Cap methyltransferase 1

Overview
NameCap methyltransferase 1
Smed IDSMED30009864
Length (bp)2414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cap methyltransferase 1 (SMED30009864) t-SNE clustered cells

Violin plots show distribution of expression levels for Cap methyltransferase 1 (SMED30009864) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cap methyltransferase 1 (SMED30009864) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cap methyltransferase 1 (SMED30009864) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009864

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009864h1SMcG0005269 SmedASXL_014539SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009864h1SMcG0005269 SmedASXL_014539SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30009864h1SMcG0005269 SmedASXL_014540SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009864h1SMcG0005269 SmedASXL_014540SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cap methyltransferase 1 vs. Ensembl Human
Match: CMTR1 (cap methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:21077])

HSP 1 Score: 308.145 bits (788), Expect = 7.093e-94
Identity = 156/333 (46.85%), Postives = 216/333 (64.86%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+R+NPYE I   FFLNRAAMKMAN+D + D +FT   +          E E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+         T  EN++ F+  V+  T   GVH ++ADGGF V G E++QE++SKQL LCQFL A++I+RT G+F+CK FD+FT FSVGL++L+   F+ V + KPITSRPANSERY+V K        I+++R++L+ VN  LN  + TD DV  V+   ++K D +F  ++  SN    + QI  LAK++AF+ D  LS+ RQ +IRKE   LW IPD  R
Sbjct:  217 ARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVG---IDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQAR 546          

HSP 2 Score: 58.151 bits (139), Expect = 7.093e-94
Identity = 41/125 (32.80%), Postives = 65/125 (52.00%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLK----DEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG  +QG  + V AS+   R GLGL     D++L ++  D        E SA   + +       + D  +++   V+G+RK  I++ET +C   LL  +L+CK
Sbjct:   85 SMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDE------PEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK 203          
BLAST of Cap methyltransferase 1 vs. Ensembl Human
Match: CMTR1 (cap methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:21077])

HSP 1 Score: 169.859 bits (429), Expect = 6.335e-53
Identity = 79/163 (48.47%), Postives = 113/163 (69.33%), Query Frame = 1
Query:  625 ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNV 1104
            + E E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+         T  EN++ F+  V+  T   GVH ++ADGGF V G E++QE++SKQL LCQFL A++I+RT G+F+CK FD+FT FSVGL++L+   F+ V
Sbjct:  209 DREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERV 371          

HSP 2 Score: 59.6918 bits (143), Expect = 6.335e-53
Identity = 43/136 (31.62%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLK----DEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCKINMITFSTAEV 520
            S  ++V   +M KMG+ EG GLG  +QG  + V AS+   R GLGL     D++L ++  D        E SA   + +       + D  +++   V+G+RK  I++ET +C   LL  +L+CK  ++    AE+
Sbjct:   85 SMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDE------PEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKKPLVKDREAEL 214          
BLAST of Cap methyltransferase 1 vs. Ensembl Human
Match: CMTR2 (cap methyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:25635])

HSP 1 Score: 82.8037 bits (203), Expect = 1.447e-15
Identity = 64/250 (25.60%), Postives = 112/250 (44.80%), Query Frame = 1
Query:  658 ICAGPGGFTEFM--LWKRQMQSCGFGFTL-------RGKDDFKL---NKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQD-----VIKVIQNTILKKDKQFIKFIKESNNKILAEQI 1356
            +C  PG F   +    K     C + +            DD  +   +++I   +  ++  +G  + GDI   + LT  Q  +   +    VH V ADG FD  G+   QE +   L+ C+ + A+  L   G+FV K+F +F   S+ L++L++  FD V + KP TS+  NSE Y+V   +          R  ++ + S + L  GT+          VI ++ LK+ ++   F  +   + ++E I
Sbjct:  143 LCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEANDDLMMIMDDRLIANTLHWWY--FGPDNTGDIMTLKFLTGLQNFI---SSMATVHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKG--------REAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRHEECCVFFHKYQLETISENI 379          
BLAST of Cap methyltransferase 1 vs. Ensembl Human
Match: CMTR2 (cap methyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:25635])

HSP 1 Score: 82.8037 bits (203), Expect = 1.447e-15
Identity = 64/250 (25.60%), Postives = 112/250 (44.80%), Query Frame = 1
Query:  658 ICAGPGGFTEFM--LWKRQMQSCGFGFTL-------RGKDDFKL---NKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQD-----VIKVIQNTILKKDKQFIKFIKESNNKILAEQI 1356
            +C  PG F   +    K     C + +            DD  +   +++I   +  ++  +G  + GDI   + LT  Q  +   +    VH V ADG FD  G+   QE +   L+ C+ + A+  L   G+FV K+F +F   S+ L++L++  FD V + KP TS+  NSE Y+V   +          R  ++ + S + L  GT+          VI ++ LK+ ++   F  +   + ++E I
Sbjct:  143 LCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEANDDLMMIMDDRLIANTLHWWY--FGPDNTGDIMTLKFLTGLQNFI---SSMATVHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKG--------REAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRHEECCVFFHKYQLETISENI 379          
BLAST of Cap methyltransferase 1 vs. Ensembl Human
Match: FTSJ1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:13254])

HSP 1 Score: 53.5286 bits (127), Expect = 9.063e-7
Identity = 52/208 (25.00%), Postives = 87/208 (41.83%), Query Frame = 1
Query:  655 DICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIF-LVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVI 1275
            D+CA PG +++ +  K   Q  G    +    D +    + G V+           GDIT    L+  +  + H  G      V+ DG  DV+G   + E M  QL L     A ++L+  G FV K   IF    V L++  +   F +V   KP +SR ++ E + V + +      I ++   L   + D N   G  + ++  +
Sbjct:   47 DLCAAPGSWSQVLSQKIGGQGSGHVVAV----DLQAMAPLPGVVQI---------QGDIT---QLSTAKEIIQHFKG-CPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAK---IFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDFNQLDGPTRIIVPFV 234          
BLAST of Cap methyltransferase 1 vs. Ensembl Celegans
Match: Y53F4B.13 (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NAA5])

HSP 1 Score: 284.648 bits (727), Expect = 3.786e-85
Identity = 178/542 (32.84%), Postives = 278/542 (51.29%), Query Frame = 1
Query:  499 NFLDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENE----------------------ILFFADICAGPGGFTEFMLWKRQMQSC-GFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKG--TDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRD--------HFLCAKANPI-----------AENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGN-LKCNS----VVVVDSPLIYGEDISELSYEDRMHRVSHLCSLL 1977
            +  + R+R+NPYE I S FF NRAAMK AN+D I D I ++   EN+                      + +FAD+CAGPGGF+E+MLW++   +  GFGFTL GKDDFKL K        F   YG  D+GD+ +  N+   +  +  GT  +GVH ++ADGGF V G E+IQE++SK+LYLCQ L ++ I+R  GNF CKLFDIFT FSVGLI+L+   + +VS+ KP TSRPANSERYI  K    +   +  ++ +L +VN  L+  K   +  DV  ++   +++ D+ F+  I   N  +   Q + L K  +F  ++   D+ Q ++R E  + W++P+ +R         H    + NP+            E+ +   F +        +   + +P+    + + +F            VP+    +  L + A D  ++            +R  R F+ +     +IP  T+LLV +  E     GN +K +S    V ++D+ +++G+D+S L YE+RM       + L
Sbjct:  218 DLREARTRANPYETIGSAFFQNRAAMKTANMDKIYDWILSRENTENDRFLLKNPLQESQTAENVDRSEDLFYFADVCAGPGGFSEYMLWRKGFYNAKGFGFTLAGKDDFKLFKFTASSQYFFETFYGTKDNGDVMDPVNIDSLEAHISRGTSGLGVHLMMADGGFSVEGQENIQEILSKRLYLCQLLVSLCIVREGGNFFCKLFDIFTPFSVGLIYLMRVCYQSVSLHKPHTSRPANSERYITCKGLRKEFANV--VKEYLKRVNRKLDELKNKKSHDDVTDLMPLDVIEADQIFMDEIIRHNEFLANRQTLYLRKYQSFAKNQGQFDKDQGNLRDECLKYWQVPNKQRPRGGDRGNRHDNMQRLNPLQVYGKYCKKVCGESEIGNTFPD-------FSLNCLDAPLPNIPYEEYRF------------VPLASSGSPNLLIAAGDSAFI------------FRSGR-FESISADHIRIPENTILLVDWAEEVVRGDGNRIKISSEPQVVRIIDAAVLFGDDVSNLPYEERMKAAEKFVAAL 725          

HSP 2 Score: 51.2174 bits (121), Expect = 3.786e-85
Identity = 38/125 (30.40%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  140 NVGLNMMRKMGWE-GSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIF--------SASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
             V   +M  MG + G GLG   QG+ EP+A+ST   R GLG           + VW +  +E +    + +         A     + DD  +    VIG+ K+TID+ET +C    + EM++ K
Sbjct:   88 TVAERLMAAMGHKAGEGLGKHGQGISEPIASSTQRGRTGLGHNAGKATARDFNEVWDETTEEKTVVERVEWMTDIEEEKRAEICEQLKDDKWM----VIGKEKRTIDDETKFCSQQSITEMIEAK 208          
BLAST of Cap methyltransferase 1 vs. Ensembl Celegans
Match: Y53F4B.13 (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NAA5])

HSP 1 Score: 269.626 bits (688), Expect = 1.143e-80
Identity = 141/349 (40.40%), Postives = 206/349 (59.03%), Query Frame = 1
Query:  499 NFLDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENE----------------------ILFFADICAGPGGFTEFMLWKRQMQSC-GFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKG--TDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
            +  + R+R+NPYE I S FF NRAAMK AN+D I D I ++   EN+                      + +FAD+CAGPGGF+E+MLW++   +  GFGFTL GKDDFKL K        F   YG  D+GD+ +  N+   +  +  GT  +GVH ++ADGGF V G E+IQE++SK+LYLCQ L ++ I+R  GNF CKLFDIFT FSVGLI+L+   + +VS+ KP TSRPANSERYI  K    +   +  ++ +L +VN  L+  K   +  DV  ++   +++ D+ F+  I   N  +   Q + L K  +F  ++   D+ Q ++R E  + W++P+ +R
Sbjct:  218 DLREARTRANPYETIGSAFFQNRAAMKTANMDKIYDWILSRENTENDRFLLKNPLQESQTAENVDRSEDLFYFADVCAGPGGFSEYMLWRKGFYNAKGFGFTLAGKDDFKLFKFTASSQYFFETFYGTKDNGDVMDPVNIDSLEAHISRGTSGLGVHLMMADGGFSVEGQENIQEILSKRLYLCQLLVSLCIVREGGNFFCKLFDIFTPFSVGLIYLMRVCYQSVSLHKPHTSRPANSERYITCKGLRKEFANV--VKEYLKRVNRKLDELKNKKSHDDVTDLMPLDVIEADQIFMDEIIRHNEFLANRQTLYLRKYQSFAKNQGQFDKDQGNLRDECLKYWQVPNKQR 564          

HSP 2 Score: 51.6026 bits (122), Expect = 1.143e-80
Identity = 37/127 (29.13%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  143 VGLNMMRKMGWE-GSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGE-----------VIGERKQTIDNETTYCDPALLCEMLKCK 487
            V   +M  MG + G GLG   QG+ EP+A+ST   R GLG           + VW +  +E +           +  ++D  +    E           VIG+ K+TID+ET +C    + EM++ K
Sbjct:   89 VAERLMAAMGHKAGEGLGKHGQGISEPIASSTQRGRTGLGHNAGKATARDFNEVWDETTEEKTV-------VERVEWMTDIEEEKRAEICEQLKDDKWMVIGKEKRTIDDETKFCSQQSITEMIEAK 208          
BLAST of Cap methyltransferase 1 vs. Ensembl Celegans
Match: Y53F4B.13 (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NAA5])

HSP 1 Score: 269.626 bits (688), Expect = 1.335e-80
Identity = 172/540 (31.85%), Postives = 270/540 (50.00%), Query Frame = 1
Query:  499 NFLDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENE----------------------ILFFADICAGPGGFTEFMLWKRQMQSC-GFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRD--------HFLCAKANPI-----------AENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGN-LKCNS----VVVVDSPLIYGEDISELSYEDRMHRVSHLCSLL 1977
            +  + R+R+NPYE I S FF NRAAMK AN+D I D I ++   EN+                      + +FAD+CAGPGGF+E+MLW++   +  GFGFTL GKDDFKL K        F   YG  D+GD+ +  N+   +  +  GT  +GVH ++ADGGF V G E+IQE++SK+LYLCQ L ++ I+R  GNF CKLFDIFT FSVGLI+L+   + +VS+ KP TSRPANSER            +++ ++N            K +  DV  ++   +++ D+ F+  I   N  +   Q + L K  +F  ++   D+ Q ++R E  + W++P+ +R         H    + NP+            E+ +   F +        +   + +P+    + + +F            VP+    +  L + A D  ++            +R  R F+ +     +IP  T+LLV +  E     GN +K +S    V ++D+ +++G+D+S L YE+RM       + L
Sbjct:  218 DLREARTRANPYETIGSAFFQNRAAMKTANMDKIYDWILSRENTENDRFLLKNPLQESQTAENVDRSEDLFYFADVCAGPGGFSEYMLWRKGFYNAKGFGFTLAGKDDFKLFKFTASSQYFFETFYGTKDNGDVMDPVNIDSLEAHISRGTSGLGVHLMMADGGFSVEGQENIQEILSKRLYLCQLLVSLCIVREGGNFFCKLFDIFTPFSVGLIYLMRVCYQSVSLHKPHTSRPANSERV---------NRKLDELKN------------KKSHDDVTDLMPLDVIEADQIFMDEIIRHNEFLANRQTLYLRKYQSFAKNQGQFDKDQGNLRDECLKYWQVPNKQRPRGGDRGNRHDNMQRLNPLQVYGKYCKKVCGESEIGNTFPD-------FSLNCLDAPLPNIPYEEYRF------------VPLASSGSPNLLIAAGDSAFI------------FRSGR-FESISADHIRIPENTILLVDWAEEVVRGDGNRIKISSEPQVVRIIDAAVLFGDDVSNLPYEERMKAAEKFVAAL 704          

