTSHHRNENSQMKSEGSYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEES----------TLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQIS-SVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKME--KANNLEKE--LTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCS 2669
            +E+P+    R E+ +  S+    + +L  D+     K   LE +R D L  +  M     +E+EM +  YK +I++LEE++   EKRL +E   L Q   +KL+              +++D +E     +IS +R+ H+ E+ KLR  +E  +E ++QAK  E S          TLR+A        S L ++ +G  D          +  RQ++ ++ +L DQ   L++ +E  D        E+  L  L+S LE+QL   ++ + EE W LRQ         +SLE ER     +K+ +R  ++   K++ D +   L  +     ++ EER +LT E  +     Q++     +++  ELE                 +QL   R E + +A +     ++++ +ME  K + L+KE  L +++  + +    Y+    R   + Q+A+E     Q ++  + K+   + EKE Q+  + M + + RM L N +K I  ++C+
Sbjct:  381 VEKPEPEPERKEHHKATSQEQEHLLLLEMDA-----KRNLLEKQRLDEL--VANMKVNYEQEIEMIDSSYKKQIKVLEEHLSVVEKRLKDENSELRQYYIEKLE-------------KQKEDYVE-----QISSLRQDHEDEVRKLRQSHELDLEGIRQAKMVELSAVQDHGNYLDTLRLAS-------SNLQELRDGMSD--------NQERERQLEARERRLADQERRLKMDEETADD-------EKRRLMELVSTLELQLGRLSKESAEENWQLRQR-------MSSLEAERKAFEREKEFHREQMQRDEKRVEDLKALQLAEMERLHHDLQEERNQLTVERQQIELRQQLNEHGDPDRDRRELE-----------------AQLQVAR-EAIRRADEERDRYHKLQREMEQRKRHLLDKEHALNLKEDELGQATGAYRLATSRQHLAEQKAREADQLLQAKLKVMAKRAQEIAEKEAQLAHERMLVAQDRMALVNLKKQISRSRCA 818          
BLAST of fas-binding factor 1 homolog vs. Ensembl Xenopus
Match: kmt2c (lysine methyltransferase 2C [Source:Xenbase;Acc:XB-GENE-485111])

HSP 1 Score: 114.005 bits (284), Expect = 3.813e-25
Identity = 114/466 (24.46%), Postives = 238/466 (51.07%), Query Frame = 3
Query: 1269 NDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQ-------VSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNI----------RSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKA--ITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMEL 2609
            N   + + +++KL+ ERD     L  + +R+ E++E+ E  +++R++++E++ + +E+RL  E   LS Q   + Q  E E+ E+ ++  ++  E + +K  E+ RIRE  +  + ++   +E+ +++LK+ K  E   +  A   T  L +V+ Q       +S+ +  + S +Q    +     ++++ QL+   E L   ++ ++       +ER +L+ +I+ +E +L EQ+R  ++ERW +  EQ K+ +LQ SLE++R ++       R  LE  +  +L+EQ+ ++    EE+R +A E          WS+      + K +   E   +  A ++    + N+           S+L N+ E+        +    ++R++ E+ N     L +RQ+A  I     L  +    GE++L++A ++ SEHQ  +  IQ++L +L ++E+ I+++ + L
Sbjct:  261 NRVMDLEAQVRKLQLERDQQNLLLETLRERHQEDMELIENAHRSRLKLVEDSARQREERLRLENQELSAQYLSRCQSTETEKAELLAQYQKKLTEFQQEKELELERIRELQRVFVQEMCRDHEEQLQRLKRLKDQEIDAVTSASSHTRSLNTVIEQMESFSHKLSDLSHRVESTQQTTSHELETGARQREGQLRALQEQLSRQQKDME-------QERNSLRMVITNMETRLIEQSRLLEQERWRVTSEQAKVESLQRSLEEQRRVVTQQMAIEREELERAKSALLEEQQSVMSRCTEERRKLAAE----------WSDFHTQQKLSKERAEKEANRVIVAETQREGAIINLAKEQAELKIKASELLNKEEQLFLAREAMEKERQDLRLEKERVNA--SALRVRQRAEEIESMSKLASQRYEEGEKALEEACKIESEHQGRLRAIQQKLEILRQQEEHIHQERLSL 707          
BLAST of fas-binding factor 1 homolog vs. Ensembl Xenopus
Match: kmt2c (lysine methyltransferase 2C [Source:Xenbase;Acc:XB-GENE-485111])

HSP 1 Score: 111.694 bits (278), Expect = 2.241e-24
Identity = 114/466 (24.46%), Postives = 237/466 (50.86%), Query Frame = 3
Query: 1269 NDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLV-------SIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNI----------RSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKA--ITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMEL 2609
            N   + + +++KL+ ERD     L  + +R+ E++E+ E  +++R++++E++ + +E+RL  E   LS Q   + Q  E E+ E+ ++  ++  E + +K  E+ RIRE  +  + ++   +E+ +++LK+ K  E   +  A   T  L +V+ Q+ + +  L        S +Q    +     ++++ QL+   E L   ++ ++       +ER +L+ +I+ +E +L EQ+R  ++ERW +  EQ K+ +LQ SLE++R ++       R  LE  +  +L+EQ+ ++    EE+R +A E          WS+      + K +   E   +  A ++    + N+           S+L N+ E+        +    ++R++ E+ N     L +RQ+A  I     L  +    GE++L++A ++ SEHQ  +  IQ++L +L ++E+ I+++ + L
Sbjct:  314 NRVMDLEAQVRKLQLERDQQNLLLETLRERHQEDMELIENAHRSRLKLVEDSARQREERLRLENQELSAQYLSRCQSTETEKAELLAQYQKKLTEFQQEKELELERIRELQRVFVQEMCRDHEEQLQRLKRLKDQEIDAVTSASSHTRSLNTVIEQMESFSHKLSDLSHRVESTQQTTSHELETGARQREGQLRALQEQLSRQQKDME-------QERNSLRMVITNMETRLIEQSRLLEQERWRVTSEQAKVESLQRSLEEQRRVVTQQMAIEREELERAKSALLEEQQSVMSRCTEERRKLAAE----------WSDFHTQQKLSKERAEKEANRVIVAETQREGAIINLAKEQAELKIKASELLNKEEQLFLAREAMEKERQDLRLEKERVNA--SALRVRQRAEEIESMSKLASQRYEEGEKALEEACKIESEHQGRLRAIQQKLEILRQQEEHIHQERLSL 760          
BLAST of fas-binding factor 1 homolog vs. Ensembl Xenopus
Match: kmt2c (lysine methyltransferase 2C [Source:Xenbase;Acc:XB-GENE-485111])

HSP 1 Score: 110.923 bits (276), Expect = 3.926e-24
Identity = 114/466 (24.46%), Postives = 237/466 (50.86%), Query Frame = 3
Query: 1269 NDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLV-------SIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNI----------RSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKA--ITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMEL 2609
            N   + + +++KL+ ERD     L  + +R+ E++E+ E  +++R++++E++ + +E+RL  E   LS Q   + Q  E E+ E+ ++  ++  E + +K  E+ RIRE  +  + ++   +E+ +++LK+ K  E   +  A   T  L +V+ Q+ + +  L        S +Q    +     ++++ QL+   E L   ++ ++       +ER +L+ +I+ +E +L EQ+R  ++ERW +  EQ K+ +LQ SLE++R ++       R  LE  +  +L+EQ+ ++    EE+R +A E          WS+      + K +   E   +  A ++    + N+           S+L N+ E+        +    ++R++ E+ N     L +RQ+A  I     L  +    GE++L++A ++ SEHQ  +  IQ++L +L ++E+ I+++ + L
Sbjct:  270 NRVMDLEAQVRKLQLERDQQNLLLETLRERHQEDMELIENAHRSRLKLVEDSARQREERLRLENQELSAQYLSRCQSTETEKAELLAQYQKKLTEFQQEKELELERIRELQRVFVQEMCRDHEEQLQRLKRLKDQEIDAVTSASSHTRSLNTVIEQMESFSHKLSDLSHRVESTQQTTSHELETGARQREGQLRALQEQLSRQQKDME-------QERNSLRMVITNMETRLIEQSRLLEQERWRVTSEQAKVESLQRSLEEQRRVVTQQMAIEREELERAKSALLEEQQSVMSRCTEERRKLAAE----------WSDFHTQQKLSKERAEKEANRVIVAETQREGAIINLAKEQAELKIKASELLNKEEQLFLAREAMEKERQDLRLEKERVNA--SALRVRQRAEEIESMSKLASQRYEEGEKALEEACKIESEHQGRLRAIQQKLEILRQQEEHIHQERLSL 716          