HSP 2 Score: 51.2174 bits (121), Expect = 1.335e-80
Identity = 38/125 (30.40%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  140 NVGLNMMRKMGWE-GSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIF--------SASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
             V   +M  MG + G GLG   QG+ EP+A+ST   R GLG           + VW +  +E +    + +         A     + DD  +    VIG+ K+TID+ET +C    + EM++ K
Sbjct:   88 TVAERLMAAMGHKAGEGLGKHGQGISEPIASSTQRGRTGLGHNAGKATARDFNEVWDETTEEKTVVERVEWMTDIEEEKRAEICEQLKDDKWM----VIGKEKRTIDDETKFCSQQSITEMIEAK 208          
BLAST of Cap methyltransferase 1 vs. Ensembl Celegans
Match: Y53F4B.13 (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NAA5])

HSP 1 Score: 268.855 bits (686), Expect = 1.944e-80
Identity = 141/349 (40.40%), Postives = 206/349 (59.03%), Query Frame = 1
Query:  499 NFLDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENE----------------------ILFFADICAGPGGFTEFMLWKRQMQSC-GFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKG--TDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
            +  + R+R+NPYE I S FF NRAAMK AN+D I D I ++   EN+                      + +FAD+CAGPGGF+E+MLW++   +  GFGFTL GKDDFKL K        F   YG  D+GD+ +  N+   +  +  GT  +GVH ++ADGGF V G E+IQE++SK+LYLCQ L ++ I+R  GNF CKLFDIFT FSVGLI+L+   + +VS+ KP TSRPANSERYI  K    +   +  ++ +L +VN  L+  K   +  DV  ++   +++ D+ F+  I   N  +   Q + L K  +F  ++   D+ Q ++R E  + W++P+ +R
Sbjct:  218 DLREARTRANPYETIGSAFFQNRAAMKTANMDKIYDWILSRENTENDRFLLKNPLQESQTAENVDRSEDLFYFADVCAGPGGFSEYMLWRKGFYNAKGFGFTLAGKDDFKLFKFTASSQYFFETFYGTKDNGDVMDPVNIDSLEAHISRGTSGLGVHLMMADGGFSVEGQENIQEILSKRLYLCQLLVSLCIVREGGNFFCKLFDIFTPFSVGLIYLMRVCYQSVSLHKPHTSRPANSERYITCKGLRKEFANV--VKEYLKRVNRKLDELKNKKSHDDVTDLMPLDVIEADQIFMDEIIRHNEFLANRQTLYLRKYQSFAKNQGQFDKDQGNLRDECLKYWQVPNKQR 564          

HSP 2 Score: 51.2174 bits (121), Expect = 1.944e-80
Identity = 37/127 (29.13%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  143 VGLNMMRKMGWE-GSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGE-----------VIGERKQTIDNETTYCDPALLCEMLKCK 487
            V   +M  MG + G GLG   QG+ EP+A+ST   R GLG           + VW +  +E +           +  ++D  +    E           VIG+ K+TID+ET +C    + EM++ K
Sbjct:   89 VAERLMAAMGHKAGEGLGKHGQGISEPIASSTQRGRTGLGHNAGKATARDFNEVWDETTEEKTV-------VERVEWMTDIEEEKRAEICEQLKDDKWMVIGKEKRTIDDETKFCSQQSITEMIEAK 208          
BLAST of Cap methyltransferase 1 vs. Ensembl Celegans
Match: Y40D12A.1 (pep chromosome:WBcel235:III:6615414:6620051:1 gene:WBGene00021502.1 transcript:Y40D12A.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y40D12A.1)

HSP 1 Score: 58.151 bits (139), Expect = 2.183e-8
Identity = 40/129 (31.01%), Postives = 63/129 (48.84%), Query Frame = 1
Query:  805 YGKADDGDIT--NQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTN 1185
            +G +DDGDI    +E L K   + + GT ++    V ADG  +  G E   E +   L   +   A+ +LR  G  + K +      +  ++ L++  F ++  IKP+ SRP +SERYIV   F    N
Sbjct:  190 FGPSDDGDIEKFTEEYLIK---QKLAGTFDL----VTADGSTNTQGKEGEIESIVSSLISAEVEVALKLLRRNGRLILKTYRFCAKSTRDVMNLLADNFSSIKAIKPMASRPGSSERYIVCDGFGGSMN 311          
BLAST of Cap methyltransferase 1 vs. Ensembl Fly
Match: CG6379 (gene:FBgn0029693 transcript:FBtr0343297)

HSP 1 Score: 287.73 bits (735), Expect = 3.594e-91
Identity = 149/329 (45.29%), Postives = 213/329 (64.74%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENE--------NEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQ-DVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             RSR NP+E I S  FLNRAA+KMAN+DS+C+ +FT   +         +E+L+F D+CAGPGGF+E++L+++  ++ GFGFTLRG +DFKL K      E F   YG  +DG+I ++ N       +   T   GVH  +ADGGF V G ++IQE++SKQLYLCQFL A+ ILR  G+FVCK+FD+FT FSVGL++L+   F  ++IIKP +SRPANSERY+V K   SD      I  +L  VN  L+     D+ DV+++     L +D+ F+++I +SNN I  +QI+GL K+ AF  +  L + +Q ++R+E  + W +PD  R
Sbjct:  157 ARSRCNPFETIRSSIFLNRAAVKMANIDSMCNFMFTNPRDPAGQTLVAPDELLYFTDMCAGPGGFSEYVLYRKSWEAKGFGFTLRGANDFKLEKFFAASPESFDTFYGVKEDGNIFDESNQDSLNEYIRMHTPQ-GVHFAMADGGFSVEGQKNIQEILSKQLYLCQFLTALKILRPNGSFVCKVFDLFTPFSVGLVYLMYKCFQQIAIIKPNSSRPANSERYLVCKYKRSDAE-TAGIVAYLNTVNLMLSDESQLDENDVLEIFNANELAEDEDFLRYIIDSNNAIGKKQIVGLRKIAAFAQNLELKETKQSEVRQECLKRWGLPDKLR 483          

HSP 2 Score: 68.9366 bits (167), Expect = 3.594e-91
Identity = 50/141 (35.46%), Postives = 72/141 (51.06%), Query Frame = 2
Query:   86 NDDYEPSAKIRKVE--SSNHNVGLNMMRKMGWEG-SGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIF-SASGIRMVSDDYDLNS---GEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            +++ EP+ K  K E   S  N  + MM+KMG+E   GLG  NQG +EP+ A     R G GLK +   ++     W    +E      +++    G R  +D Y L+      V GE+K T+D ET YCDPA+L  +L  K
Sbjct:    7 DENSEPTPKKIKREWVKSYSNKAMEMMKKMGYENDKGLGKSNQGRLEPIIAVQQDGRRGFGLKLD--TVQSSAGQWDPACEELEIPEPVLWLHNPGSR--ADAYSLDQLMGHLVTGEKKLTLDGETRYCDPAILHHILNAK 143          
BLAST of Cap methyltransferase 1 vs. Ensembl Fly
Match: CG6379 (gene:FBgn0029693 transcript:FBtr0070671)

HSP 1 Score: 287.73 bits (735), Expect = 3.594e-91
Identity = 149/329 (45.29%), Postives = 213/329 (64.74%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENE--------NEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQ-DVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             RSR NP+E I S  FLNRAA+KMAN+DS+C+ +FT   +         +E+L+F D+CAGPGGF+E++L+++  ++ GFGFTLRG +DFKL K      E F   YG  +DG+I ++ N       +   T   GVH  +ADGGF V G ++IQE++SKQLYLCQFL A+ ILR  G+FVCK+FD+FT FSVGL++L+   F  ++IIKP +SRPANSERY+V K   SD      I  +L  VN  L+     D+ DV+++     L +D+ F+++I +SNN I  +QI+GL K+ AF  +  L + +Q ++R+E  + W +PD  R
Sbjct:  157 ARSRCNPFETIRSSIFLNRAAVKMANIDSMCNFMFTNPRDPAGQTLVAPDELLYFTDMCAGPGGFSEYVLYRKSWEAKGFGFTLRGANDFKLEKFFAASPESFDTFYGVKEDGNIFDESNQDSLNEYIRMHTPQ-GVHFAMADGGFSVEGQKNIQEILSKQLYLCQFLTALKILRPNGSFVCKVFDLFTPFSVGLVYLMYKCFQQIAIIKPNSSRPANSERYLVCKYKRSDAE-TAGIVAYLNTVNLMLSDESQLDENDVLEIFNANELAEDEDFLRYIIDSNNAIGKKQIVGLRKIAAFAQNLELKETKQSEVRQECLKRWGLPDKLR 483          

HSP 2 Score: 68.9366 bits (167), Expect = 3.594e-91
Identity = 50/141 (35.46%), Postives = 72/141 (51.06%), Query Frame = 2
Query:   86 NDDYEPSAKIRKVE--SSNHNVGLNMMRKMGWEG-SGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIF-SASGIRMVSDDYDLNS---GEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            +++ EP+ K  K E   S  N  + MM+KMG+E   GLG  NQG +EP+ A     R G GLK +   ++     W    +E      +++    G R  +D Y L+      V GE+K T+D ET YCDPA+L  +L  K
Sbjct:    7 DENSEPTPKKIKREWVKSYSNKAMEMMKKMGYENDKGLGKSNQGRLEPIIAVQQDGRRGFGLKLD--TVQSSAGQWDPACEELEIPEPVLWLHNPGSR--ADAYSLDQLMGHLVTGEKKLTLDGETRYCDPAILHHILNAK 143          
BLAST of Cap methyltransferase 1 vs. Ensembl Fly
Match: aft (gene:FBgn0026309 transcript:FBtr0089549)

HSP 1 Score: 69.707 bits (169), Expect = 7.332e-12
Identity = 38/114 (33.33%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  904 VLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSD----TNRIENIRNFLYKVNSDL 1233
            V ADG  D +     QE +  +L+  + L A+ IL + GNF+ K+F +F   SV L++ ++ +F+ V I KP TS+  NSE Y++   +  D       +E I++ L + N  L
Sbjct:  231 VTADGSIDCAAQPDCQEEIVVRLFFAEVLSALRILSSGGNFLVKMFTLFEACSVSLLYTLNCIFEEVHIFKPATSKRGNSEVYVICLNYNKDHPDLPRLLEEIKSKLAQPNDTL 344          
BLAST of Cap methyltransferase 1 vs. Ensembl Fly
Match: CG5220 (gene:FBgn0038471 transcript:FBtr0083391)

HSP 1 Score: 65.0846 bits (157), Expect = 5.523e-11
Identity = 57/210 (27.14%), Postives = 88/210 (41.90%), Query Frame = 1
Query:  634 NEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRI--------ENIRNFLYKVNSDLN 1236
            N +    D+CA PG +++ +L ++   +C         D+    KII   ++   P  G     GDIT Q         + H  GN     V+ DG  DV+G   + E M  QL +     A  +L T G FV K+F    + +  L   +   F    I KP +SRP++ E ++V   F      I        ++IR    K  S++N
Sbjct:   40 NGVQRAVDLCAAPGSWSQ-VLSRKLYDTC------ETDDEKSAVKIIAVDLQAMAPIRGILQLQGDITKQSTAEAI---IGHFGGNEKAQLVVCDGAPDVTGVHEMDEYMQHQLLVAALSIATCVLETGGTFVAKIFK--GNATSLLSSQMQIFFKKFDIYKPPSSRPSSIEAFVVCSDFCLPEGYIPQVINPARDDIRLLAQKTGSEVN 237          
BLAST of Cap methyltransferase 1 vs. Ensembl Zebrafish
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:393102])

HSP 1 Score: 317.775 bits (813), Expect = 1.062e-96
Identity = 188/514 (36.58%), Postives = 283/514 (55.06%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI 2010
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E E+L+F D+CAGPGGF+E++LW+R+  + GFG TL+G +DFKL      P E F   YG+         T  EN++ F+  V+  T   G+H ++ADGGF V G E++QE++SKQL LCQFL A++++R  G+F+CK FD+FT FSVGLI+L+   F+ VS+ KP+TSRPANSERY+V K     T+    +R +++ +N  LN  + +D+DVI+V+   I+K D  F +++  SN    A QI  LAK++A++ D  L + RQ DIRKE  +LW IPD  R   +    +     F  L   ++ D     +F S  + +   N  + + V+       VGG     G    L  L + + Y  W         D +    +  L+ +  ++P  T+L V    E  G  K   + N+V V+D+ ++ G D+ +  +  R+  V      +    +  + PI
Sbjct:  209 ARTRSNPYETIRGAFFLNRAAMKMANMDHVFDYMFTNPKDSQGKVLTRDKEGELLYFGDVCAGPGGFSEYVLWRRRWHAKGFGMTLKGANDFKLEDFYAAPSELFEAYYGEGGIDGDGDITRPENISAFRNFVLDSTEGRGLHFLMADGGFSVEGQENLQEILSKQLLLCQFLTALSVVRPGGHFLCKTFDLFTPFSVGLIYLLYLCFERVSLFKPVTSRPANSERYVVCKGLKPGTD---AVREYMFTINLKLNQFRHSDRDVIEVVPLDIIKGDTDFFQYMIGSNESYCAVQIKALAKIHAYVRDTTLFEARQADIRKECLKLWGIPDKAR---VTPSTSDPKNKFYELVKGSEMD-----SFNSRPTALNSVNLEKLQHVL--DYRCIVGG-----GEQLFLLALGRSQIYT-W---------DGKAPSRWKKLENFKMELPRDTLLSVEIVQELKGEGKAQRRINAVHVLDALVLNGTDVRDQHFNQRIQMVEKFVKAVSKPSRPDMNPI 694          

HSP 2 Score: 57.3806 bits (137), Expect = 1.062e-96
Identity = 44/122 (36.07%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  137 HNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDE----DLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            +NV   +M KMG+ EG GLG   QG  E V AST   R GLGL  +    DL ++  D        E SA   + +       + D  +L     IGE+K  ID+E  +C   LL  +L+CK
Sbjct:   80 NNVSQKLMAKMGFREGEGLGKYGQGRKEIVEASTQRGRRGLGLMLKGFQGDLNVDWEDE------PEPSAIEQVSWFPESSPEIPDSDELRDWMTIGEKKLKIDDEIEFCSENLLHLLLRCK 195          
BLAST of Cap methyltransferase 1 vs. Ensembl Zebrafish
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:393102])

HSP 1 Score: 317.775 bits (813), Expect = 1.062e-96
Identity = 188/514 (36.58%), Postives = 283/514 (55.06%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI 2010
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E E+L+F D+CAGPGGF+E++LW+R+  + GFG TL+G +DFKL      P E F   YG+         T  EN++ F+  V+  T   G+H ++ADGGF V G E++QE++SKQL LCQFL A++++R  G+F+CK FD+FT FSVGLI+L+   F+ VS+ KP+TSRPANSERY+V K     T+    +R +++ +N  LN  + +D+DVI+V+   I+K D  F +++  SN    A QI  LAK++A++ D  L + RQ DIRKE  +LW IPD  R   +    +     F  L   ++ D     +F S  + +   N  + + V+       VGG     G    L  L + + Y  W         D +    +  L+ +  ++P  T+L V    E  G  K   + N+V V+D+ ++ G D+ +  +  R+  V      +    +  + PI
Sbjct:  209 ARTRSNPYETIRGAFFLNRAAMKMANMDHVFDYMFTNPKDSQGKVLTRDKEGELLYFGDVCAGPGGFSEYVLWRRRWHAKGFGMTLKGANDFKLEDFYAAPSELFEAYYGEGGIDGDGDITRPENISAFRNFVLDSTEGRGLHFLMADGGFSVEGQENLQEILSKQLLLCQFLTALSVVRPGGHFLCKTFDLFTPFSVGLIYLLYLCFERVSLFKPVTSRPANSERYVVCKGLKPGTD---AVREYMFTINLKLNQFRHSDRDVIEVVPLDIIKGDTDFFQYMIGSNESYCAVQIKALAKIHAYVRDTTLFEARQADIRKECLKLWGIPDKAR---VTPSTSDPKNKFYELVKGSEMD-----SFNSRPTALNSVNLEKLQHVL--DYRCIVGG-----GEQLFLLALGRSQIYT-W---------DGKAPSRWKKLENFKMELPRDTLLSVEIVQELKGEGKAQRRINAVHVLDALVLNGTDVRDQHFNQRIQMVEKFVKAVSKPSRPDMNPI 694          

HSP 2 Score: 57.3806 bits (137), Expect = 1.062e-96
Identity = 44/122 (36.07%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  137 HNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDE----DLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            +NV   +M KMG+ EG GLG   QG  E V AST   R GLGL  +    DL ++  D        E SA   + +       + D  +L     IGE+K  ID+E  +C   LL  +L+CK
Sbjct:   80 NNVSQKLMAKMGFREGEGLGKYGQGRKEIVEASTQRGRRGLGLMLKGFQGDLNVDWEDE------PEPSAIEQVSWFPESSPEIPDSDELRDWMTIGEKKLKIDDEIEFCSENLLHLLLRCK 195          
BLAST of Cap methyltransferase 1 vs. Ensembl Zebrafish
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:393102])

HSP 1 Score: 305.449 bits (781), Expect = 5.529e-93
Identity = 185/515 (35.92%), Postives = 278/515 (53.98%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYV-NWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI 2010
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E E+L+F D+CAGPGGF+E++LW+R+  + GFG TL+G +DFKL      P E F   YG+         T  EN++ F+  V+  T   G+H ++ADGGF V G E++QE++SKQL LCQFL A++++R  G+F+CK FD+FT FSVGLI+L+   F+ VS+ KP+TSRPANSERY+V K     T+    +R +++ +N  LN  + +D+DVI+V+   I+K D  F +++  SN    A QI  LAK++A++ D  L + RQ DIRKE  +LW   ++  D F    + P A N  S+N    Q  L    ++ IV                              G    L++LA  +  +  W         D +    +  L+ +  ++P  T+L V    E  G  K   + N+V V+D+ ++ G D+ +  +  R+  V      +    +  + PI
Sbjct:  209 ARTRSNPYETIRGAFFLNRAAMKMANMDHVFDYMFTNPKDSQGKVLTRDKEGELLYFGDVCAGPGGFSEYVLWRRRWHAKGFGMTLKGANDFKLEDFYAAPSELFEAYYGEGGIDGDGDITRPENISAFRNFVLDSTEGRGLHFLMADGGFSVEGQENLQEILSKQLLLCQFLTALSVVRPGGHFLCKTFDLFTPFSVGLIYLLYLCFERVSLFKPVTSRPANSERYVVCKGLKPGTD---AVREYMFTINLKLNQFRHSDRDVIEVVPLDIIKGDTDFFQYMIGSNESYCAVQIKALAKIHAYVRDTTLFEARQADIRKECLKLWGGSEM--DSF---NSRPTALN--SVNLEKLQHVLD---YRCIV------------------------------GGGEQLFLLALGRSQIYTW---------DGKAPSRWKKLENFKMELPRDTLLSVEIVQELKGEGKAQRRINAVHVLDALVLNGTDVRDQHFNQRIQMVEKFVKAVSKPSRPDMNPI 671          

HSP 2 Score: 57.3806 bits (137), Expect = 5.529e-93
Identity = 44/122 (36.07%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  137 HNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDE----DLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            +NV   +M KMG+ EG GLG   QG  E V AST   R GLGL  +    DL ++  D        E SA   + +       + D  +L     IGE+K  ID+E  +C   LL  +L+CK
Sbjct:   80 NNVSQKLMAKMGFREGEGLGKYGQGRKEIVEASTQRGRRGLGLMLKGFQGDLNVDWEDE------PEPSAIEQVSWFPESSPEIPDSDELRDWMTIGEKKLKIDDEIEFCSENLLHLLLRCK 195          
BLAST of Cap methyltransferase 1 vs. Ensembl Zebrafish
Match: cmtr2 (cap methyltransferase 2 [Source:NCBI gene;Acc:406742])

HSP 1 Score: 82.4185 bits (202), Expect = 1.128e-15
Identity = 68/233 (29.18%), Postives = 106/233 (45.49%), Query Frame = 1
Query:  805 YGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKV--NSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELW----KIPDLKRDHFLC 1485
            +G  + GDI  Q++L +    V   +    V  V ADG FD  G    QE +   L  C+ +CA+ +L T G+FV K+F +F   SV L++L++  F +V+I KP TS+  NSE YIV  C   D    E IR  L K+  N   +L         + I ++ L + ++   F +      + E       L  F+        R   +R+ A E +     +  L R  ++C
Sbjct:  206 FGSDNTGDIMLQKHLLELPRFV---SNMRSVDLVTADGSFDCQGDPGEQERLVAPLQHCEAICALLLLGTGGSFVLKMFTLFEHSSVCLLYLLACCFRSVNIFKPGTSKSGNSELYIV--CL--DYQAKEQIRPLLSKLIRNYGPDLASTASLFPRRCIPDSFLSQHEEICTFFQALQVNTIQE------NLRLFVCMSTEQRRRLEQLREYAAEFYTKRFSVQYLPRKSWVC 425          
BLAST of Cap methyltransferase 1 vs. Ensembl Zebrafish
Match: ftsj1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-041114-83])

HSP 1 Score: 69.707 bits (169), Expect = 2.885e-12
Identity = 57/210 (27.14%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  655 DICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLF---DIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFL--YKVNSDLNLCKGTDQDVI 1266
            D+CA PG +++ +  K           LRGKD  +  KI+   ++   P  G     GDIT    ++  +  + H  G      V+ DG  DV+G   + E +  QL L       ++L+  GNFV K+F   D+   +S   IF     F  V+  KP +SR ++ E ++V + ++     + N+ N L  +  + DLN  +G ++ ++
Sbjct:   47 DLCAAPGSWSQVLSRK-----------LRGKDKSEEVKIVAVDLQAMAPLPGVTQIQGDITK---ISTAEEIIRHFEGE-SADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGNFVAKIFRGKDVTLLYSQLKIF-----FSFVTCAKPPSSRNSSIEAFVVCQNYSPPEGYVPNMSNPLLDHSYDVDLNQLEGPNRIIV 236          
BLAST of Cap methyltransferase 1 vs. Ensembl Xenopus
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:100170565])

HSP 1 Score: 322.013 bits (824), Expect = 1.412e-97
Identity = 158/333 (47.45%), Postives = 221/333 (66.37%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E+E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL      P E F P YG+         T  EN+T F+  ++  T + GVH ++ADGGF V G E+IQE++SKQL LCQFL  ++++RT G+F+CK FD+FT FSVGLI+L+   F+ + + KP+TSRPANSERY+V +        I+++RN+L+ VN  LN  + +DQDV  V+   +L+ D+QF  ++  SN      QI  LAK++AF+ D  LS+ RQ DIRKE  +LW IPD  R
Sbjct:  194 ARTRSNPYEMIRGAFFLNRAAMKMANVDHVFDYMFTNPKDSHGRPKLKDKESELLYFADVCAGPGGFSEYVLWRKKWHTKGFGMTLKGPNDFKLEDFYAAPSELFEPYYGEGGVDGDGDVTRPENITAFRNFILDNTEHKGVHFMMADGGFSVEGQENIQEILSKQLLLCQFLVGLSVVRTGGHFICKTFDLFTPFSVGLIYLLYCCFERICLFKPLTSRPANSERYVVCRGLKEG---IDDVRNYLFTVNRRLNHLRDSDQDVSLVVPMEVLRGDRQFYDYMVRSNESHCEVQIKALAKIHAFVQDSTLSEPRQADIRKECLKLWGIPDQAR 523          
BLAST of Cap methyltransferase 1 vs. Ensembl Xenopus
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:100170565])

HSP 1 Score: 321.242 bits (822), Expect = 3.238e-97
Identity = 158/333 (47.45%), Postives = 221/333 (66.37%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E+E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL      P E F P YG+         T  EN+T F+  ++  T + GVH ++ADGGF V G E+IQE++SKQL LCQFL  ++++RT G+F+CK FD+FT FSVGLI+L+   F+ + + KP+TSRPANSERY+V +        I+++RN+L+ VN  LN  + +DQDV  V+   +L+ D+QF  ++  SN      QI  LAK++AF+ D  LS+ RQ DIRKE  +LW IPD  R
Sbjct:  218 ARTRSNPYEMIRGAFFLNRAAMKMANVDHVFDYMFTNPKDSHGRPKLKDKESELLYFADVCAGPGGFSEYVLWRKKWHTKGFGMTLKGPNDFKLEDFYAAPSELFEPYYGEGGVDGDGDVTRPENITAFRNFILDNTEHKGVHFMMADGGFSVEGQENIQEILSKQLLLCQFLVGLSVVRTGGHFICKTFDLFTPFSVGLIYLLYCCFERICLFKPLTSRPANSERYVVCRGLKEG---IDDVRNYLFTVNRRLNHLRDSDQDVSLVVPMEVLRGDRQFYDYMVRSNESHCEVQIKALAKIHAFVQDSTLSEPRQADIRKECLKLWGIPDQAR 547          

HSP 2 Score: 56.225 bits (134), Expect = 3.238e-97
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V  S    R GLG+  +  G EK   +  +   EA+A  ++ +       + D  +L+    + +RK  ID+ET +C  +LL  +L+CK
Sbjct:   86 SMYNSVSQKLMAKMGFREGEGLGKFGQGRKEIVETSKQKGRRGLGMVLK--GFEKELNINWRTEPEATAYEEVDWFPECTTEIPDADELSDWMTVEKRKLIIDDETEFCRDSLLTNLLECK 204          
BLAST of Cap methyltransferase 1 vs. Ensembl Xenopus
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:100170565])

HSP 1 Score: 321.242 bits (822), Expect = 1.610e-96
Identity = 158/333 (47.45%), Postives = 221/333 (66.37%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E+E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL      P E F P YG+         T  EN+T F+  ++  T + GVH ++ADGGF V G E+IQE++SKQL LCQFL  ++++RT G+F+CK FD+FT FSVGLI+L+   F+ + + KP+TSRPANSERY+V +        I+++RN+L+ VN  LN  + +DQDV  V+   +L+ D+QF  ++  SN      QI  LAK++AF+ D  LS+ RQ DIRKE  +LW IPD  R
Sbjct:  226 ARTRSNPYEMIRGAFFLNRAAMKMANVDHVFDYMFTNPKDSHGRPKLKDKESELLYFADVCAGPGGFSEYVLWRKKWHTKGFGMTLKGPNDFKLEDFYAAPSELFEPYYGEGGVDGDGDVTRPENITAFRNFILDNTEHKGVHFMMADGGFSVEGQENIQEILSKQLLLCQFLVGLSVVRTGGHFICKTFDLFTPFSVGLIYLLYCCFERICLFKPLTSRPANSERYVVCRGLKEG---IDDVRNYLFTVNRRLNHLRDSDQDVSLVVPMEVLRGDRQFYDYMVRSNESHCEVQIKALAKIHAFVQDSTLSEPRQADIRKECLKLWGIPDQAR 555          

HSP 2 Score: 51.6026 bits (122), Expect = 6.208e-6
Identity = 43/131 (32.82%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMV----------SDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V  S    R GLG+  +  G EK   +  +   E SA    +F A+    V           D  +L+    + +RK  ID+ET +C  +LL  +L+CK
Sbjct:   86 SMYNSVSQKLMAKMGFREGEGLGKFGQGRKEIVETSKQKGRRGLGMVLK--GFEKELNINWRTEPEVSALS--VFQATAYEEVDWFPECTTEIPDADELSDWMTVEKRKLIIDDETEFCRDSLLTNLLECK 212          
BLAST of Cap methyltransferase 1 vs. Ensembl Xenopus
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:100170565])

HSP 1 Score: 314.309 bits (804), Expect = 4.009e-95
Identity = 154/323 (47.68%), Postives = 217/323 (67.18%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN-------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELW 1449
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++       E+E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL      P E F P YG+         T  EN+T F+  ++  T + GVH ++ADGGF V G E+IQE++SKQL LCQFL  ++++RT G+F+CK FD+FT FSVGLI+L+   F+ + + KP+TSRPANSERY+V +        I+++RN+L+ VN  LN  + +DQDV  V+   +L+ D+QF  ++  SN      QI  LAK++AF+ D  LS+ RQ DIRKE  +LW
Sbjct:  218 ARTRSNPYEMIRGAFFLNRAAMKMANVDHVFDYMFTNPKDSHGLKDKESELLYFADVCAGPGGFSEYVLWRKKWHTKGFGMTLKGPNDFKLEDFYAAPSELFEPYYGEGGVDGDGDVTRPENITAFRNFILDNTEHKGVHFMMADGGFSVEGQENIQEILSKQLLLCQFLVGLSVVRTGGHFICKTFDLFTPFSVGLIYLLYCCFERICLFKPLTSRPANSERYVVCRGLKEG---IDDVRNYLFTVNRRLNHLRDSDQDVSLVVPMEVLRGDRQFYDYMVRSNESHCEVQIKALAKIHAFVQDSTLSEPRQADIRKECLKLW 537          