BLAST of fas-binding factor 1 homolog vs. Ensembl Xenopus
Match: kmt2c (lysine methyltransferase 2C [Source:Xenbase;Acc:XB-GENE-485111])

HSP 1 Score: 110.538 bits (275), Expect = 5.479e-24
Identity = 114/466 (24.46%), Postives = 237/466 (50.86%), Query Frame = 3
Query: 1269 NDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLV-------SIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNI----------RSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKA--ITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMEL 2609
            N   + + +++KL+ ERD     L  + +R+ E++E+ E  +++R++++E++ + +E+RL  E   LS Q   + Q  E E+ E+ ++  ++  E + +K  E+ RIRE  +  + ++   +E+ +++LK+ K  E   +  A   T  L +V+ Q+ + +  L        S +Q    +     ++++ QL+   E L   ++ ++       +ER +L+ +I+ +E +L EQ+R  ++ERW +  EQ K+ +LQ SLE++R ++       R  LE  +  +L+EQ+ ++    EE+R +A E          WS+      + K +   E   +  A ++    + N+           S+L N+ E+        +    ++R++ E+ N     L +RQ+A  I     L  +    GE++L++A ++ SEHQ  +  IQ++L +L ++E+ I+++ + L
Sbjct:  273 NRVMDLEAQVRKLQLERDQQNLLLETLRERHQEDMELIENAHRSRLKLVEDSARQREERLRLENQELSAQYLSRCQSTETEKAELLAQYQKKLTEFQQEKELELERIRELQRVFVQEMCRDHEEQLQRLKRLKDQEIDAVTSASSHTRSLNTVIEQMESFSHKLSDLSHRVESTQQTTSHELETGARQREGQLRALQEQLSRQQKDME-------QERNSLRMVITNMETRLIEQSRLLEQERWRVTSEQAKVESLQRSLEEQRRVVTQQMAIEREELERAKSALLEEQQSVMSRCTEERRKLAAE----------WSDFHTQQKLSKERAEKEANRVIVAETQREGAIINLAKEQAELKIKASELLNKEEQLFLAREAMEKERQDLRLEKERVNA--SALRVRQRAEEIESMSKLASQRYEEGEKALEEACKIESEHQGRLRAIQQKLEILRQQEEHIHQERLSL 719          
BLAST of fas-binding factor 1 homolog vs. Ensembl Mouse
Match: Fbf1 (Fas (TNFRSF6) binding factor 1 [Source:MGI Symbol;Acc:MGI:1922033])

HSP 1 Score: 119.013 bits (297), Expect = 1.345e-26
Identity = 122/472 (25.85%), Postives = 260/472 (55.08%), Query Frame = 3
Query: 1254 VDILSNDS--AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEM----AELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHL-------YQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            V++L + +  +E + +++KLE ER      L  + QR+  +LE+ E  +++RI++LE + + +E++L  E ++LS Q+    +  EQ R E+ ++  R+    E ++ QE++R+RE  +  + ++R  +E  +++LK  K  E   +  A   T  L  ++ Q+   +  L ++  ++        ++++  ++ Q+E L+ L+E+L +Q+ +  +ER  LQ +I K+E++L+EQ+R  ++ERW +  E+ K  + Q +LE++R I++      R  LE  +  +L+EQK ++    EE+R +A E A    E F   + S+  + ++ +      ++ EG   +L++E+ EL     +L  + E+ L++    +    E+R++ ++ +     L  R + +   EH+       Y+E    GE++LQ+A+++ +E Q  +  +Q+Q   L ++EQ+++++ + L + R+ L
Sbjct:  622 VELLQSQTKLSELEAQVRKLELERAQHRMLLESLQQRHQADLELIEDAHRSRIKVLETSYQQREEQLRREKEVLSAQHASYCREAEQARAELVAQHQRQMAMAEQERDQEVARLRELQQASILEMRKDHEHQLQRLKMLKDQEIDAVTSATSHTRSLNGIIEQMEKFSSSLNTLSSRVEASHLTTSQQRELGIRQQDEQLRALQERLGRQQRDMEEERNRLQEVIGKMEVRLSEQSRLLEQERWRVAAEKTKAESAQRTLEEQRKIMVQQIAMEREELERAKSALLEEQKSVMNKCGEERRRLAAEWA----EYFTQQKLSKERAEREAERAMHADSQREGTIISLTKEQAELTVRACELRAKEEKLLAEREALERERQELRLEKDRLHKASLRLQARAQEV---EHMSKVASKKYEE----GEQALQEAQQMQNEQQGRLQVVQRQQEWLRQQEQRVHQEHLSLAQQRLQL 1082          
BLAST of fas-binding factor 1 homolog vs. Ensembl Mouse
Match: Fbf1 (Fas (TNFRSF6) binding factor 1 [Source:MGI Symbol;Acc:MGI:1922033])

HSP 1 Score: 119.013 bits (297), Expect = 1.345e-26
Identity = 122/472 (25.85%), Postives = 260/472 (55.08%), Query Frame = 3
Query: 1254 VDILSNDS--AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEM----AELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHL-------YQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            V++L + +  +E + +++KLE ER      L  + QR+  +LE+ E  +++RI++LE + + +E++L  E ++LS Q+    +  EQ R E+ ++  R+    E ++ QE++R+RE  +  + ++R  +E  +++LK  K  E   +  A   T  L  ++ Q+   +  L ++  ++        ++++  ++ Q+E L+ L+E+L +Q+ +  +ER  LQ +I K+E++L+EQ+R  ++ERW +  E+ K  + Q +LE++R I++      R  LE  +  +L+EQK ++    EE+R +A E A    E F   + S+  + ++ +      ++ EG   +L++E+ EL     +L  + E+ L++    +    E+R++ ++ +     L  R + +   EH+       Y+E    GE++LQ+A+++ +E Q  +  +Q+Q   L ++EQ+++++ + L + R+ L
Sbjct:  622 VELLQSQTKLSELEAQVRKLELERAQHRMLLESLQQRHQADLELIEDAHRSRIKVLETSYQQREEQLRREKEVLSAQHASYCREAEQARAELVAQHQRQMAMAEQERDQEVARLRELQQASILEMRKDHEHQLQRLKMLKDQEIDAVTSATSHTRSLNGIIEQMEKFSSSLNTLSSRVEASHLTTSQQRELGIRQQDEQLRALQERLGRQQRDMEEERNRLQEVIGKMEVRLSEQSRLLEQERWRVAAEKTKAESAQRTLEEQRKIMVQQIAMEREELERAKSALLEEQKSVMNKCGEERRRLAAEWA----EYFTQQKLSKERAEREAERAMHADSQREGTIISLTKEQAELTVRACELRAKEEKLLAEREALERERQELRLEKDRLHKASLRLQARAQEV---EHMSKVASKKYEE----GEQALQEAQQMQNEQQGRLQVVQRQQEWLRQQEQRVHQEHLSLAQQRLQL 1082          
BLAST of fas-binding factor 1 homolog vs. UniProt/SwissProt
Match: sp|A2A870|FBF1_MOUSE (Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.405e-26
Identity = 122/472 (25.85%), Postives = 260/472 (55.08%), Query Frame = 3
Query: 1254 VDILSNDS--AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEM----AELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHL-------YQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            V++L + +  +E + +++KLE ER      L  + QR+  +LE+ E  +++RI++LE + + +E++L  E ++LS Q+    +  EQ R E+ ++  R+    E ++ QE++R+RE  +  + ++R  +E  +++LK  K  E   +  A   T  L  ++ Q+   +  L ++  ++        ++++  ++ Q+E L+ L+E+L +Q+ +  +ER  LQ +I K+E++L+EQ+R  ++ERW +  E+ K  + Q +LE++R I++      R  LE  +  +L+EQK ++    EE+R +A E A    E F   + S+  + ++ +      ++ EG   +L++E+ EL     +L  + E+ L++    +    E+R++ ++ +     L  R + +   EH+       Y+E    GE++LQ+A+++ +E Q  +  +Q+Q   L ++EQ+++++ + L + R+ L
Sbjct:  622 VELLQSQTKLSELEAQVRKLELERAQHRMLLESLQQRHQADLELIEDAHRSRIKVLETSYQQREEQLRREKEVLSAQHASYCREAEQARAELVAQHQRQMAMAEQERDQEVARLRELQQASILEMRKDHEHQLQRLKMLKDQEIDAVTSATSHTRSLNGIIEQMEKFSSSLNTLSSRVEASHLTTSQQRELGIRQQDEQLRALQERLGRQQRDMEEERNRLQEVIGKMEVRLSEQSRLLEQERWRVAAEKTKAESAQRTLEEQRKIMVQQIAMEREELERAKSALLEEQKSVMNKCGEERRRLAAEWA----EYFTQQKLSKERAEREAERAMHADSQREGTIISLTKEQAELTVRACELRAKEEKLLAEREALERERQELRLEKDRLHKASLRLQARAQEV---EHMSKVASKKYEE----GEQALQEAQQMQNEQQGRLQVVQRQQEWLRQQEQRVHQEHLSLAQQRLQL 1082          
BLAST of fas-binding factor 1 homolog vs. UniProt/SwissProt
Match: sp|Q5ZIB2|FBF1_CHICK (Fas-binding factor 1 homolog OS=Gallus gallus OX=9031 GN=FBF1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.536e-22
Identity = 130/480 (27.08%), Postives = 246/480 (51.25%), Query Frame = 3
Query: 1278 AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERA------KLTREMFK--WSETSQISSVKKN------QEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKAS-KFDSMNYEIRMKMEKANNLEKELTIRQK--AITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKC 2666
            AE + +++ LE ER      L  + QR+ E+L++ E  +++R++++EE    +E+RL  E + L  Q   + Q  E+ R ++ ++  +R   +E Q  QE+ R+RE  +  + ++   +E+ +++LK+ K  E   +  A   T  L  V+ Q+   + DL S+  ++    +   +E     + ++E L++L+++L +Q+ +  +ER  LQ +I+K+E +L+EQTR  ++ERW +   Q+K+ +LQ SLE++R ++       RA LE  +  +L+EQK +++   EE+R +A E A      +L++E  +       Q+ S ++       +E AEL                +RS+    +EE L++     D   +E+R++ EK       L IRQ+   I     L  +    GE +LQ A  + SEHQ  +  +Q+ L  L ++EQ + ++ + +   R  L+   K +  N  
Sbjct:  587 AELESQVRMLELERTQHKLLLESLQQRHQEDLDLLESAHRSRVKVVEETYGQREERLRREKEQLEAQLLSQSQDAERARADLVAQHKQRVATLEQQSAQELERLRELQRSSVQEMLKDHEEQLQRLKRLKDQEIDAVTSATSHTRSLNGVIEQMERFSSDLHSLSHKVEATHHTTSQELAMGARQRDEQLKVLQDRLSQQQRDMEEERSRLQEVIAKMEARLSEQTRLLEQERWRVTAVQSKVESLQRSLEEQRRLMTQQLSMERAELERAKSALLEEQKSVMQKCSEERRKLAVEWAEFHTQQQLSKERMERDIDRALQLDSQREGTIMSLAKEQAEL---------------KVRSRELKVKEEQLARDRLLLDEAWHELRLEKEKVKG--ATLRIRQQEEEIKNMSKLSAQKYEEGERALQDACRIESEHQARLQVMQQHLEQLKQQEQHLQQERLSMAHQRRQLEQLHKKLPNNPT 1049          
BLAST of fas-binding factor 1 homolog vs. UniProt/SwissProt
Match: sp|Q8TES7|FBF1_HUMAN (Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.131e-18
Identity = 119/452 (26.33%), Postives = 242/452 (53.54%), Query Frame = 3
Query: 1278 AEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIR-SQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNL 2630
            AE + +++KLE ER      L  + Q++  +LE+ E  +++RI++LE + + +E+RL  E + LS +   + Q  EQ R E+ ++  RR   I  +K QE+ R+RE  +  +  +R  +E+ +++LK  K  E      A   T  L S++ Q+   +  L  +  ++        +E++  ++ ++E L+ L+E+L +Q+ +  +ER   Q +I K+E +L EQ+R  ++ERW +  EQ+K  ++Q +LE++R +        RA LE  +  +L+EQK ++    EE+R +A E A+ + +     E ++  + +  Q   + EG    +S  ++    IR S+L  E ++  ++ +  +    E+R++ E+ N     + +R + +     +  E    GE +L++A+++ +E Q  +  +Q+Q   L ++EQ ++++ + L + R+ L
Sbjct:  591 AELEAQVRKLELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLSQCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLKDREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQLRALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKERAEREAERALQVDTQREGT--LISLAKQAELKIRASELRAEEKQLAAERAALEQERQELRLEKERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLRKQEQHMHQEHLSLAQQRLQL 1040          
BLAST of fas-binding factor 1 homolog vs. TrEMBL
Match: A0A1S3HVC4 (fas-binding factor 1 homolog OS=Lingula unguis OX=7574 GN=LOC106158511 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.288e-44
Identity = 158/547 (28.88%), Postives = 288/547 (52.65%), Query Frame = 3
Query: 1365 EELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSAL-----------IATQMEEERLMHSIKMAADDDREYLSQERAYLDSLISGSQQSWKTHVK 2972
            EE++  E ++K R++++EE+ + +E RL E+VDL + QN  K++ +E ER ++ S   R+  E+E  + +E+ R++EQH+  +  ++  +E+ +++LK     E   +  A      LQSV+ ++ +  + L  ++  +       I ++D     ++E+L+LL+E+L KQ+ +  KERE LQ L++K+EIQL EQ R  +EE+W ++QEQNKLS LQ S+E+ER +I     + R+ L+  +  +L EQK +   +Y+E+R ++EERA+            Q  +V+  Q  A+LEG    LS ER  L+ +  +L  E++   ++    D     ++M+ EK + L   + +R + + E      +++  G+  L +A+++ +E  N++  IQ Q+  L EKE+QI ++ + L K +  L +   + +C  C   +   +  GS       P  G        +LN+  ++A       SL  S             I++ + ++R     KM A+ D E+L  E  +L++L      +  T VK
Sbjct:  943 EEMKTIESIHKGRVQMIEESYQRREARLKEDVDLAAAQNALKIKQMEMERADLMSSQQRKLQELERDRTEELQRLKEQHRSAITDIQKEHEEAIQRLKAINQQEVEAVSTATSHNRSLQSVVDRIQSNTRSLSDLQHVVETHHFANINDRDIAATARDEHLKLLQERLIKQQGDMDKERERLQQLVAKMEIQLREQGRQLEEEKWKVKQEQNKLSVLQISVEEERRMITDQLTRERSELQSSKDALLKEQKTIYSQLYDERRALSEERAQFNMLQSTLLNREQRDTVRNVQAEADLEGTMKTLSNERMRLQTMSEELQKEQQRINTEKLALDQQKAALQMEKEKLDELATHMKLRSQEVEEISLEASKVREEGDRMLAEARKVQAEQSNKLQNIQIQISALREKERQIAQERLGLAKEKKELGHLRNSFICINCRTPVKDATQHGS-------PILGA-------ALNIPGSSANANGAAISLQGSGTGEPFTSPVLNSISSSLAKDRTFRMWKMNAEKDHEFLEDESLFLEALKHSPYHTPPTAVK 1475          
BLAST of fas-binding factor 1 homolog vs. TrEMBL
Match: A0A2C9LKY0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057922 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 8.274e-43
Identity = 169/566 (29.86%), Postives = 308/566 (54.42%), Query Frame = 3
Query: 1263 LSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQ-IKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPFYGFTKKPTDP--SLNVRLATAFDQEIIDSLDYSAL------IATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            L +   E   K++KLE ER      L+ + +R  EE+   E  YKNR++ILEE+ + KE RL EE + L QQ+  K++ LEQE+ +  +   R+ +++E +K QE+ +++EQ++  L  L+  +E+ +++L  AK+ E + +  A  T+  L  V+ Q+SN A+DL  + Q+ ++ +N+Q + E++  L+ ++E LQ+L+E+L +Q+++N +ER+ L+ LI ++E QL EQTR  +EERW L+Q+Q++   +Q SL++ER + L  + + R SLE  R  +L+EQ      I +E+R +AEERAK   E     E     ++K+ Q  AE E +  A++EE+ +  +   +L  E E   S+ +K +    +I  + E      +++  + + I       +  +  GE+++++A  + S+ +   + I+K+L  +   E+ I ++ + L + +  + N  K+ LC  C                 R+P  G    P  P    +  LA    Q +I S  +  +      IA  +  +R +  +K+ A  D+E+L +E  YL++L