HSP 2 Score: 56.225 bits (134), Expect = 4.009e-95
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V  S    R GLG+  +  G EK   +  +   EA+A  ++ +       + D  +L+    + +RK  ID+ET +C  +LL  +L+CK
Sbjct:   86 SMYNSVSQKLMAKMGFREGEGLGKFGQGRKEIVETSKQKGRRGLGMVLK--GFEKELNINWRTEPEATAYEEVDWFPECTTEIPDADELSDWMTVEKRKLIIDDETEFCRDSLLTNLLECK 204          
BLAST of Cap methyltransferase 1 vs. Ensembl Xenopus
Match: CMTR2 (cap methyltransferase 2 [Source:NCBI gene;Acc:100496665])

HSP 1 Score: 75.0998 bits (183), Expect = 3.303e-13
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 1
Query:  805 YGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIV 1158
            +G  + GDI   + L   Q  + + +    VH V ADG FD  G    QE +   L+ C+ +  +  L   G+FV K+F +F   S+ L++L++  F  V IIKP TS+  NSE Y+V
Sbjct:  184 FGPDNTGDIMTIKYLNGLQQFISNMSA---VHLVTADGSFDCQGDPGEQESLVSPLHYCEVVTCLLTLSKGGSFVLKMFTLFQHSSINLMYLLNCCFSEVHIIKPGTSKAGNSEVYVV 298          
BLAST of Cap methyltransferase 1 vs. Ensembl Mouse
Match: Cmtr1 (cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1921407])

HSP 1 Score: 309.686 bits (792), Expect = 2.195e-94
Identity = 158/333 (47.45%), Postives = 218/333 (65.47%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKI----------ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+R+NPYE I   FFLNRAAMKMAN+D + D +FT            E++ ++L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+        IT  EN+  F+  V+  T   GVH V+ADGGF V G E++QE++SKQL LCQFL A++++RT G+FVCK FD+FT FSVGLI+L+   F+ V + KPITSRPANSERY+V K        I+++R +L+ VN  LN  + T+ DV  V+   ++K D +F  ++  SN    + QI  LAK++AF+ D  LS+ RQ +IRKE  +LWKIPD  R
Sbjct:  216 ARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPLDSSGKPLLKESDIDLLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGVDGDGDITRPENINAFRNFVLDNTDRKGVHFVMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFVCKTFDLFTPFSVGLIYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVG---IDDVREYLFSVNIKLNQLRNTESDVNLVVPLMVIKGDHEFNDYMIRSNESYCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLQLWKIPDQAR 545          

HSP 2 Score: 58.151 bits (139), Expect = 2.195e-94
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG  +QG  + V  S    R GLGL  +  G ++   V  +   E +A   + +       + D  +++   V+G+RK  I++ET +C   LL  MLKCK
Sbjct:   84 SMYNSVSQRLMAKMGFREGEGLGKYSQGRKDIVETSNQKGRRGLGLTLQ--GFDQELNVDWRDEPEPNACEQVSWFPECTTEIPDSREMSDWMVVGKRKMVIEDETEFCGEELLHSMLKCK 202          
BLAST of Cap methyltransferase 1 vs. Ensembl Mouse
Match: Cmtr1 (cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1921407])

HSP 1 Score: 309.301 bits (791), Expect = 2.231e-94
Identity = 158/333 (47.45%), Postives = 218/333 (65.47%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKI----------ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+R+NPYE I   FFLNRAAMKMAN+D + D +FT            E++ ++L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+        IT  EN+  F+  V+  T   GVH V+ADGGF V G E++QE++SKQL LCQFL A++++RT G+FVCK FD+FT FSVGLI+L+   F+ V + KPITSRPANSERY+V K        I+++R +L+ VN  LN  + T+ DV  V+   ++K D +F  ++  SN    + QI  LAK++AF+ D  LS+ RQ +IRKE  +LWKIPD  R
Sbjct:  216 ARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPLDSSGKPLLKESDIDLLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGVDGDGDITRPENINAFRNFVLDNTDRKGVHFVMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFVCKTFDLFTPFSVGLIYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVG---IDDVREYLFSVNIKLNQLRNTESDVNLVVPLMVIKGDHEFNDYMIRSNESYCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLQLWKIPDQAR 545          

HSP 2 Score: 58.151 bits (139), Expect = 2.231e-94
Identity = 41/125 (32.80%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLK----DEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG  +QG  + V  S    R GLGL     D++L ++  D        E +A   + +       + D  +++   V+G+RK  I++ET +C   LL  MLKCK
Sbjct:   84 SMYNSVSQRLMAKMGFREGEGLGKYSQGRKDIVETSNQKGRRGLGLTLQGFDQELNVDWRDE------PEPNACEQVSWFPECTTEIPDSREMSDWMVVGKRKMVIEDETEFCGEELLHSMLKCK 202          
BLAST of Cap methyltransferase 1 vs. Ensembl Mouse
Match: Cmtr1 (cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1921407])

HSP 1 Score: 168.703 bits (426), Expect = 1.356e-45
Identity = 80/161 (49.69%), Postives = 113/161 (70.19%), Query Frame = 1
Query:  625 ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFD 1098
            E++ ++L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+        IT  EN+  F+  V+  T   GVH V+ADGGF V G E++QE++SKQL LCQFL A++++RT G+FVCK FD+FT FSVGLI+L+   F+
Sbjct:  208 ESDIDLLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGVDGDGDITRPENINAFRNFVLDNTDRKGVHFVMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFVCKTFDLFTPFSVGLIYLLYCCFE 368          

HSP 2 Score: 57.7658 bits (138), Expect = 3.325e-8
Identity = 40/125 (32.00%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCKINMI 499
            S  ++V   +M KMG+ EG GLG  +QG  + V  S    R GLGL  +  G ++   V  +   E +A   + +       + D  +++   V+G+RK  I++ET +C   LL  MLKCK  ++
Sbjct:   84 SMYNSVSQRLMAKMGFREGEGLGKYSQGRKDIVETSNQKGRRGLGLTLQ--GFDQELNVDWRDEPEPNACEQVSWFPECTTEIPDSREMSDWMVVGKRKMVIEDETEFCGEELLHSMLKCKKPLL 206          
BLAST of Cap methyltransferase 1 vs. Ensembl Mouse
Match: Cmtr1 (cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1921407])

HSP 1 Score: 150.214 bits (378), Expect = 1.712e-41
Identity = 75/165 (45.45%), Postives = 107/165 (64.85%), Query Frame = 1
Query:  574 MKMANLDSICDNIFTKI----------ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFV 1029
            MKMAN+D + D +FT            E++ ++L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+        IT  EN+  F+  V+  T   GVH V+ADGGF V G E++QE++SKQL LCQFL A++++RT G+FV
Sbjct:    1 MKMANMDFVFDRMFTNPLDSSGKPLLKESDIDLLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGVDGDGDITRPENINAFRNFVLDNTDRKGVHFVMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFV 165          
BLAST of Cap methyltransferase 1 vs. Ensembl Mouse
Match: Cmtr1 (cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1921407])

HSP 1 Score: 118.242 bits (295), Expect = 2.110e-30
Identity = 56/122 (45.90%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  499 NFLDG------RSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTK----------IENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKA 816
            + LDG      R+R+NPYE I   FFLNRAAMKMAN+D + D +FT            E++ ++L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+ 
Sbjct:   25 DILDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPLDSSGKPLLKESDIDLLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEG 146          
BLAST of Cap methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q6GQ76|CMTR1_XENLA (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Xenopus laevis OX=8355 GN=cmtr1 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.099e-97
Identity = 158/333 (47.45%), Postives = 222/333 (66.67%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E+E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL      P E F P YG+         T  EN+T F+  ++  T + GVH ++ADGGF V G E+IQE++SKQL LCQFL  ++++RT G+F+CK FD+FT FSVGLI+L+   F+ V + KP+TSRPANSERY+V +        I+++RN+L+ VN  LN  + +DQDV  V+   +L+ DKQF +++  SN      QI  LAK++AF+ D  LS+ RQ DIR+E  +LW +PD  R
Sbjct:  217 ARTRSNPYEMIRGVFFLNRAAMKMANIDHVFDYMFTNPKDSQGKPKLKDKESELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYAAPSELFEPYYGEGGVDGDGDVTRPENITAFRNFILDNTDHKGVHFMMADGGFSVEGQENIQEILSKQLLLCQFLVGLHVIRTGGHFICKTFDLFTPFSVGLIYLLYCCFERVCLFKPLTSRPANSERYVVCRGLKEG---IDDVRNYLFNVNRRLNHLRNSDQDVTLVVPLEVLRGDKQFNEYMVRSNESCCEVQIKALAKIHAFVQDSTLSESRQADIRRECLKLWGVPDQAR 546          

HSP 2 Score: 60.077 bits (144), Expect = 1.099e-97
Identity = 41/121 (33.88%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V  S    R GLG+  +  G EK   +  +   EA+A  ++ +       + D  +L+   ++G+RK  ID+ET +C   LL  +L+CK
Sbjct:   85 SMYNSVSQKLMAKMGFREGEGLGKFGQGRKEIVETSKQKGRRGLGMVLK--GFEKELNINWRSEPEATAYEEVDWFPECTTDIPDSDELSDWMIVGKRKLIIDDETEFCRDNLLTSLLQCK 203          
BLAST of Cap methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q803R5|CMTR1_DANRE (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Danio rerio OX=7955 GN=cmtr1 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 6.717e-96
Identity = 188/514 (36.58%), Postives = 283/514 (55.06%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI 2010
             R+RSNPYE I   FFLNRAAMKMAN+D + D +FT  ++          E E+L+F D+CAGPGGF+E++LW+R+  + GFG TL+G +DFKL      P E F   YG+         T  EN++ F+  V+  T   G+H ++ADGGF V G E++QE++SKQL LCQFL A++++R  G+F+CK FD+FT FSVGLI+L+   F+ VS+ KP+TSRPANSERY+V K     T+    +R +++ +N  LN  + +D+DVI+V+   I+K D  F +++  SN    A QI  LAK++A++ D  L + RQ DIRKE  +LW IPD  R   +    +     F  L   ++ D     +F S  + +   N  + + V+       VGG     G    L  L + + Y  W         D +    +  L+ +  ++P  T+L V    E  G  K   + N+V V+D+ ++ G D+ +  +  R+  V      +    +  + PI
Sbjct:  209 ARTRSNPYETIRGAFFLNRAAMKMANMDHVFDYMFTNPKDSQGKVLTRDKEGELLYFGDVCAGPGGFSEYVLWRRRWHAKGFGMTLKGANDFKLEDFYAAPSELFEAYYGEGGIDGDGDITRPENISAFRNFVLDSTEGRGLHFLMADGGFSVEGQENLQEILSKQLLLCQFLTALSVVRPGGHFLCKTFDLFTPFSVGLIYLLYLCFERVSLFKPVTSRPANSERYVVCKGLKPGTD---AVREYMFTINLKLNQFRHSDRDVIEVVPLDIIKGDTDFFQYMIGSNESYCAVQIKALAKIHAYVRDTTLFEARQADIRKECLKLWGIPDKAR---VTPSTSDPKNKFYELVKGSEMD-----SFNSRPTALNSVNLEKLQHVL--DYRCIVGG-----GEQLFLLALGRSQIYT-W---------DGKAPSRWKKLENFKMELPRDTLLSVEIVQELKGEGKAQRRINAVHVLDALVLNGTDVRDQHFNQRIQMVEKFVKAVSKPSRPDMNPI 694          

HSP 2 Score: 57.3806 bits (137), Expect = 6.717e-96
Identity = 44/122 (36.07%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  137 HNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDE----DLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            +NV   +M KMG+ EG GLG   QG  E V AST   R GLGL  +    DL ++  D        E SA   + +       + D  +L     IGE+K  ID+E  +C   LL  +L+CK
Sbjct:   80 NNVSQKLMAKMGFREGEGLGKYGQGRKEIVEASTQRGRRGLGLMLKGFQGDLNVDWEDE------PEPSAIEQVSWFPESSPEIPDSDELRDWMTIGEKKLKIDDEIEFCSENLLHLLLRCK 195          
BLAST of Cap methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q5U2Z5|CMTR1_RAT (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Cmtr1 PE=1 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.778e-94
Identity = 158/333 (47.45%), Postives = 219/333 (65.77%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKI----------ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+R+NPYE I   FFLNRAAMKMAN+D + D +FT            E++ ++L+FAD+CAGPGGF+E++LW+R+  + GFG TL+G +DFKL        E F P YG+        IT  EN+  F+  V+  T   GVH V+ADGGF V G E++QE++SKQL LCQFL A++++RT G+FVCK FD+FT FSVGLI+L+   F+ V + KP+TSRPANSERY+V K        I+++R +L+ VN  LN  + TD DV  V+  +++K D +F  ++  SN    + QI  LAK++AF+ D  LS+ RQ +IRKE  +LW+IPD  R
Sbjct:  216 ARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPLDSSGKPLLKESDIDLLYFADVCAGPGGFSEYVLWRRKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGVDGDGDITRPENINAFRNFVLDNTDRKGVHFVMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFVCKTFDLFTPFSVGLIYLLYCCFERVCLFKPVTSRPANSERYVVCKGLKVG---IDDVREYLFSVNIQLNQLRNTDSDVNLVVPLSVIKGDHEFNDYMIRSNESYCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLQLWEIPDRAR 545          