Sbjct:  836 LPDSLPEAHAKIRKLELERTYTESLLDSLKRRYEEEMFTVESSYKNRLQILEESNRKKEIRLREENEELMQQHLNKVRQLEQEKSDQSTAHYRKLEDMEREKAQELEKLKEQNRLTLASLKRDHEEALDRLVSAKNQEINKIANANDTSRSLTVVVEQISNNAKDLNDL-QRKVEAWNKQGLDEREITLRSKDEQLQMLQERLKRQEEDNERERKRLEELIVRMESQLREQTRLMEEERWKLKQDQSRAEAVQRSLDEERRLWLEQQTRERMSLERARDNLLEEQHSCASQITDERRLLAEERAKFQIEQKTVREKLHQDTIKRTQAEAEYEVLMKAIAEEKVQQASRLKELQREEERINSERNKLERERAQIDQEREMLAKQARQIREQSEEIDRVTEAARRAQNEGEQAMEEAFHVSSQIERRETDIEKKLSAIKLMEEHITEEKLRLAREKKEMDNLRKSHLCVNC-----------------RSPQNGLATLPLLPQNGYHTPLAVTAPQFMIPSPGHQMVTNPLEQIAASIASDRAVRMLKIQAIKDKEFLEEENFYLETL 1383          
BLAST of fas-binding factor 1 homolog vs. TrEMBL
Match: A0A2C9LL54 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057922 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 7.217e-39
Identity = 166/566 (29.33%), Postives = 303/566 (53.53%), Query Frame = 3
Query: 1263 LSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQ-IKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPFYGFTKKPTDP--SLNVRLATAFDQEIIDSLDYSAL------IATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            L +   E   K++KLE ER      L+ + +R  EE+   E  YKNR++ILEE+ + KE RL EE + L QQ+  K++ LEQE+ +  +   R+ +++E +K QE+ +++EQ++  L  L+  +E+ +++L  AK+ E + +  A  T+  L  V+ Q+SN A+DL  + Q+ ++ +N+Q + E++  L+ ++E LQ+L+E+L +Q+++N +ER+ L+ LI ++E QL EQTR  +EERW L+Q+Q++   +Q SL++ER + L  + + R SLE  R             I +E+R +AEERAK   E     E     ++K+ Q  AE E +  A++EE+ +  +   +L  E E   S+ +K +    +I  + E      +++  + + I       +  +  GE+++++A  + S+ +   + I+K+L  +   E+ I ++ + L + +  + N  K+ LC  C                 R+P  G    P  P    +  LA    Q +I S  +  +      IA  +  +R +  +K+ A  D+E+L +E  YL++L
Sbjct:  836 LPDSLPEAHAKIRKLELERTYTESLLDSLKRRYEEEMFTVESSYKNRLQILEESNRKKEIRLREENEELMQQHLNKVRQLEQEKSDQSTAHYRKLEDMEREKAQELEKLKEQNRLTLASLKRDHEEALDRLVSAKNQEINKIANANDTSRSLTVVVEQISNNAKDLNDL-QRKVEAWNKQGLDEREITLRSKDEQLQMLQERLKRQEEDNERERKRLEELIVRMESQLREQTRLMEEERWKLKQDQSRAEAVQRSLDEERRLWLEQQTRERMSLERAR-------------ITDERRLLAEERAKFQIEQKTVREKLHQDTIKRTQAEAEYEVLMKAIAEEKVQQASRLKELQREEERINSERNKLERERAQIDQEREMLAKQARQIREQSEEIDRVTEAARRAQNEGEQAMEEAFHVSSQIERRETDIEKKLSAIKLMEEHITEEKLRLAREKKEMDNLRKSHLCVNC-----------------RSPQNGLATLPLLPQNGYHTPLAVTAPQFMIPSPGHQMVTNPLEQIAASIASDRAVRMLKIQAIKDKEFLEEENFYLETL 1370          
BLAST of fas-binding factor 1 homolog vs. TrEMBL
Match: K1RBN1 (Fas-binding factor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10021163 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 8.899e-39
Identity = 171/567 (30.16%), Postives = 303/567 (53.44%), Query Frame = 3
Query: 1281 EFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIR-MKMEKANNLEKELTIRQKAITEKE------HLYQEIKIRGEE---SLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSH---NNLNRAPFYGFTKKPTDPSLNVRLA---TAFDQEIIDSLDYSALIATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            E Q ++ K+E ERD   Y +          LEMN++ +    + +E + K     L EE +LL  Q   K++ LE ++ +  S+  RR +E +  K Q+I R++  H+  ++ ++  YE+ +E+LK+AK  +      +  TT  L   ++ + + A+DL  +++++    N  + E++  ++ ++E L++L+E+L++Q++EN  ER+ L+ LIS+LE QL EQTR  DEERW ++QEQ +L +LQ+SLE+ER +    + + R+++E+ R+ +L+EQK +L  +++E++++AEER KL   +    E S+ ++VK  Q  AE E +  A+SEE+ +   IR +L  +REE        D ++ E R ++M++A   EKE    Q A T KE       ++ E + + EE   +L +A ++  E     + +Q Q+ VL  KE++I    + L K +  ++N +  +LC  C         GG        N A  Y     P     N  +     A  Q    SL+    I   ++ +R +   KM A  D++YL ++  +L +L
Sbjct:  775 EAQTRLYKMEIERD-YAYSV----------LEMNKRRFDEEKQTIENSYK-----LREENELLMNQYLSKVRQLENDKSDQSSQYQRRLEEFQRDKDQDIDRLKSIHRRAIEDMKREYEEDLERLKKAKDQQIEAAMTSNDTTKSLVQAVSMIQSNARDLGELQKKVDSWHNMGLDEREIAIRSKDEQLKILQERLNRQQEENDLERKRLEDLISRLETQLREQTRMLDEERWKVKQEQTRLQSLQSSLEEERRLWTEQQARERSNIEKTRETLLEEQKSVLSQLHKERQSVAEERTKLNVSLTVQREESEDAAVKLAQAKAEFEALMKAISEEKSKQNIIRQEL--QREE--------DRLDSERRKLEMQQAKMAEKEKDFLQAAQTLKERSEEMDQVFIESQSKAEEGNTALMEAMKIEREESERAANLQHQIQVLRLKEREIADDRLRLSKEKKEVENLKSAMLCPNCRTPAGAKPQGGEQVIAGQYNNASTYQVYSSPAVQQSNPAMQHNNPAMQQ----SLNSVGSITETIKADRSIRMWKMEALKDQKYLEEQSMFLYTL 1311          
BLAST of fas-binding factor 1 homolog vs. TrEMBL
Match: A0A2T7PYX7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01240 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.063e-38
Identity = 174/576 (30.21%), Postives = 307/576 (53.30%), Query Frame = 3
Query: 1281 EFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQ-IKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEK-ELTIRQKAITEKEHLYQEIKIR---GEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSL-----------VHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSAL---------IATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            E   ++ KLE E+  L   L    +R  EE+   EK YKNRI+ILE+  +  E RL  E++ L  Q+  +++ +EQE+ ++ +E  RR +E E    QE  +++E+H+  L  L+  +E+ ++ L  AK+ E   +  A  T+  L  V+ Q+ N A+DL  + Q  MD ++R  + E++  L+ ++E L++L+E+L KQ+ +N KER  L+ LI+++E+Q  EQ R  +EERW ++QEQ++L   Q +L+ +R      + + R +LE+ R+  L+EQ+  L H+ +E+R++AEER+KL  E   + E  Q  +++  Q   E + +   + EER+        L  E +  L   ++ D++N  +     +   LE+  L ++Q++ TE E + +E   R   GE++L +A++LHS +  +  +++ QL  +   E+ I ++ + + K +  L++ ++ +LC  C NSL             N+F GS +  N     GFT     PS  +  A       + SL  S L         IA+ +  +R +   K+    D+EYL  E  +L+ L
Sbjct:  543 EAAARICKLEIEKQYLDSTLESARRRYEEEVVAVEKSYKNRIQILEDANQKIEARLRGEIEQLMGQHLIRVKKMEQEKADLVAENYRRLEEQERNSAQETEKLKEKHRQVLASLKQEHEETIKLLADAKNKEIEKVASAHDTSRSLSVVVEQIQNNARDLGHL-QLKMDSWSRAGLDEREIGLRAKDEQLKILQERLTKQEQDNEKERRRLEDLIARMEMQNREQLRQLEEERWKVKQEQSRLEAQQTALDNDRRAWSEQQARERLTLEKAREIFLEEQRSGLSHLTDERRSLAEERSKLNMEQKLYREKLQQDAIRNAQAETEYQVLMKTIEEERKRAAERMRNLQKEEDRVL---AERDNLNQSMAGLEHEKRQLEQLALNLKQRS-TELEAMSEEANYRHMEGEKALAEARKLHSAYSQQNHEVEAQLSRVKVMEEHITQEKLRVAKEKKELESLKQAVLCASCRNSLQASSVPVARYTGGNAFIGSASTDNI--LAGFT-----PSQVIGQAN-----YLPSLARSMLGMMPPQIETIASSIANDRAVRLWKIQGLKDQEYLEDESLFLEGL 1101          