HSP 2 Score: 57.7658 bits (138), Expect = 3.778e-94
Identity = 41/125 (32.80%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLK----DEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG  +QG  + V  S    R GLGL     D++L ++  D        E +A   + +       + D  +++   V+G+RK  I++ET +C   LL  MLKCK
Sbjct:   84 SMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVETSNQKGRRGLGLTLQGFDQELNVDWRDE------PEPNACEQVSWFPECTTEIPDSREMSDWMVVGKRKMVIEDETEFCGEELLHSMLKCK 202          
BLAST of Cap methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q9DBC3|CMTR1_MOUSE (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Mus musculus OX=10090 GN=Cmtr1 PE=1 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.336e-93
Identity = 158/333 (47.45%), Postives = 218/333 (65.47%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKI----------ENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+R+NPYE I   FFLNRAAMKMAN+D + D +FT            E++ ++L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+        IT  EN+  F+  V+  T   GVH V+ADGGF V G E++QE++SKQL LCQFL A++++RT G+FVCK FD+FT FSVGLI+L+   F+ V + KPITSRPANSERY+V K        I+++R +L+ VN  LN  + T+ DV  V+   ++K D +F  ++  SN    + QI  LAK++AF+ D  LS+ RQ +IRKE  +LWKIPD  R
Sbjct:  216 ARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPLDSSGKPLLKESDIDLLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGVDGDGDITRPENINAFRNFVLDNTDRKGVHFVMADGGFSVEGQENLQEILSKQLLLCQFLMALSVVRTGGHFVCKTFDLFTPFSVGLIYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVG---IDDVREYLFSVNIKLNQLRNTESDVNLVVPLMVIKGDHEFNDYMIRSNESYCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLQLWKIPDQAR 545          

HSP 2 Score: 58.151 bits (139), Expect = 1.336e-93
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG  +QG  + V  S    R GLGL  +  G ++   V  +   E +A   + +       + D  +++   V+G+RK  I++ET +C   LL  MLKCK
Sbjct:   84 SMYNSVSQRLMAKMGFREGEGLGKYSQGRKDIVETSNQKGRRGLGLTLQ--GFDQELNVDWRDEPEPNACEQVSWFPECTTEIPDSREMSDWMVVGKRKMVIEDETEFCGEELLHSMLKCK 202          
BLAST of Cap methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q5R981|CMTR1_PONAB (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Pongo abelii OX=9601 GN=CMTR1 PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 3.143e-93
Identity = 156/333 (46.85%), Postives = 216/333 (64.86%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDI---TNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+R+NPYE I   FFLNRAAMKMAN+D + D +FT   +          E E+L+FAD+CAGPGGF+E++LW+++  + GFG TL+G +DFKL        E F P YG+         T  EN++ F+  V+  T   GVH ++ADGGF V G E++QE++SKQL LCQFL A++I+RT G+F+CK FD+FT FSVGL++L+   F+ V + KPITSRPANSERY+V K        I+++R++L+ VN  LN  + TD DV  V+   ++K D +F  ++  SN    + QI  LAK++AF+ D  LS+ RQ +IRKE   LW IPD  R
Sbjct:  217 ARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVG---IDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQAR 546          

HSP 2 Score: 58.151 bits (139), Expect = 3.143e-93
Identity = 41/125 (32.80%), Postives = 65/125 (52.00%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLK----DEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG  +QG  + V AS+   R GLGL     D++L ++  D        E SA   + +       + D  +++   V+G+RK  I++ET +C   LL  +L+CK
Sbjct:   85 SMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDE------PEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK 203          
BLAST of Cap methyltransferase 1 vs. TrEMBL
Match: A0A2R5L812 (Putative ftsj-like rna methyltransferase (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 8.779e-105
Identity = 213/570 (37.37%), Postives = 309/570 (54.21%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENE--------ILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKG--TDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLN------FHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYV-NWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLD-PKLKGLI--RPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTD----HFYSLGKLL 2145
             R+RSNP+E I  G F NRAAMKMAN+D+  D +FT   +++         +L+FAD+CAGPGGF+E++LW++  Q+ GFGFTL+G +DFKL +   GP + F P YG   DGD+   ENL  F   V   T   GVH V+ADGGF V G E+IQE++SK+LYLCQF  A++ILRT G+FVCKLFDIFT FSVGL++L+   F +V I KP TSRPANSERYIV K    DT   ++I++++Y++           +D D+  V+   IL  D+ F K+IK+SN ++   Q++ L+K+ AF  + NL +ERQ ++RKE  ELWK+PD  R H    KA   +  F  L       F +K  +L  A  + + S             V ++     G     D  N A Y L   +KYV  W    Q+     + N++ D L     ++P+ T+       E  G  +   + N++ V+D+ ++  + I +  Y+DR+  ++     +  P    LI  R  + F   D      R     +  G    ++  C+  +    HFY  G LL
Sbjct:  257 ARTRSNPFETIRGGIFQNRAAMKMANIDAAFDFMFTDPRDQDGESLVASEGLLYFADVCAGPGGFSEYVLWRKGWQAKGFGFTLKGPNDFKLEEFFAGPPDTFQPYYGVTGDGDVFVPENLRSFSKFVKDNTDGGGVHFVMADGGFSVEGQENIQEILSKRLYLCQFCAALSILRTGGHFVCKLFDIFTPFSVGLVYLMYRAFRHVCIFKPNTSRPANSERYIVCKWRRQDT---KDIQDYMYELCCRFEKISSVTSDDDITDVVPLEILNDDQDFFKYIKDSNEELGRLQVVHLSKIKAFAQNANLYEERQSNLRKECLELWKVPDQARAH---PKAGNPSAKFKELTKNDTSYFDSKPGELTDAQLRKMKS-------------VYDYRCLVCGEGKPPD--NKAFY-LGLGRKYVYQWSGNPQE-----KWNKVTDSL-----ELPADTLFYGETVQELEGEGRHQKRLNTIHVIDALVLGKKVIKDEHYDDRIRWINKFVKAISKPNRHDLIPLRVKEVFRFEDAGSMFERLCMKLEKGGARNMRLSYCLPQEEEEKHFYPSGMLL 794          

HSP 2 Score: 66.6254 bits (161), Expect = 8.779e-105
Identity = 41/121 (33.88%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  131 SNHNVGLNMMRKMGWE-GSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIE-KPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  +V L +M+ MG++ G GLG   QG+ + + AS    R GLGL  +  G E +PD  W    ++     ++ +         D  +L      G +K TID+ETT+CDP +L E++ CK
Sbjct:  125 SYSSVSLKLMKSMGYKSGKGLGKSGQGITDIIEASKQRGRRGLGLIVD--GFEPRPDVEWDFTKEKIDIREEIKWLPECTEDPPDIKELRQWPTEGAKKLTIDDETTFCDPEILGEIISCK 243          

HSP 3 Score: 34.6538 bits (78), Expect = 8.779e-105
Identity = 15/45 (33.33%), Postives = 24/45 (53.33%), Query Frame = 2
Query: 2210 PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDW 2344
            PW   VSR    TYYYN+ + +S++E+P +  A +       + W
Sbjct:  801 PWYEQVSRSSKKTYYYNMSNGKSIYERPTSAVADFKSCFTTSLVW 845          
BLAST of Cap methyltransferase 1 vs. TrEMBL
Match: A0A1S3K135 (cap-specific mRNA (Nucleoside-2'-O-)-methyltransferase 1 OS=Lingula unguis OX=7574 GN=LOC106177770 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 4.454e-104
Identity = 206/559 (36.85%), Postives = 308/559 (55.10%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENE--------NEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLN-LCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLK--PAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYV-NWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI---DYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTD-HFYSLG 2136
             R+RSNPYE I    FLNRAA+KMAN+D++ D +FT  ++         NE+L+FAD+CAGPGGF+E++LW+++  + GFGFTL+G  DFKL   +  P E F P YG  DDGDI   ENL   Q  V+  T N GVH V+ADGGF V G E+IQE++SK+LYLCQFL A+ +LR  G+FVCKLFDIFT +SVGL++L+   F++V+I KP+TSRPANSERYIV K    D    + + +++Y +N  L  +   +D D+I+V+ + +++ D +F+ +I  SN+ +  +Q + LAK+ AF  + +L +ERQ  +R E  E W+IPD  R     A        F  L      D  K  PA          + N ++  F  R ++   VGG       N  L++L+  + ++  W         D RP   +  L++   ++P  T+L      E  G  KG  K  +  V+D+  I G+DI +  +  R+ ++      L    +  + P+   D +   +I +     + +K  KG    ++  C  +  HF   G
Sbjct:  188 ARTRSNPYETIRGAIFLNRAAVKMANMDAVLDFMFTNPKDREGRSVVGPNELLYFADVCAGPGGFSEYILWRKKWHAKGFGFTLKGPCDFKLEDFLAAPSEMFEPYYGVNDDGDIYRPENLISLQKFVLENTNNKGVHFVMADGGFSVEGQENIQEILSKRLYLCQFLAALMLLRDGGHFVCKLFDIFTAYSVGLVYLMYKAFEHVAIFKPVTSRPANSERYIVCKYKRQDA---QAVTDYMYHINLALEKMGSTSDNDIIEVVPDNVMRSDHKFVDYIITSNDNLGIKQALNLAKIQAFAKNPDLYEERQSLMRAECLETWQIPDSVR---TAASKVEAKTKFKELIKGENTDYFKHTPAVLDQT-----KLNCMKSVFDYRCYV---VGG-------NQRLFLLSLGRAHIYKW---------DGRPETPWRKLEEIKLELPKDTLLEGELVQELKGEGKGQRKLMTFHVLDAMFICGDDIRQEHFNVRIEKLRLFVKALSKPSRSDLAPVRVKDIYRFEEISELFDS-LEMKSVKGSSFPRLCYCNSSGCHFLPSG 715          

HSP 2 Score: 66.2402 bits (160), Expect = 4.454e-104
Identity = 49/131 (37.40%), Postives = 70/131 (53.44%), Query Frame = 2
Query:  101 PSAKIRKVESSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKP-DTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            P+ K +  E S+      MM KMG+ EGSGLG   QG ++PV AS    R GLGL+   LG  +P D  W    ++ SA   + +  S    V     + S    G++K TID+ET +C  ++L ++LKCK
Sbjct:   51 PTKKKKGAEYSSK--AQKMMAKMGYKEGSGLGLNKQGRVDPVEASKQRGRRGLGLQ---LGAFEPADVEW--SWEDVSAKETVEWMPSCTDPVPSIDTMESWMREGKKKLTIDDETQFCTESVLQDVLKCK 174          

HSP 3 Score: 30.0314 bits (66), Expect = 4.454e-104
Identity = 13/45 (28.89%), Postives = 22/45 (48.89%), Query Frame = 2
Query: 2210 PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDW 2344
            PW+++ SR     YY+N  + ES+F  P    A    + +  + W
Sbjct:  725 PWVMSFSRSSNRKYYFNKKNGESMFATPPESIADVRDTLLQRVFW 769          
BLAST of Cap methyltransferase 1 vs. TrEMBL
Match: A0A3S1BYJ7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013975 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 9.203e-103
Identity = 210/539 (38.96%), Postives = 303/539 (56.22%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENEN--------EILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD---DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLN--LCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAEN-FLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYV-NWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLL----DPKLKGLIRPIDYFPLSDIKDHVSRYISVK 2067
             R+RSNPYE I   FFLNRAAMKMAN+D++ D +FT  +  N        E+L+FAD+CAGPGGF+E++LW+ + +S GFG TL+G +DFK+     GP E F P YG      DGD+ N +N TKF+  V+  T   GVH V+ADGGF V G E+IQE++SKQLYLCQFL A++ILRT G+FVCKLFD+FT FSVGL++L++ +FD V+I KP+TSRPANSERYI  K    +    ++++++++ +N DLN  +   + +DV  ++   IL  DK F ++I ESN  +   Q I L K+  F  +  L + RQ D+R +  E WKIPD  R     A   P     F SL     Q+      F++   P+      + K  + ++     G  P       + Y+L   +  V  W         D R    +  L  +  ++PS T+L V    E  G  KG  +  ++ VVD+  + GED+   S+E+R  ++S     L       L  L +P+  FPL  +K H+   +S++
Sbjct:  200 ARTRSNPYETIRGAFFLNRAAMKMANMDAVFDFMFTSPKQSNGEPLVGPEELLYFADVCAGPGGFSEYVLWRTKGESKGFGMTLKGNNDFKVEDFFAGPPEMFEPHYGVGGIEGDGDVFNVKNQTKFRNFVLESTDGKGVHFVMADGGFSVEGQENIQEILSKQLYLCQFLVAVSILRTGGHFVCKLFDLFTPFSVGLVYLMNMIFDQVAIFKPVTSRPANSERYIACKGLRPNK---QSVQHYMHLINVDLNKYMTAVSTEDVNDIVPLEILTNDKPFFEYILESNESLAKLQAISLKKIETFTRNSQLHESRQSDVRSKCLEKWKIPDRVR----AAPGRPDPNTMFRSLVNDEAQE-----MFEATGEPLGLETLEKIK-CLSSYRCMVRGDGP-------SYYLLGCGRSSVFKW---------DGRQKSKWQKLDGFRVELPSKTLLEVQAVTELRGEGKGQRRQTTLHVVDAFFLCGEDVRSKSFEERQRKLSKFVKALRKPTRSDLTQLFKPVT-FPLDRVK-HIFENLSMR 707          
BLAST of Cap methyltransferase 1 vs. TrEMBL
Match: L7MEE7 (Putative ftsj-like rna methyltransferase (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.666e-101
Identity = 214/573 (37.35%), Postives = 307/573 (53.58%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENEN--------EILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDL-NLCKGTDQ-DVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLN------FHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI---DYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCI--------KTDHFYSLGKLL 2145
             R+RSNP+E I  G FLNRAAMKMAN+DS  D +FT   +EN        ++L+FAD+CAGPGGF+E++LW++  Q+ GFGFTL+G +DFKL     G  + F P YG  DDGDI   EN+  F   V   T N GVH V+ADGGF V G E+IQE++SKQLYLCQF  A+++LRT G+FVCKLFDIFT +SVGL++L+   F +VSI KP TSRPANSERYIV K    DT  IE   +++Y++      +   T Q D+ +V+   ++  D  F K+I+ESN+++   QI  L K+ AF  +  L +ERQ ++RKE  +LWK+PDL R   L  K  P    F  L       F  + D+L P   + I S             + ++     G        N   ++ A  K+   W  TG    Q  +     +        +P+ T+       E++G  +   + N++ V+D+ ++    + +  YE+RM  V      L    +  + P+   + F L D++    R IS K+ KG      ++C         +  HF + G L 
Sbjct:  312 ARTRSNPFETIRGGIFLNRAAMKMANMDSAFDFMFTSPVDENGDPMVGPDDLLYFADVCAGPGGFSEYVLWRKGWQAKGFGFTLKGPNDFKLEDFFAGSPDTFEPHYGVHDDGDIFVPENVRSFSKFVKSSTDNQGVHFVMADGGFSVEGQENIQEILSKQLYLCQFYTALSVLRTGGHFVCKLFDIFTVYSVGLVYLMYRAFRHVSIFKPNTSRPANSERYIVCKWRRPDTKDIE---DYMYELCCRFKEISSVTSQVDIAEVVPLEVINDDAVFAKYIRESNDRLGRAQITHLTKIRAFAQNSELYEERQSNLRKECLKLWKVPDLAR---LDPKRPPPETKFKELTKNEVSYFERRPDELTPKFLEGIKS-------------LHDYRCVVCGEWKPSLRDNKFFFLSAGRKQVYKW--TGMSTDQWKKVTEGLE--------LPADTLFYGEMVQEFAGEGRQQKRFNTIHVIDALVLGKVSVKDKHYEERMKWVQKFVKALSKPSRNDLTPLRAKEVFKLPDVESLFER-ISWKQEKGASRNMRLSCTVPQEPRDREEKHFSATGVLF 854          

HSP 2 Score: 56.9954 bits (136), Expect = 1.666e-101
Identity = 43/139 (30.94%), Postives = 68/139 (48.92%), Query Frame = 2
Query:   80 MKNDDYEPSAKIRKVESSNH-NVGLNMMRKMGWE-GSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIE-KPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
              NDD EP+     +   N+ NV   +M  MG++ G+GLG  NQG+ + +  S    R GLGL  E  G+E   D  W    +E +    + +         +   L      G++K TID+ET +CD  +L ++++CK
Sbjct:  162 FSNDDDEPAESGSGLSMGNYSNVSQKLMASMGYKAGAGLGKNNQGISDIIPTSKQRGRRGLGLSME--GLEPSADVKWDFEKEEVNVKERVDWIPECEEEPPNIKTLREWVTEGKKKLTIDDETCFCDEEVLKQIIECK 298          
BLAST of Cap methyltransferase 1 vs. TrEMBL
Match: Q4S721 (Chromosome 14 SCAF14723, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00023025001 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.920e-100
Identity = 194/494 (39.27%), Postives = 287/494 (58.10%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMH 1950
             R+RSNPYE I  G FLNRAAMKMAN+D   DN+FT  ++          E E+L+F D+CAGPGGF+E++LW+R+  + GFG TL+G  DFKL      P E F P YG+        IT  EN+T F+  V+  T   G+H ++ADGGF V G E+IQE++SKQL LCQFL A++ +RT G+FVCK FD+FT FSVGLI+L+   F+ +S+ KP+TSRPANSERY+V +     ++    +R++L+KVN  LN  K +D DV  V+  +I+K+D  F  F+  SN  + A QI  LAK++AF++D  LS+ RQ DIRKE  +LW +PD  R     A ++P ++ +  +   N +      +F+  +SP+   N  + + ++ +     VGG     G    L  L K + Y  W         D +    +  L+ +  ++P  T+L V    E  G  K   + N+V ++D+ ++ G D+ +  +  R+ 
Sbjct:  138 ARTRSNPYEVIRGGIFLNRAAMKMANIDHCFDNMFTNPKDSQGKSLTKDREGELLYFGDVCAGPGGFSEYILWRRRWHAKGFGMTLKGPCDFKLEDFYAAPSELFEPYYGEGGVDGDGDITRPENITAFRNFVLENTDKRGLHCLMADGGFSVEGQENIQEVLSKQLLLCQFLTALSTVRTGGHFVCKTFDLFTPFSVGLIYLLYLCFERISLFKPVTSRPANSERYVVCRGLKPGSD---AVRDYLFKVNLKLNQLKNSDTDVTDVVPLSIIKEDTDFYHFMVNSNESLCAVQIKALAKIHAFVLDPTLSEPRQADIRKECLKLWGVPDKAR--VAPASSDPKSKFYELVKNSNVE------SFQCKLSPLSPGNLEKLRHILDHR--CIVGG-----GEQIFLLALGKSQIYT-W---------DGKMPLRWSKLENFKLELPRDTLLSVEIVKELKGEGKAQRRINAVHIMDALVLNGTDVRDKHFNQRIQ 603          

HSP 2 Score: 63.5438 bits (153), Expect = 1.920e-100
Identity = 44/121 (36.36%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V AST   R GLGLK +  G +    V  +   E SA   + +       + D  +L    ++G+RK+ ID+ET +C   LL  +L+CK
Sbjct:    6 SMYNSVSQKLMAKMGFREGEGLGKFGQGRKEIVEASTQRGRRGLGLKLQ--GFQGELNVDWRDEPEPSATETVDWFPECTTEIPDSDELREWLILGQRKRKIDDETEFCTEDLLHNLLRCK 124          
BLAST of Cap methyltransferase 1 vs. Ensembl Cavefish
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:393102])

HSP 1 Score: 166.007 bits (419), Expect = 3.119e-42
Identity = 123/397 (30.98%), Postives = 197/397 (49.62%), Query Frame = 1
Query:  829 ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAF--IIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPI 2010
            IT  EN++ F+  V+  T   G+H ++ADGGF V G E+IQE++SKQL LCQFL A++++RT G+FVCK FD+FT FSVGL +L+   F+ VS+ KP+TSRPANSERY+V +     ++    +R +L+ VN  LN  + T++DV++V+   I+K D  F  ++  SN + +  ++   + ++ F  I D+        D R +  EL K  D+K                    F++     +P A  S  S ++    + D   +       VGG     G    L  L K + Y  W         D +    +  L+ +  ++P  T+L V    E  G  K   + N+V V+D+ ++ G D+ E  +  R+         +    +  + PI
Sbjct:  283 ITLPENISAFRNFVLENTERRGLHFLMADGGFSVEGQENIQEILSKQLLLCQFLTALSVVRTGGHFVCKTFDLFTPFSVGLTYLLYLCFERVSLFKPVTSRPANSERYVVCRGLKPGSD---PVREYLFNVNLRLNQFRHTERDVVEVVPLDIIKGDTDFYHYMINSNERFM--EMCNFSTVSVFLQIPDQARVAPSSSDPRSKFQELVKGSDIKM-------------------FNS-----RPTALSS--STLERLQHVLDHRCI-------VGG-----GEQIFLLGLGKSQIYT-W---------DGKAPLRWRKLENFKLELPRETLLSVEIVQELKGEGKAQRRINAVHVLDALVLNGTDVREQHFNQRIQMAEKFVKAVSKHSRPDMNPI 626          

HSP 2 Score: 59.3066 bits (142), Expect = 1.423e-8
Identity = 44/121 (36.36%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V AST   R GLGL  +  G +    V  +   EA+A  ++ +       + D  +L     +GERK  ID+ET +C   LL  +L+CK
Sbjct:   77 SMYNSVSQKLMAKMGFKEGEGLGKFGQGRKEIVEASTQRGRRGLGLTLQ--GFQGELNVDWQDEPEATAFEEVSWFPECSTEMPDAEELRDWMAVGERKLKIDDETEFCSENLLHLLLRCK 195          
BLAST of Cap methyltransferase 1 vs. Ensembl Cavefish
Match: cmtr2 (cap methyltransferase 2 [Source:NCBI gene;Acc:103026585])

HSP 1 Score: 82.4185 bits (202), Expect = 1.001e-15
Identity = 53/140 (37.86%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  805 YGKADDGDITNQENLTKFQTEVMHGTGNI-GVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKV 1221
            +G  D GDI  Q++L + Q  V    GN+  V  V ADG FD  G    QE +   L  C+ +CA+ +L   G+FV K+F +F   SV L+FL+   F +V I KP TS+  NSE Y+V   + +     E +R  L K+
Sbjct:  204 FGSDDTGDIMLQKHLLELQGFV----GNMHNVDLVTADGSFDCQGDPGEQESLVAPLQYCETVCALLLLGPGGSFVLKMFTLFEHSSVCLLFLLVCCFSSVHIFKPATSKSGNSEVYVVCLGYKAK----EVVRPLLSKL 335          
BLAST of Cap methyltransferase 1 vs. Ensembl Cavefish
Match: ftsj1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gene;Acc:103035718])

HSP 1 Score: 69.707 bits (169), Expect = 2.357e-12
Identity = 63/240 (26.25%), Postives = 109/240 (45.42%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLF---DIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFL--YKVNSDLNLCKGTDQDVI 1266
            R+A K+  LD    N+F  +          D+CA PG +++ +  K           LRGK+  +  KI+   ++   P  G     GDIT    ++  Q  + H  G      V+ DG  DV+G   + E +  QL L       ++L+  GNFV K+F   D+   +S   IF     F +V+  KP +SR ++ E ++V + ++     + N+ N L  +  + D N  +G ++ ++
Sbjct:   24 RSAFKLLQLDEEF-NLFKGVSRA------VDLCAAPGSWSQVLSRK-----------LRGKESNEDVKIVAVDLQAMAPLPGVTQIQGDITK---ISTAQEIIRHFEGQ-SADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGNFVAKIFRGKDVTLLYSQLKIF-----FSSVTCAKPRSSRNSSIEAFVVCQNYSPPEGYVPNMSNPLLDHSYDVDFNQLEGPNRIIV 236          
BLAST of Cap methyltransferase 1 vs. Ensembl Cavefish
Match: ftsj1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gene;Acc:103035718])

HSP 1 Score: 69.707 bits (169), Expect = 2.357e-12
Identity = 63/240 (26.25%), Postives = 109/240 (45.42%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLF---DIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFL--YKVNSDLNLCKGTDQDVI 1266
            R+A K+  LD    N+F  +          D+CA PG +++ +  K           LRGK+  +  KI+   ++   P  G     GDIT    ++  Q  + H  G      V+ DG  DV+G   + E +  QL L       ++L+  GNFV K+F   D+   +S   IF     F +V+  KP +SR ++ E ++V + ++     + N+ N L  +  + D N  +G ++ ++
Sbjct:   24 RSAFKLLQLDEEF-NLFKGVSRA------VDLCAAPGSWSQVLSRK-----------LRGKESNEDVKIVAVDLQAMAPLPGVTQIQGDITK---ISTAQEIIRHFEGQ-SADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGNFVAKIFRGKDVTLLYSQLKIF-----FSSVTCAKPRSSRNSSIEAFVVCQNYSPPEGYVPNMSNPLLDHSYDVDFNQLEGPNRIIV 236          
BLAST of Cap methyltransferase 1 vs. Ensembl Sea Lamprey
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:393102])

HSP 1 Score: 308.916 bits (790), Expect = 2.160e-93
Identity = 150/334 (44.91%), Postives = 218/334 (65.27%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENEN----------EILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD---DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQD-VIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKR 1470
             R+RSNPYE I    FLNRA++KMAN+D + D +FT  +++N          E+L+FAD+CAGPGGF+E++LW+R   + GFG TLRG +DFKL      P E F   YG +    DGDIT  +N+ +F+  V+ GT   GVH ++ADGGF V G E++QE++SKQL LCQ L A++++R  G+FVCK FD+FT FSVG+I+L+   F  V + KP+TSRPANSERY+V +        +E++R  +  VN+++N  KG D D V++++  + LK D++F  ++  SN      Q++ LAK++AF ++  L + RQ ++RK   E W IPD  R
Sbjct:  176 ARTRSNPYETIRGVIFLNRASVKMANMDCVFDFMFTNPKDKNGQPLVNDKGGELLYFADVCAGPGGFSEYVLWRRSWHAKGFGLTLRGPNDFKLEDFFAAPSEMFEAHYGVSGVDGDGDITRSDNIEEFRRFVLCGTEGRGVHFLMADGGFSVEGQENLQEILSKQLLLCQALVALSVVRKGGHFVCKTFDLFTRFSVGVIYLLYRCFSRVCLFKPVTSRPANSERYVVCRGLRGG---VEHVRELMLAVNAEINRLKGGDDDEVLEIVPLSTLKGDQEFFSYVCSSNESHAKVQVLALAKIHAFALEPTLYEPRQAEVRKACLERWGIPDKAR 506          
BLAST of Cap methyltransferase 1 vs. Ensembl Sea Lamprey
Match: ftsj1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-041114-83])

HSP 1 Score: 62.3882 bits (150), Expect = 8.303e-11
Identity = 65/239 (27.20%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLN-KIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIF-LVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFL--YKVNSDLNLCKGTDQDVI 1266
            R+A K+  LD    N+F  + +        D+CA PG +++ +  K           LRG+D  K + KI+   ++   P  G     GDIT    ++  Q  + H  G      V+ DG  DV+G   I E +  QL L       ++L+  G FV K   IF    V L+F  +   F  V+  KP T+ P   E ++V + +      I N+ N L  ++ + D N  +G ++ ++
Sbjct:   24 RSAFKLLQLDEEF-NLFQGVSHA------VDLCAAPGSWSQVLSRK-----------LRGEDGKKSDAKIVAVDLQAMAPLPGVIQLQGDITK---VSTAQEIIKHFEGQPS-DLVVCDGAPDVTGLHDIDEYIQAQLLLAALNITSHVLKRGGTFVAK---IFRGKDVTLLFSQLKVFFPLVTCAKPNTTLPVVPEAFVVCQNYDPPEGYIPNMCNPLLDHEYDVDFNQLEGPNRVIV 237          
BLAST of Cap methyltransferase 1 vs. Ensembl Sea Lamprey
Match: cmtr2 (cap methyltransferase 2 [Source:NCBI gene;Acc:406742])

HSP 1 Score: 58.5362 bits (140), Expect = 4.761e-9
Identity = 29/75 (38.67%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  934 GHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIV 1158
            G+   QE     L  C+ + A+ +L   G+FV KLF +F   S  L+FL+   F  V ++KP TS+  NSE Y+V
Sbjct:  249 GNPGEQEACVAPLVFCETVTALALLAPGGSFVLKLFTLFEHSSACLLFLLVCTFQEVHVVKPATSKAGNSELYVV 323          
BLAST of Cap methyltransferase 1 vs. Ensembl Yeast
Match: TRM7 (2'-O-ribose methyltransferase; methylates the 2'-O-ribose of tRNA-Phe, tRNA-Trp, and tRNA-Leu at positions C32 and N34 of tRNA anticodon loop; crucial biological role likely modification of tRNA-Phe; interacts with Trm732p and Rtt10p in 2'-O-methylation of C32 and N34 substrate tRNAs, respectively; yeast null mutant can be functionally complemented by human FTSJ1, mutations in which have been implicated in nonsyndromic X-linked intellectual disability (NSXLID) [Source:SGD;Acc:S000000265])