BLAST of fas-binding factor 1 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000002386.2 (pep primary_assembly:Astyanax_mexicanus-2.0:23:1449009:1478995:-1 gene:ENSAMXG00000002318.2 transcript:ENSAMXT00000002386.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.611e-16
Identity = 135/569 (23.73%), Postives = 281/569 (49.38%), Query Frame = 3
Query: 1245 SYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKL-TREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASK-FDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNS----LVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSALIATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            S  V+ L     + + +++ L+ E+D +   L+ + QR  ++ E+ E  ++ R+++LEE+   +E R  +E + L+++     +M EQER E++++  RR  + +  + +E+ R+R+  +  + +++  +E+ V++L++ K +E   +  A   T  L  V+ Q+   +  L  +  ++        +  +   + ++E L++L+++L +Q+ E A+ER  L+ +I+K++ QL EQ R   +ERW +  EQ K  +    LE+ER  ++      R  LE  +  +L+EQ+ +++   EE+R +A E  +  T+E  +     + +S    +E A  EG       + +    +R+    +RE++L +  +  D +  E+  + EK +     L  R + +     L  E    GE ++Q+A+++ SEHQ  +  I  ++  L ++EQ + ++ M +   R  ++   +++  N    S    L   S   +  +L  AP  G       P +   +++    E+  +L   AL         L H+    A+ DR++L  E+ +LD+L
Sbjct:  531 SVEVNSLHAKIIQLEGQVRSLQLEKDQIQMLLDSVQQRQKQDTELMENTHRARVKLLEESTAQREARARQENEDLAERLAAVTRMAEQERAELQAQHQRRLAQCQQDRDREVERLRDLQRKSILEMKKDHEEQVQRLRRLKDEEIDAVTSATSQTRSLTVVIEQMEQFSHRLGDLSSRVESTHENTTQGLELGARQRDEQLRVLQDRLTQQQREMAEERTRLKEVIAKMDTQLAEQQRQLQQERWRVTAEQAKAESALRGLEEERRSMMQHFTMEREELERAKSALLEEQQAVMQRCAEERRKLATEWTQFHTQEKVRQDRAEREASRAMERE-AHREG-SIIGIAQEQAELKLRAGELKQREDSLQRERENLDKLREELEREKEKLSAAALRLKSRAQEVESFSKLASERYEEGERAVQEARQVESEHQARLRTIHTEMERLRKQEQSLQQERMSMTDHRREVERMRQSLPINPLPLSTAPLLAEFSPALASTHLG-APVAG------PPPVGSNVSSFVSPELQATL---AL---------LRHT----AEKDRDFLQDEQFFLDTL 1074          
BLAST of fas-binding factor 1 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000049618.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:1449009:1480653:-1 gene:ENSAMXG00000002318.2 transcript:ENSAMXT00000049618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.611e-16
Identity = 135/569 (23.73%), Postives = 281/569 (49.38%), Query Frame = 3
Query: 1245 SYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKL-TREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASK-FDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNS----LVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSALIATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            S  V+ L     + + +++ L+ E+D +   L+ + QR  ++ E+ E  ++ R+++LEE+   +E R  +E + L+++     +M EQER E++++  RR  + +  + +E+ R+R+  +  + +++  +E+ V++L++ K +E   +  A   T  L  V+ Q+   +  L  +  ++        +  +   + ++E L++L+++L +Q+ E A+ER  L+ +I+K++ QL EQ R   +ERW +  EQ K  +    LE+ER  ++      R  LE  +  +L+EQ+ +++   EE+R +A E  +  T+E  +     + +S    +E A  EG       + +    +R+    +RE++L +  +  D +  E+  + EK +     L  R + +     L  E    GE ++Q+A+++ SEHQ  +  I  ++  L ++EQ + ++ M +   R  ++   +++  N    S    L   S   +  +L  AP  G       P +   +++    E+  +L   AL         L H+    A+ DR++L  E+ +LD+L
Sbjct:  531 SVEVNSLHAKIIQLEGQVRSLQLEKDQIQMLLDSVQQRQKQDTELMENTHRARVKLLEESTAQREARARQENEDLAERLAAVTRMAEQERAELQAQHQRRLAQCQQDRDREVERLRDLQRKSILEMKKDHEEQVQRLRRLKDEEIDAVTSATSQTRSLTVVIEQMEQFSHRLGDLSSRVESTHENTTQGLELGARQRDEQLRVLQDRLTQQQREMAEERTRLKEVIAKMDTQLAEQQRQLQQERWRVTAEQAKAESALRGLEEERRSMMQHFTMEREELERAKSALLEEQQAVMQRCAEERRKLATEWTQFHTQEKVRQDRAEREASRAMERE-AHREG-SIIGIAQEQAELKLRAGELKQREDSLQRERENLDKLREELEREKEKLSAAALRLKSRAQEVESFSKLASERYEEGERAVQEARQVESEHQARLRTIHTEMERLRKQEQSLQQERMSMTDHRREVERMRQSLPINPLPLSTAPLLAEFSPALASTHLG-APVAG------PPPVGSNVSSFVSPELQATL---AL---------LRHT----AEKDRDFLQDEQFFLDTL 1074          
BLAST of fas-binding factor 1 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000031774.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:1449009:1480653:-1 gene:ENSAMXG00000002318.2 transcript:ENSAMXT00000031774.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.627e-16
Identity = 135/569 (23.73%), Postives = 281/569 (49.38%), Query Frame = 3
Query: 1245 SYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKL-TREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASK-FDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNS----LVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSALIATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            S  V+ L     + + +++ L+ E+D +   L+ + QR  ++ E+ E  ++ R+++LEE+   +E R  +E + L+++     +M EQER E++++  RR  + +  + +E+ R+R+  +  + +++  +E+ V++L++ K +E   +  A   T  L  V+ Q+   +  L  +  ++        +  +   + ++E L++L+++L +Q+ E A+ER  L+ +I+K++ QL EQ R   +ERW +  EQ K  +    LE+ER  ++      R  LE  +  +L+EQ+ +++   EE+R +A E  +  T+E  +     + +S    +E A  EG       + +    +R+    +RE++L +  +  D +  E+  + EK +     L  R + +     L  E    GE ++Q+A+++ SEHQ  +  I  ++  L ++EQ + ++ M +   R  ++   +++  N    S    L   S   +  +L  AP  G       P +   +++    E+  +L   AL         L H+    A+ DR++L  E+ +LD+L
Sbjct:  516 SVEVNSLHAKIIQLEGQVRSLQLEKDQIQMLLDSVQQRQKQDTELMENTHRARVKLLEESTAQREARARQENEDLAERLAAVTRMAEQERAELQAQHQRRLAQCQQDRDREVERLRDLQRKSILEMKKDHEEQVQRLRRLKDEEIDAVTSATSQTRSLTVVIEQMEQFSHRLGDLSSRVESTHENTTQGLELGARQRDEQLRVLQDRLTQQQREMAEERTRLKEVIAKMDTQLAEQQRQLQQERWRVTAEQAKAESALRGLEEERRSMMQHFTMEREELERAKSALLEEQQAVMQRCAEERRKLATEWTQFHTQEKVRQDRAEREASRAMERE-AHREG-SIIGIAQEQAELKLRAGELKQREDSLQRERENLDKLREELEREKEKLSAAALRLKSRAQEVESFSKLASERYEEGERAVQEARQVESEHQARLRTIHTEMERLRKQEQSLQQERMSMTDHRREVERMRQSLPINPLPLSTAPLLAEFSPALASTHLG-APVAG------PPPVGSNVSSFVSPELQATL---AL---------LRHT----AEKDRDFLQDEQFFLDTL 1059          
BLAST of fas-binding factor 1 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000042254.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:1449009:1480653:-1 gene:ENSAMXG00000002318.2 transcript:ENSAMXT00000042254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 2.741e-16
Identity = 131/546 (23.99%), Postives = 270/546 (49.45%), Query Frame = 3
Query: 1314 ERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKL-TREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASK-FDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNS----LVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSALIATQMEEERLMHSIKMAADDDREYLSQERAYLDSL 2933
            E+D +   L+ + QR  ++ E+ E  ++ R+++LEE+   +E R  +E + L+++     +M EQER E++++  RR  + +  + +E+ R+R+  +  + +++  +E+ V++L++ K +E   +  A   T  L  V+ Q+   +  L  +  ++        +  +   + ++E L++L+++L +Q+ E A+ER  L+ +I+K++ QL EQ R   +ERW +  EQ K  +    LE+ER  ++      R  LE  +  +L+EQ+ +++   EE+R +A E  +  T+E  +     + +S    +E A  EG       + +    +R+    +RE++L +  +  D +  E+  + EK +     L  R + +     L  E    GE ++Q+A+++ SEHQ  +  I  ++  L ++EQ + ++ M +   R  ++   +++  N    S    L   S   +  +L  AP  G       P +   +++    E+  +L   AL         L H+    A+ DR++L  E+ +LD+L
Sbjct:  509 EKDQIQMLLDSVQQRQKQDTELMENTHRARVKLLEESTAQREARARQENEDLAERLAAVTRMAEQERAELQAQHQRRLAQCQQDRDREVERLRDLQRKSILEMKKDHEEQVQRLRRLKDEEIDAVTSATSQTRSLTVVIEQMEQFSHRLGDLSSRVESTHENTTQGLELGARQRDEQLRVLQDRLTQQQREMAEERTRLKEVIAKMDTQLAEQQRQLQQERWRVTAEQAKAESALRGLEEERRSMMQHFTMEREELERAKSALLEEQQAVMQRCAEERRKLATEWTQFHTQEKVRQDRAEREASRAMERE-AHREG-SIIGIAQEQAELKLRAGELKQREDSLQRERENLDKLREELEREKEKLSAAALRLKSRAQEVESFSKLASERYEEGERAVQEARQVESEHQARLRTIHTEMERLRKQEQSLQQERMSMTDHRREVERMRQSLPINPLPLSTAPLLAEFSPALASTHLG-APVAG------PPPVGSNVSSFVSPELQATL---AL---------LRHT----AEKDRDFLQDEQFFLDTL 1029          
BLAST of fas-binding factor 1 homolog vs. Ensembl Nematostella
Match: EDO31245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYH5])

HSP 1 Score: 88.5817 bits (218), Expect = 5.567e-20
Identity = 67/199 (33.67%), Postives = 119/199 (59.80%), Query Frame = 3
Query: 1584 RIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLT 2180
            R+R+ H+  L+  R  +   +  LK+ K +E +    A   T  LQS++ +V +  +D+  ++QQL       ++E++   + ++EYL  L ++L +Q+ E  +ER  LQ LI+K+E+ L EQTR  D+E+W L  E+ ++ TLQ SLE ER + +    + RA ++  R++ + EQ+++  H+ EEKR ++ ERA+L 
Sbjct:    2 RLRDLHRKSLEDARTEHAQEIAHLKRLKDEEVAAATSAHAHTRSLQSLMERVMSSTRDVSDMRQQLETTHKSGMEERETVARARDEYLAQLHDRLVRQQAETEEERTRLQGLIAKMELHLREQTRQLDQEKWRLSAEEARVKTLQNSLETERRMTMEQLAEERADVQRLREEFMREQQRVTLHLQEEKRALSTERAQLA 200          
BLAST of fas-binding factor 1 homolog vs. Ensembl Nematostella
Match: EDO27154 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA19])

HSP 1 Score: 59.6918 bits (143), Expect = 7.227e-10
Identity = 33/84 (39.29%), Postives = 55/84 (65.48%), Query Frame = 3
Query: 1929 LEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLT 2180
            +E+ L EQTR  D+E+W L  E+ ++ TLQ SLE ER + +    + RA ++  R++ + EQ+++  H+ EEKR ++ ERA+L 
Sbjct:    1 MELHLREQTRQLDQEKWRLSAEEARVKTLQNSLETERRMTMEQLAEERADVQRLREEFMREQQRVTLHLQEEKRALSTERAQLA 84          
BLAST of fas-binding factor 1 homolog vs. Ensembl Medaka
Match: ENSORLT00000030507.1 (Fas binding factor 1 [Source:NCBI gene;Acc:101160074])

HSP 1 Score: 103.605 bits (257), Expect = 5.801e-22
Identity = 83/304 (27.30%), Postives = 167/304 (54.93%), Query Frame = 3
Query: 1281 EFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLV-------SIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERA 2171
            E + ++K L+ ER      L  +  R+++++E  E  ++ R+++LEE    +E R   E + L ++     + +EQER E++++  R+  +++  + +E+ R+R+  +  + +++  +ED +++LK+ K +E   +  A   T  L  V+ Q+   +  L        S  +Q      R  + ++ QL+       +L+++L +Q+   A+ER  L+ +IS+++ Q+ EQ R  ++ERW +  EQ K+ +LQ SLE+ER ++ +     R  LE  +  +L+EQK +++H  EE+R +A E A
Sbjct:  529 ELEGQLKILQLERGQTQMMLESIQLRHAQDVEFMENAHRARVKLLEEAAAQRETRSRLECEDLIERMAALTRAVEQERSELQAQYHRKVAQVQQDRDREVERLRDLQRQSILEMKKDHEDQIQRLKRLKEEEIDAVTSATSQTRSLTGVIEQMEQFSSRLEELSSRVESAHEQSAHGLERGARHREEQLR-------VLEDRLSQQQKATAEERSYLKEIISRMDAQINEQQRQLEKERWKVASEQAKVESLQRSLEEERRVLNMQTSMEREELERAKSVLLEEQKSVMQHCAEERRKLAAEWA 825          
BLAST of fas-binding factor 1 homolog vs. Ensembl Medaka
Match: ENSORLT00000044861.1 (Fas binding factor 1 [Source:NCBI gene;Acc:101160074])

HSP 1 Score: 103.219 bits (256), Expect = 6.824e-22
Identity = 80/297 (26.94%), Postives = 167/297 (56.23%), Query Frame = 3
Query: 1281 EFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERA 2171
            E + ++K L+ ER      L  +  R+++++E  E  ++ R+++LEE    +E R   E + L ++     + +EQER E++++  R+  +++  + +E+ R+R+  +  + +++  +ED +++LK+ K +E   +  A   T  L  V+ Q+   +  L  +  ++     +     +   + + E L++L+++L +Q+   A+ER  L+ +IS+++ Q+ EQ R  ++ERW +  EQ K+ +LQ SLE+ER ++ +     R  LE  +  +L+EQK +++H  EE+R +A E A
Sbjct:  529 ELEGQLKILQLERGQTQMMLESIQLRHAQDVEFMENAHRARVKLLEEAAAQRETRSRLECEDLIERMAALTRAVEQERSELQAQYHRKVAQVQQDRDREVERLRDLQRQSILEMKKDHEDQIQRLKRLKEEEIDAVTSATSQTRSLTGVIEQMEQFSSRLEELSSRVESAHEQSAHGLERGARHREEQLRVLEDRLSQQQKATAEERSYLKEIISRMDAQINEQQRQLEKERWKVASEQAKVESLQRSLEEERRVLNMQTSMEREELERAKSVLLEEQKSVMQHCAEERRKLAAEWA 825          
BLAST of fas-binding factor 1 homolog vs. Ensembl Medaka
Match: ENSORLT00000015665.2 (Fas binding factor 1 [Source:NCBI gene;Acc:101160074])

HSP 1 Score: 103.219 bits (256), Expect = 7.447e-22
Identity = 83/304 (27.30%), Postives = 167/304 (54.93%), Query Frame = 3
Query: 1281 EFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLV-------SIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERA 2171