HSP 1 Score: 54.299 bits (129), Expect = 3.235e-8
Identity = 53/220 (24.09%), Postives = 97/220 (44.09%), Query Frame = 1
Query:  532 YEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHP-SYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIF-LVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTN 1185
            Y K     +  R+A K+  L+    + F  +++ N +    D+CA PG +++ +   R++      F      D +  KI+   ++   P  +      DIT+ + L +    ++   GN     V +DG  DV+G   + E + +QL +        IL+  G FV K   IF    + +++  +  LFD +   KP +SR  + E +IV   +   +N
Sbjct:   13 YRKAKEQGYRARSAFKLLQLN----DQFHFLDDPN-LKRVVDLCAAPGSWSQVL--SRKL------FDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLAR----ILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAK---IFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSN 212          
BLAST of Cap methyltransferase 1 vs. Ensembl Nematostella
Match: EDO44686 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV47])

HSP 1 Score: 72.7886 bits (177), Expect = 1.679e-13
Identity = 45/125 (36.00%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  805 YGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSD 1179
            +G    GD+   ENL     E   G     VH V ADG  D S     QE    QL  C+ + A+ +L T G +V K+F       V L++L+  LF+ V +IKP TS+  NSE YI    +T +
Sbjct:  207 FGADGTGDLMQLENLNHL-AEACQGK----VHLVTADGSIDCSDEPEEQENAVSQLIFCEAVTALTVLATGGCYVFKMFTTLEHHMVCLMYLMCCLFEEVHVIKPGTSKGGNSEVYITCCGYTGN 326          
BLAST of Cap methyltransferase 1 vs. Ensembl Nematostella
Match: EDO35418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ2])

HSP 1 Score: 58.151 bits (139), Expect = 5.010e-9
Identity = 60/240 (25.00%), Postives = 103/240 (42.92%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHS--VLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFL-VSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKV--NSDLNLCKGTDQDVI 1266
            R+A K+  L+   D +F+ +          D+CA PG +++ +  K            +  ++ +  KI+   ++   P  G     GDIT      +    + H  G    H+  V+ DG  DV+G   I E +  QL L       ++L+  GNFV K   IF    V L++  +   F  V+I KP +SR ++ E ++V + +         + N L     N D N  +G ++ V+
Sbjct:   24 RSAFKLLQLNEDFD-LFSGVSK------VVDLCAAPGSWSQVLSRKL--------IEEKQDEEGEKPKIVAVDLQAMAPLPGVIQIQGDITKTSTANQI---ISHFEGE---HADLVICDGAPDVTGLHDIDEYIQGQLLLAALNITTHVLKPGGNFVAK---IFRGKDVSLLYAQLKVFFPTVTICKPRSSRNSSIESFVVCQGYAPPQGYKPTMSNPLLDSHQNPDFNSLEGVNRIVV 239          
BLAST of Cap methyltransferase 1 vs. Ensembl Nematostella
Match: EDO48222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB9])

HSP 1 Score: 49.6766 bits (117), Expect = 5.234e-6
Identity = 21/50 (42.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  140 NVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRH----GLGLKDEDL 277
            NVG  M++KMGWEG+GLG   +G+  P+ A     RH    G+G++++D+
Sbjct:  788 NVGHQMLKKMGWEGAGLGKNERGIQNPIQAGEVRERHNMYKGIGVEEDDV 837          
BLAST of Cap methyltransferase 1 vs. Ensembl Medaka
Match: cmtr1 (cap methyltransferase 1 [Source:NCBI gene;Acc:101158070])

HSP 1 Score: 329.331 bits (843), Expect = 3.753e-100
Identity = 190/494 (38.46%), Postives = 283/494 (57.29%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIEN----------ENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGD---ITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGP-KGNLKCNSVVVVDSPLIYGEDISELSYEDRMH 1950
             R+RSNPYE I  G FLNRAAMKMAN+D   DN+FT  ++          E E+L+F D+CAGPGGF+E++LWKR+  + GFG TL+G  DFKL      P E F P YG+        IT  EN+T F+  VM  T   G+H ++ADGGF V G E++QE++SKQL LCQFL A++ LRT G+FVCK FD+FT FSVGL++L+   FD +S+ KP+TSRPANSERYIV +     +     ++++++KVN  LN  + TD DV  V+   I+K D  F +F+  SN    A QI  LAK++AF+++  LS+ +Q DIRKE  +LW +PD  R     + ++P ++      F+   +      F+S ++P+  +   + + ++ +     VGG     G    L  + K + Y  W            P R +  ++ +  ++P  T+L V    E  G  K   + N+V ++D+ ++ G D+ +  +  R+ 
Sbjct:  201 ARTRSNPYETIRGGIFLNRAAMKMANIDHCFDNMFTNPKDGQGRPLTKDREGELLYFGDVCAGPGGFSEYILWKRRWHAKGFGMTLKGPCDFKLEDFYAAPSELFEPYYGEGGVDGDGDITRPENITAFRNFVMESTERRGLHFIMADGGFSVEGQENLQEILSKQLLLCQFLTALSTLRTGGHFVCKTFDLFTPFSVGLVYLLYLCFDRISLFKPVTSRPANSERYIVCRSLKPGSG---AVKDYMFKVNIKLNQLRNTDSDVTDVVPLHIVKDDPDFYQFMVNSNESFCAVQIKALAKIHAFVVEPTLSEPKQADIRKECLKLWGVPDKAR--VAPSSSDPKSK------FYELTENADVNLFQSKLTPLNSSTLEKLRPILDHR--CIVGG-----GEQIFLLAMGKSQIYT-W--------NGKMPLR-WKKMENFKLELPRDTLLSVEIVQELKGEGKAQRRINAVHLMDALILNGTDVRDRHFNQRIQ 666          

HSP 2 Score: 53.5286 bits (127), Expect = 9.509e-7
Identity = 41/121 (33.88%), Postives = 57/121 (47.11%), Query Frame = 2
Query:  128 SSNHNVGLNMMRKMGW-EGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            S  ++V   +M KMG+ EG GLG   QG  E V AST   R GLGL  +    E  +  W    + ++      F      M   D +L     +G RK  I++ET +C   LL  +L+CK
Sbjct:   69 SMYNSVSQKLMAKMGFREGEGLGKFGQGRKEIVEASTQRGRRGLGLTLQGFQGEL-NIDWRDEPEPSAIETVQWFPECSTEMPDAD-ELRDWMTLGPRKLKIEDETEFCAEDLLHTLLRCK 187          
BLAST of Cap methyltransferase 1 vs. Ensembl Medaka
Match: cmtr2 (cap methyltransferase 2 [Source:NCBI gene;Acc:101158006])

HSP 1 Score: 70.0922 bits (170), Expect = 6.710e-12
Identity = 57/201 (28.36%), Postives = 98/201 (48.76%), Query Frame = 1
Query:  805 YGKADDGDITNQENLTKFQTEV--MHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKV----NSDLNLCKGTDQDV---IKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNA 1380
            +G  + GDI  Q+ L      V  MH      V  V ADG FD   +   QE +   L+ C+   A+ +L   G+FV K+F ++   SV L++L++  F +V++ KP TS+  NSE Y+V  C   + N  E +R  L K+     +DL     +D++    I ++  + L++ ++   +      K + E +    K++A
Sbjct:  209 FGSDNTGDIMVQKYLLDLHKFVSNMHF-----VDLVTADGSFDCQENPDEQEALVASLHYCEATAALLLLSPGGSFVLKMFTLYEHSSVCLLYLLNCCFHSVNVFKPATSKAGNSEVYVV--CL--NYNGKEALRPLLSKLIRHYGADL-----SDREALFPISLLPESFLEQHEEVCFYFHTLQVKTITENLQLFQKMSA 395          
BLAST of Cap methyltransferase 1 vs. Ensembl Medaka
Match: cmtr2 (cap methyltransferase 2 [Source:NCBI gene;Acc:101158006])

HSP 1 Score: 70.0922 bits (170), Expect = 6.710e-12
Identity = 57/201 (28.36%), Postives = 98/201 (48.76%), Query Frame = 1
Query:  805 YGKADDGDITNQENLTKFQTEV--MHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKV----NSDLNLCKGTDQDV---IKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNA 1380
            +G  + GDI  Q+ L      V  MH      V  V ADG FD   +   QE +   L+ C+   A+ +L   G+FV K+F ++   SV L++L++  F +V++ KP TS+  NSE Y+V  C   + N  E +R  L K+     +DL     +D++    I ++  + L++ ++   +      K + E +    K++A
Sbjct:  209 FGSDNTGDIMVQKYLLDLHKFVSNMHF-----VDLVTADGSFDCQENPDEQEALVASLHYCEATAALLLLSPGGSFVLKMFTLYEHSSVCLLYLLNCCFHSVNVFKPATSKAGNSEVYVV--CL--NYNGKEALRPLLSKLIRHYGADL-----SDREALFPISLLPESFLEQHEEVCFYFHTLQVKTITENLQLFQKMSA 395          
BLAST of Cap methyltransferase 1 vs. Ensembl Medaka
Match: ftsj1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gene;Acc:101164526])

HSP 1 Score: 66.6254 bits (161), Expect = 2.001e-11
Identity = 64/240 (26.67%), Postives = 107/240 (44.58%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLF---DIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFL--YKVNSDLNLCKGTDQDVI 1266
            R+A K+  LD    N+FT +          D+CA PG +++ +  K           LRG +  K  KI+   ++   P  G     GDIT    ++  Q  + H  G      V+ DG  DV+G   + E +  QL L       ++L+  G FV K+F   D+   +S   IF     F  V+  KP +SR ++ E ++V + ++     I N+ N L  +  + D N   G+++ ++
Sbjct:   24 RSAFKLLQLDQEF-NLFTGVSRA------VDLCAAPGSWSQVLSRK-----------LRGDEGAKEVKIVAVDLQAMAPLPGVTQIQGDITK---VSTAQEIIRHFEGQ-AADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGTFVAKIFRGKDVTLLYSQLKIF-----FSRVTCAKPRSSRNSSIESFVVCQRYSPPACYIPNMSNPLLDHCYDVDFNQLDGSNRFIV 236          
BLAST of Cap methyltransferase 1 vs. Ensembl Medaka
Match: ftsj1 (FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gene;Acc:101164526])

HSP 1 Score: 66.6254 bits (161), Expect = 2.001e-11
Identity = 64/240 (26.67%), Postives = 107/240 (44.58%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKAD-DGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLF---DIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFL--YKVNSDLNLCKGTDQDVI 1266
            R+A K+  LD    N+FT +          D+CA PG +++ +  K           LRG +  K  KI+   ++   P  G     GDIT    ++  Q  + H  G      V+ DG  DV+G   + E +  QL L       ++L+  G FV K+F   D+   +S   IF     F  V+  KP +SR ++ E ++V + ++     I N+ N L  +  + D N   G+++ ++
Sbjct:   24 RSAFKLLQLDQEF-NLFTGVSRA------VDLCAAPGSWSQVLSRK-----------LRGDEGAKEVKIVAVDLQAMAPLPGVTQIQGDITK---VSTAQEIIRHFEGQ-AADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGTFVAKIFRGKDVTLLYSQLKIF-----FSRVTCAKPRSSRNSSIESFVVCQRYSPPACYIPNMSNPLLDHCYDVDFNQLDGSNRFIV 236          
BLAST of Cap methyltransferase 1 vs. Planmine SMEST
Match: SMESG000050516.1 (SMESG000050516.1)

HSP 1 Score: 1137.87 bits (2942), Expect = 0.000e+0
Identity = 549/551 (99.64%), Postives = 550/551 (99.82%), Query Frame = 1
Query:  493 YDNFLDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTDHFYSLGKLL 2145
            YDN LDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNF+CKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTDHFYSLGKLL
Sbjct:  142 YDNILDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFLCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTDHFYSLGKLL 692          

HSP 2 Score: 280.796 bits (717), Expect = 1.057e-82
Identity = 132/136 (97.06%), Postives = 134/136 (98.53%), Query Frame = 2
Query:   80 MKNDDYEPSAKIRKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            MKNDDYEP+AK+RKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASAN DLIFSA GIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK
Sbjct:    1 MKNDDYEPTAKVRKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANRDLIFSAPGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 136          

HSP 3 Score: 118.242 bits (295), Expect = 4.080e-27
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query: 2210 PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDWKSNKEEFDCV 2374
            PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDWKSNKEEFDCV
Sbjct:  700 PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDWKSNKEEFDCV 754          
BLAST of Cap methyltransferase 1 vs. Planmine SMEST
Match: SMESG000050516.1 (SMESG000050516.1)

HSP 1 Score: 1137.48 bits (2941), Expect = 0.000e+0
Identity = 549/551 (99.64%), Postives = 550/551 (99.82%), Query Frame = 1
Query:  493 YDNFLDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTDHFYSLGKLL 2145
            YDN LDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNF+CKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTDHFYSLGKLL
Sbjct:  121 YDNILDGRSRSNPYEKIASGFFLNRAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFLCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFTSDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIKESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRDHFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVVRNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLFDHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDISELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKAKGLPEQKMVTCIKTDHFYSLGKLL 671          

HSP 2 Score: 229.18 bits (583), Expect = 3.477e-64
Identity = 112/136 (82.35%), Postives = 114/136 (83.82%), Query Frame = 2
Query:   80 MKNDDYEPSAKIRKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSDDYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCK 487
            MKNDDYEP+AK+RKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASAN                      EVIGERKQTIDNETTYCDPALLCEMLKCK
Sbjct:    1 MKNDDYEPTAKVRKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAASTHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASAN---------------------REVIGERKQTIDNETTYCDPALLCEMLKCK 115          