            E + ++K L+ ER      L  +  R+++++E  E  ++ R+++LEE    +E R   E + L ++     + +EQER E++++  R+  +++  + +E+ R+R+  +  + +++  +ED +++LK+ K +E   +  A   T  L  V+ Q+   +  L        S  +Q      R  + ++ QL+       +L+++L +Q+   A+ER  L+ +IS+++ Q+ EQ R  ++ERW +  EQ K+ +LQ SLE+ER ++ +     R  LE  +  +L+EQK +++H  EE+R +A E A
Sbjct:  535 ELEGQLKILQLERGQTQMMLESIQLRHAQDVEFMENAHRARVKLLEEAAAQRETRSRLECEDLIERMAALTRAVEQERSELQAQYHRKVAQVQQDRDREVERLRDLQRQSILEMKKDHEDQIQRLKRLKEEEIDAVTSATSQTRSLTGVIEQMEQFSSRLEELSSRVESAHEQSAHGLERGARHREEQLR-------VLEDRLSQQQKATAEERSYLKEIISRMDAQINEQQRQLEKERWKVASEQAKVESLQRSLEEERRVLNMQTSMEREELERAKSVLLEEQKSVMQHCAEERRKLAAEWA 831          
BLAST of fas-binding factor 1 homolog vs. Planmine SMEST
Match: SMESG000037546.1 (SMESG000037546.1)

HSP 1 Score: 1774.6 bits (4595), Expect = 0.000e+0
Identity = 907/916 (99.02%), Postives = 909/916 (99.24%), Query Frame = 3
Query:  228 ESKPKVNLITTPVAKNIDKEEINRVSIKPPKEIKTATKSLNDLFDDDFDHMSTMETVKPKENQNKPAKKILESLLSSSADLNDMNFSFNSQSTMNSKPVISEENKDQSPFQLEYRPSTGNQKSKESNLNQIYKKNVRFSTETLPDGDLDFDAASGSNRPVTAPNISTSDKIKPKFYTRFEAAEHGEIPIKTNANILFDGGSDSNLLNESKLDDFTTEFGNGFKQTLEINSNNKGFITSDFNRPPPKQKLEEFMQSSQEEILSLSTEKHRSQVLSDVPARRSTNDSRKGSIENLLDDRPKSFTSDEVTYGRRTSMSKDLHLERPKTSHHRNENSQMKSEGSYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYXXXXXXXXXXXXXXNAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIXXXXXXXXXXXXNIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATAFDQEIIDSLDYSALIATQMEEERLMHSIKMAADDDREYLSQERAYLDSLISGSQQSWKTHVKS 2975
            ESKPKVNLITTPVAKNIDKEEIN VSIKPPKEIKTATKSLNDLFDDDFDHMSTMETVKPKENQNKPAKKILESLLSSSADLNDMNFSFNSQSTMNSKPVISEE KDQSPFQLEYRPSTGNQKSKESNLNQIYKKNVRFS+ETLPDGDLDFDAASGSNRPVTAPNISTSDKIKPKFYTRFEAAEHGEIPIKTNANILF GGSDSNLLNESKLDDFTTEFGNGFKQTLEINSNNKGFITSD N PPPKQKLEEFMQSSQEEILSLSTEKHRSQVLSDVPARRSTNDSRKGSIENLLDDRPKSFTSDEVTYGRRTSMSKDLHLERPKTSHHRNENSQMKSEGSYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYLQLLKEKLDKQKDENAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIRAALSEERRELENIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATA DQEIIDSLD+SALI TQMEEERLMHSIKMAADDDREYLSQERAYLDSLISGSQQSWKTHVKS
Sbjct:   17 ESKPKVNLITTPVAKNIDKEEINLVSIKPPKEIKTATKSLNDLFDDDFDHMSTMETVKPKENQNKPAKKILESLLSSSADLNDMNFSFNSQSTMNSKPVISEEKKDQSPFQLEYRPSTGNQKSKESNLNQIYKKNVRFSSETLPDGDLDFDAASGSNRPVTAPNISTSDKIKPKFYTRFEAAEHGEIPIKTNANILFGGGSDSNLLNESKLDDFTTEFGNGFKQTLEINSNNKGFITSDSNWPPPKQKLEEFMQSSQEEILSLSTEKHRSQVLSDVPARRSTNDSRKGSIENLLDDRPKSFTSDEVTYGRRTSMSKDLHLERPKTSHHRNENSQMKSEGSYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEMNEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRSELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEESTLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLKDQNEYLQLLKEKLDKQKDENAKERENLQSLISKLEIQLTEQTRTADEERWFLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLEHIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIRAALSEERRELENIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIRQKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKEQQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPFYGFTKKPTDPSLNVRLATALDQEIIDSLDFSALITTQMEEERLMHSIKMAADDDREYLSQERAYLDSLISGSQQSWKTHVKS 932          
The following BLAST results are available for this feature:
BLAST of fas-binding factor 1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBF16.121e-2026.61Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
FBF16.176e-2026.61Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
FBF18.010e-2026.61Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
FBF12.355e-1926.33Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
FBF16.279e-635.00Fas binding factor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG59641.747e-825.49gene:FBgn0036206 transcript:FBtr0076085[more]
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kmt2c3.813e-2524.46lysine methyltransferase 2C [Source:Xenbase;Acc:XB... [more]
kmt2c2.241e-2424.46lysine methyltransferase 2C [Source:Xenbase;Acc:XB... [more]
kmt2c3.926e-2424.46lysine methyltransferase 2C [Source:Xenbase;Acc:XB... [more]
kmt2c5.479e-2424.46lysine methyltransferase 2C [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fbf11.345e-2625.85Fas (TNFRSF6) binding factor 1 [Source:MGI Symbol;... [more]
Fbf11.345e-2625.85Fas (TNFRSF6) binding factor 1 [Source:MGI Symbol;... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A2A870|FBF1_MOUSE9.405e-2625.85Fas-binding factor 1 OS=Mus musculus OX=10090 GN=F... [more]
sp|Q5ZIB2|FBF1_CHICK7.536e-2227.08Fas-binding factor 1 homolog OS=Gallus gallus OX=9... [more]
sp|Q8TES7|FBF1_HUMAN1.131e-1826.33Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FB... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HVC41.288e-4428.88fas-binding factor 1 homolog OS=Lingula unguis OX=... [more]
A0A2C9LKY08.274e-4329.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9LL547.217e-3929.33Uncharacterized protein OS=Biomphalaria glabrata O... [more]
K1RBN18.899e-3930.16Fas-binding factor 1 OS=Crassostrea gigas OX=29159... [more]
A0A2T7PYX71.063e-3830.21Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000002386.21.611e-1623.73pep primary_assembly:Astyanax_mexicanus-2.0:23:144... [more]
ENSAMXT00000049618.11.611e-1623.73pep primary_assembly:Astyanax_mexicanus-2.0:23:144... [more]
ENSAMXT00000031774.11.627e-1623.73pep primary_assembly:Astyanax_mexicanus-2.0:23:144... [more]
ENSAMXT00000042254.12.741e-1623.99pep primary_assembly:Astyanax_mexicanus-2.0:23:144... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO312455.567e-2033.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271547.227e-1039.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000030507.15.801e-2227.30Fas binding factor 1 [Source:NCBI gene;Acc:1011600... [more]
ENSORLT00000044861.16.824e-2226.94Fas binding factor 1 [Source:NCBI gene;Acc:1011600... [more]
ENSORLT00000015665.27.447e-2227.30Fas binding factor 1 [Source:NCBI gene;Acc:1011600... [more]
back to top
BLAST of fas-binding factor 1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037546.10.000e+099.02SMESG000037546.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009869 ID=SMED30009869|Name=fas-binding factor 1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=3125bp
AACTAACAGTTTTTATGTTTATTTAAATTTAAAATTTTTAACATTTCAAT
TAAGAATTTCAAGTTAATTATCAATTAGGGTAAATCATTTAAAAAAATAG
AAAAATATTTAATTAATAAGAATATCTAAAGATATTGTAATATTTAATTA
ATTATTTAATTTTTTATATTAATAAAAATATGAGCGATTTTGACGATGAT
GATGATTTTGCTGATATATTTGATGATGAGTCAAAACCTAAAGTCAACTT
GATTACAACGCCTGTTGCAAAGAATATTGATAAAGAAGAGATAAACCGAG
TTTCGATTAAACCTCCAAAAGAAATAAAAACTGCAACGAAATCACTAAAT
GACTTATTTGATGATGATTTTGATCATATGTCCACAATGGAAACTGTCAA
ACCAAAAGAAAATCAAAATAAACCAGCGAAAAAAATATTAGAATCTTTGT
TAAGTTCATCAGCAGATCTGAATGATATGAATTTTTCATTTAATTCACAA
TCTACCATGAATTCGAAACCAGTAATTTCTGAAGAAAATAAGGATCAATC
ACCATTTCAATTAGAATATAGGCCATCAACTGGCAATCAGAAATCAAAGG
AATCAAATTTAAATCAGATTTATAAAAAAAACGTGCGATTTTCTACTGAG
ACTCTGCCGGATGGAGATCTAGATTTCGATGCAGCTTCAGGCAGTAATAG
GCCAGTTACCGCTCCGAATATTAGTACAAGCGATAAGATAAAACCCAAAT
TTTACACTCGATTCGAAGCAGCTGAGCATGGTGAGATTCCCATCAAAACG
AATGCAAATATCCTATTTGATGGGGGATCAGATTCAAATTTACTGAATGA
ATCGAAGTTAGATGATTTTACAACGGAATTTGGGAATGGATTTAAACAAA
CATTAGAAATTAATAGTAACAACAAAGGATTCATTACTTCGGACTTTAAT
CGGCCTCCGCCAAAGCAAAAATTAGAAGAATTTATGCAATCATCTCAAGA
AGAAATTTTATCATTATCCACTGAGAAACACAGGTCGCAGGTTTTAAGCG
ATGTCCCGGCAAGACGCTCGACTAATGACTCCAGAAAAGGCAGTATTGAG
AATTTATTAGATGATCGCCCGAAAAGTTTTACATCTGATGAAGTCACCTA
CGGGAGAAGAACGAGTATGTCTAAAGACTTACATCTTGAAAGACCTAAAA
CCTCCCACCACCGAAATGAAAATTCCCAAATGAAATCCGAAGGAAGTTAT
TCTGTAGACATATTATCTAATGATTCTGCGGAGTTTCAATTAAAGATGAA
AAAACTTGAAACCGAACGAGACGATTTATTATATAAGTTAAACAAAATGT
CTCAGAGGAATTCGGAAGAATTGGAAATGAACGAAAAACTCTATAAGAAT
CGTATTGAAATCCTCGAGGAAAACATGAAATCAAAAGAAAAACGATTAAC
AGAGGAAGTTGATTTATTATCCCAACAGAATAAGCAGAAACTTCAGATGC
TGGAACAGGAACGACTGGAAATGAGATCTGAACTTACTCGAAGACAGGAT
GAAATTGAAAACCAAAAACGTCAAGAAATATCCAGAATTCGGGAACAACA
CAAATGCGAACTAGATAAACTTCGATTGCACTATGAAGATATGGTAGAAA
AATTAAAGCAGGCCAAGTCAGACGAAGAATCCACCCTTCGCATGGCCCAA
CCAACTACAGTGCAACTCCAGTCAGTTTTGACGCAAGTCAGCAATGGAGC
TCAGGATCTCGTTTCAATAAAACAGCAATTGATGGATCAGTTCAATAGGC
AAATCAAGGAAAAGGATGCACAATTGAAAGATCAAAATGAATATTTACAA
TTACTGAAAGAAAAACTTGATAAACAAAAAGACGAAAATGCGAAAGAAAG
GGAAAATCTTCAATCATTAATTTCCAAACTGGAAATTCAATTGACAGAAC
AAACGAGAACAGCCGATGAAGAACGATGGTTTTTGCGACAAGAACAGAAC
AAATTATCAACACTTCAAGCATCATTGGAAAAAGAAAGAGGAATAATTCT
TTTAGATAAAGATCAAAATAGAGCCTCATTAGAAGAATTCCGAAAACAAA
TCCTTGATGAACAGAAAAAAATGCTAGAACATATATATGAAGAGAAGCGA
AACATGGCGGAAGAAAGAGCAAAGCTTACACGCGAAATGTTTAAATGGTC
TGAGACGAGTCAGATATCAAGCGTTAAAAAGAATCAAGAAATGGCCGAGT
TGGAAGGAATTCGTGCTGCTTTATCTGAAGAAAGAAGGGAACTTGAAAAT
ATTAGATCCCAATTAAATAATGAACGAGAAGAGAATCTGTCAAAGGCATC
CAAATTTGATTCCATGAACTATGAAATTCGAATGAAAATGGAAAAAGCAA
ATAATCTAGAGAAAGAACTCACCATCCGACAGAAAGCCATAACTGAAAAA
GAACATCTCTATCAAGAAATAAAAATTCGAGGCGAAGAGTCACTCCAGCA
AGCCAAAGAGTTGCATTCAGAGCATCAAAATGAAATATCTAAAATCCAGA
AGCAGTTGATTGTATTGAATGAAAAAGAACAACAAATTAATAAACAAATG
ATGGAATTGGAAAAACTGCGAATGAATTTACAAAATAAAGAGAAAACGAT
ATTGTGTAACAAGTGCTCGAATTCTTTGGTTCACAATTCATTCGGTGGAT
CACACAACAATCTGAATAGGGCACCATTCTATGGATTCACAAAAAAGCCA
ACCGATCCTAGCTTAAATGTAAGACTTGCCACAGCATTTGATCAAGAAAT
TATTGACTCTTTGGATTATTCCGCTCTGATAGCCACTCAAATGGAGGAAG
AAAGACTGATGCATTCAATCAAAATGGCCGCCGATGATGACCGGGAATAT
CTGAGCCAAGAGCGGGCTTATCTAGATTCATTAATTAGTGGTTCTCAACA
GTCATGGAAAACTCATGTAAAAAGTTAATCCAGACTAAGAAGCAACCAGA
CTTTCCTCAATTTATATTCTAATAATTATTGCTATAAAATATTATTCTCA
GATACCCGAAAAGTATTTGATCGAAAATAAAGAAAAATATTTTTGAAATA
TTGAATATTTGTAAATCGCACCGTG
back to top

protein sequence of SMED30009869-orf-1

>SMED30009869-orf-1 ID=SMED30009869-orf-1|Name=SMED30009869-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=933bp
MSDFDDDDDFADIFDDESKPKVNLITTPVAKNIDKEEINRVSIKPPKEIK
TATKSLNDLFDDDFDHMSTMETVKPKENQNKPAKKILESLLSSSADLNDM
NFSFNSQSTMNSKPVISEENKDQSPFQLEYRPSTGNQKSKESNLNQIYKK
NVRFSTETLPDGDLDFDAASGSNRPVTAPNISTSDKIKPKFYTRFEAAEH
GEIPIKTNANILFDGGSDSNLLNESKLDDFTTEFGNGFKQTLEINSNNKG
FITSDFNRPPPKQKLEEFMQSSQEEILSLSTEKHRSQVLSDVPARRSTND
SRKGSIENLLDDRPKSFTSDEVTYGRRTSMSKDLHLERPKTSHHRNENSQ
MKSEGSYSVDILSNDSAEFQLKMKKLETERDDLLYKLNKMSQRNSEELEM
NEKLYKNRIEILEENMKSKEKRLTEEVDLLSQQNKQKLQMLEQERLEMRS
ELTRRQDEIENQKRQEISRIREQHKCELDKLRLHYEDMVEKLKQAKSDEE
STLRMAQPTTVQLQSVLTQVSNGAQDLVSIKQQLMDQFNRQIKEKDAQLK
DQNEYLQLLKEKLDKQKDENAKERENLQSLISKLEIQLTEQTRTADEERW
FLRQEQNKLSTLQASLEKERGIILLDKDQNRASLEEFRKQILDEQKKMLE
HIYEEKRNMAEERAKLTREMFKWSETSQISSVKKNQEMAELEGIRAALSE
ERRELENIRSQLNNEREENLSKASKFDSMNYEIRMKMEKANNLEKELTIR
QKAITEKEHLYQEIKIRGEESLQQAKELHSEHQNEISKIQKQLIVLNEKE
QQINKQMMELEKLRMNLQNKEKTILCNKCSNSLVHNSFGGSHNNLNRAPF
YGFTKKPTDPSLNVRLATAFDQEIIDSLDYSALIATQMEEERLMHSIKMA
ADDDREYLSQERAYLDSLISGSQQSWKTHVKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR033561FBF1
IPR011528NERD
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0090162establishment of epithelial cell polarity
Vocabulary: cellular component
TermDefinition
GO:0097539ciliary transition fiber
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 535..594
NoneNo IPR availableCOILSCoilCoilcoord: 471..498
NoneNo IPR availableCOILSCoilCoilcoord: 395..469
NoneNo IPR availableCOILSCoilCoilcoord: 684..722
NoneNo IPR availableCOILSCoilCoilcoord: 642..669
NoneNo IPR availableCOILSCoilCoilcoord: 359..393
NoneNo IPR availableCOILSCoilCoilcoord: 772..823
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 127..144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 296..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 281..355
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 281..295
IPR033561Fas-binding factor 1PANTHERPTHR33689FAMILY NOT NAMEDcoord: 3..918