HSP 3 Score: 118.242 bits (295), Expect = 4.301e-27
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query: 2210 PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDWKSNKEEFDCV 2374
            PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDWKSNKEEFDCV
Sbjct:  679 PWLVAVSRRQGNTYYYNVDSRESVFEKPETLYASYSKSNIYEIDWKSNKEEFDCV 733          
BLAST of Cap methyltransferase 1 vs. Planmine SMEST
Match: SMESG000054113.1 (SMESG000054113.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.960e-7
Identity = 58/227 (25.55%), Postives = 99/227 (43.61%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFM---LWKRQMQSCGFGFTLRGKDDFKLN-KIICGPVECFHPSYGKAD-DGDITNQ----ENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSII--KPITSRPANSERYIVFKCFTSDTNRIENIRNFL 1212
            R+A K+  ++    NIF K  +   +    D+CA PG +++ +   LW+ +             D  + N KI+   ++   P  G     GDITN+    E +T+FQ         +    V+ DG  DV+G   I E +  QL L       ++L   G F+ K   +F      L+F    LF  + ++  KP +SR +++E + V + +      + N+ N L
Sbjct:   24 RSAYKLIQINEEF-NIFEK--DCQSLTRVVDLCAAPGSWSQVLAKKLWEPK------------PDQERENVKIVAVDLQEMSPIPGIFQLQGDITNEITANEIITQFQ--------GLKAQLVVCDGAPDVTGLHDIDEFIQHQLVLAALNITTHVLEEGGTFIAK---VFRGPESQLLFSQLRLFFPLEVVCAKPKSSRNSSAECFAVCRGYKPPIGYVPNMSNPL 224          
BLAST of Cap methyltransferase 1 vs. Planmine SMEST
Match: SMESG000054113.1 (SMESG000054113.1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.535e-7
Identity = 58/227 (25.55%), Postives = 99/227 (43.61%), Query Frame = 1
Query:  565 RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFM---LWKRQMQSCGFGFTLRGKDDFKLN-KIICGPVECFHPSYGKAD-DGDITNQ----ENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSII--KPITSRPANSERYIVFKCFTSDTNRIENIRNFL 1212
            R+A K+  ++    NIF K  +   +    D+CA PG +++ +   LW+ +             D  + N KI+   ++   P  G     GDITN+    E +T+FQ         +    V+ DG  DV+G   I E +  QL L       ++L   G F+ K   +F      L+F    LF  + ++  KP +SR +++E + V + +      + N+ N L
Sbjct:   24 RSAYKLIQINEEF-NIFEK--DCQSLTRVVDLCAAPGSWSQVLAKKLWEPK------------PDQERENVKIVAVDLQEMSPIPGIFQLQGDITNEITANEIITQFQ--------GLKAQLVVCDGAPDVTGLHDIDEFIQHQLVLAALNITTHVLEEGGTFIAK---VFRGPESQLLFSQLRLFFPLEVVCAKPKSSRNSSAECFAVCRGYKPPIGYVPNMSNPL 224          
BLAST of Cap methyltransferase 1 vs. Planmine SMEST
Match: SMESG000067428.1 (SMESG000067428.1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.997e-7
Identity = 52/217 (23.96%), Postives = 93/217 (42.86%), Query Frame = 1
Query:  511 GRSRSNPYEKIASGFFLN-RAAMKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCGFGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVMHGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGNFVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIV 1158
            G+SR + Y  +A    L  R++ K+  ++     +F  +EN        D+CA PGG+ +     + M+   F   +    D    K I G +             DIT+ +     +  ++    ++ +H    DG  +V  + ++ E     L L  F  A   L   G FV K+F    D+   L ++   LF+ V ++KP +SR  ++E ++V
Sbjct:    8 GKSRKDEYYYMAKNTGLRARSSFKLIEIN----KLFHILEN---ATILIDLCAAPGGWMQIAA--KTMKKSSFIIGI----DLVPIKPIPGTISI---------QADITSDKCKQLIKKHILKAKADVILH----DGAPNVGANWNVDEFQQAHLCLKAFALATEFLVKNGTFVTKVFR-SKDYE-SLKWVFDQLFEKVQVVKPKSSRNESAEIFLV 196          
The following BLAST results are available for this feature:
BLAST of Cap methyltransferase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CMTR17.093e-9446.85cap methyltransferase 1 [Source:HGNC Symbol;Acc:HG... [more]
CMTR16.335e-5348.47cap methyltransferase 1 [Source:HGNC Symbol;Acc:HG... [more]
CMTR21.447e-1525.60cap methyltransferase 2 [Source:HGNC Symbol;Acc:HG... [more]
CMTR21.447e-1525.60cap methyltransferase 2 [Source:HGNC Symbol;Acc:HG... [more]
FTSJ19.063e-725.00FtsJ RNA 2'-O-methyltransferase 1 [Source:HGNC Sym... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y53F4B.133.786e-8532.84Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
Y53F4B.131.143e-8040.40Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
Y53F4B.131.335e-8031.85Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
Y53F4B.131.944e-8040.40Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
Y40D12A.12.183e-831.01pep chromosome:WBcel235:III:6615414:6620051:1 gene... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG63793.594e-9145.29gene:FBgn0029693 transcript:FBtr0343297[more]
CG63793.594e-9145.29gene:FBgn0029693 transcript:FBtr0070671[more]
aft7.332e-1233.33gene:FBgn0026309 transcript:FBtr0089549[more]
CG52205.523e-1127.14gene:FBgn0038471 transcript:FBtr0083391[more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtr11.062e-9636.58cap methyltransferase 1 [Source:NCBI gene;Acc:3931... [more]
cmtr11.062e-9636.58cap methyltransferase 1 [Source:NCBI gene;Acc:3931... [more]
cmtr15.529e-9335.92cap methyltransferase 1 [Source:NCBI gene;Acc:3931... [more]
cmtr21.128e-1529.18cap methyltransferase 2 [Source:NCBI gene;Acc:4067... [more]
ftsj12.885e-1227.14FtsJ RNA 2'-O-methyltransferase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtr11.412e-9747.45cap methyltransferase 1 [Source:NCBI gene;Acc:1001... [more]
cmtr13.238e-9747.45cap methyltransferase 1 [Source:NCBI gene;Acc:1001... [more]
cmtr11.610e-9647.45cap methyltransferase 1 [Source:NCBI gene;Acc:1001... [more]
cmtr14.009e-9547.68cap methyltransferase 1 [Source:NCBI gene;Acc:1001... [more]
CMTR23.303e-1335.59cap methyltransferase 2 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cmtr12.195e-9447.45cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI... [more]
Cmtr12.231e-9447.45cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI... [more]
Cmtr11.356e-4549.69cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI... [more]
Cmtr11.712e-4145.45cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI... [more]
Cmtr12.110e-3045.90cap methyltransferase 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Cap methyltransferase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GQ76|CMTR1_XENLA1.099e-9747.45Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
sp|Q803R5|CMTR1_DANRE6.717e-9636.58Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
sp|Q5U2Z5|CMTR1_RAT3.778e-9447.45Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
sp|Q9DBC3|CMTR1_MOUSE1.336e-9347.45Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
sp|Q5R981|CMTR1_PONAB3.143e-9346.85Cap-specific mRNA (nucleoside-2'-O-)-methyltransfe... [more]
back to top
BLAST of Cap methyltransferase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R5L8128.779e-10537.37Putative ftsj-like rna methyltransferase (Fragment... [more]
A0A1S3K1354.454e-10436.85cap-specific mRNA (Nucleoside-2'-O-)-methyltransfe... [more]
A0A3S1BYJ79.203e-10338.96Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
L7MEE71.666e-10137.35Putative ftsj-like rna methyltransferase (Fragment... [more]
Q4S7211.920e-10039.27Chromosome 14 SCAF14723, whole genome shotgun sequ... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cmtr13.119e-4230.98cap methyltransferase 1 [Source:NCBI gene;Acc:3931... [more]
cmtr21.001e-1537.86cap methyltransferase 2 [Source:NCBI gene;Acc:1030... [more]
ftsj12.357e-1226.25FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gen... [more]
ftsj12.357e-1226.25FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gen... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cmtr12.160e-9344.91cap methyltransferase 1 [Source:NCBI gene;Acc:3931... [more]
ftsj18.303e-1127.20FtsJ RNA 2'-O-methyltransferase 1 [Source:ZFIN;Acc... [more]
cmtr24.761e-938.67cap methyltransferase 2 [Source:NCBI gene;Acc:4067... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TRM73.235e-824.092'-O-ribose methyltransferase; methylates the 2'-O... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO446861.679e-1336.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354185.010e-925.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482225.234e-642.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtr13.753e-10038.46cap methyltransferase 1 [Source:NCBI gene;Acc:1011... [more]
cmtr26.710e-1228.36cap methyltransferase 2 [Source:NCBI gene;Acc:1011... [more]
cmtr26.710e-1228.36cap methyltransferase 2 [Source:NCBI gene;Acc:1011... [more]
ftsj12.001e-1126.67FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gen... [more]
ftsj12.001e-1126.67FtsJ RNA 2'-O-methyltransferase 1 [Source:NCBI gen... [more]
back to top
BLAST of Cap methyltransferase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050516.11.057e-8299.64SMESG000050516.1[more]
SMESG000050516.13.477e-6499.64SMESG000050516.1[more]
SMESG000054113.11.960e-725.55SMESG000054113.1[more]
SMESG000054113.13.535e-725.55SMESG000054113.1[more]
SMESG000067428.14.997e-723.96SMESG000067428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009864 ID=SMED30009864|Name=Cap methyltransferase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2414bp
TTGAGAATTATAAAAATATTTAATTCTTCGAAAGTTATTGTTAATTATTG
CAATCTTTAAAAAAATAAATTTAAGAATCATGAAAAATGACGATTATGAA
CCATCAGCTAAAATTCGAAAAGTTGAATCTTCCAATCATAATGTAGGACT
CAATATGATGAGGAAAATGGGATGGGAAGGATCTGGTTTAGGAGCTCAAA
ATCAAGGATTAATTGAGCCCGTAGCTGCTAGCACCCATTCCAGTCGACAT
GGATTAGGATTAAAAGATGAAGATTTGGGAATTGAAAAGCCTGATACAGT
GTGGCATAAAGGAATGGACGAGGCATCAGCTAATGGTGATTTAATTTTTT
CTGCGTCAGGAATTCGCATGGTTTCTGATGATTATGATTTAAATTCAGGA
GAAGTTATTGGTGAACGTAAGCAAACAATAGACAATGAAACTACATACTG
CGATCCAGCCTTGTTGTGTGAAATGTTAAAGTGTAAAATAAATATGATAA
CTTTCTCGACGGCCGAAGTCGATCAAATCCTTATGAAAAAATTGCATCTG
GATTTTTTCTGAATCGTGCAGCAATGAAAATGGCAAATCTCGATTCAATT
TGTGACAATATATTTACAAAAATTGAGAACGAGAATGAAATTTTGTTCTT
TGCAGATATCTGTGCCGGTCCTGGTGGATTTACGGAATTTATGTTGTGGA
AACGCCAGATGCAGTCCTGTGGATTCGGATTCACGTTGCGTGGCAAGGAT
GATTTCAAATTGAATAAAATAATATGTGGTCCTGTTGAGTGCTTCCACCC
GAGTTACGGAAAAGCTGATGATGGTGACATCACGAATCAGGAAAATTTAA
CCAAATTCCAAACTGAAGTCATGCATGGAACAGGCAATATCGGAGTTCAT
TCGGTTCTCGCCGACGGTGGATTTGATGTGTCCGGTCACGAGTCTATTCA
GGAATTAATGTCAAAACAATTGTATTTGTGCCAGTTTCTGTGTGCTATAA
ACATTTTGAGGACTACGGGAAATTTTGTATGCAAATTATTCGATATTTTC
ACGGATTTTAGCGTCGGTCTCATTTTTTTGGTATCGACTTTGTTTGATAA
CGTGTCAATCATTAAGCCCATCACCAGCCGCCCTGCCAATTCTGAAAGAT
ATATCGTTTTCAAATGTTTCACGAGTGACACGAATCGCATTGAAAACATC
CGCAATTTCCTTTACAAAGTCAACAGTGACCTGAACTTATGCAAAGGCAC
CGATCAAGACGTGATAAAAGTCATCCAGAACACCATATTGAAGAAAGACA
AACAATTTATCAAGTTCATAAAGGAATCAAATAACAAAATACTGGCGGAG
CAAATCATCGGGCTGGCCAAACTGAATGCCTTCATCATCGACCGGAACCT
CAGTGACGAACGGCAAATGGATATCCGCAAAGAAGCCTTTGAGTTGTGGA
AAATTCCTGATCTGAAACGAGACCATTTTCTGTGCGCCAAAGCCAATCCG
ATCGCTGAAAATTTCCTCTCATTGAATTTCCACAATAAGCAAGACAAACT
GAAACCGGCCGCATTCAAATCGATCGTTTCCCCTATGAAAGAAACCAATT
TTATCCAAGACAAATTTGTGGTTAGAAATCACATGGCAGCATTTGTCGGA
GGCGTCCCGGTTTGTGACGGAATGAATGGGGCACTTTATGTGCTGGCAAA
GGACAAGAAATACGTCAACTGGTATCCGACCGGGCAAGACATTGGTCAGG
ATTATCGACCGAATCGATTGTTTGATCATTTGAAGAAATGGTTCAATAAA
ATCCCTTCATTCACGGTTCTGTTGGTGCATTTCGGGTTGGAATATTCGGG
ACCCAAGGGCAATTTGAAATGCAACTCGGTGGTGGTTGTGGATTCACCGC
TGATTTACGGAGAGGACATTTCCGAGCTGTCCTATGAAGATCGAATGCAC
CGTGTTTCACACCTATGCAGTCTGCTCGATCCTAAACTGAAAGGCTTGAT
TCGACCGATCGATTATTTTCCATTATCGGATATCAAAGACCACGTGTCGA
GATACATATCCGTAAAGAAAGCAAAAGGCCTGCCGGAACAGAAAATGGTC
ACCTGTATAAAAACCGACCATTTCTATTCGCTCGGCAAGTTGCTAATAAT
CAACGTGATAAACTGTAATATAGATATTTGAATGTAATATATATGTATAT
TTATTAGTTCCCTGGTTGGTGGCCGTCAGTAGGAGACAAGGAAATACATA
TTATTACAATGTGGATTCTCGGGAGTCAGTGTTTGAAAAGCCGGAAACTC
TTTATGCATCATACTCGAAATCCAACATTTATGAAATCGATTGGAAAAGC
AACAAAGAAGAATTTGATTGTGTGAAATTATTGACATTATTAGATAAGAA
GCAGTGACTGAATT
back to top

protein sequence of SMED30009864-orf-1

>SMED30009864-orf-1 ID=SMED30009864-orf-1|Name=SMED30009864-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MKNDDYEPSAKIRKVESSNHNVGLNMMRKMGWEGSGLGAQNQGLIEPVAA
STHSSRHGLGLKDEDLGIEKPDTVWHKGMDEASANGDLIFSASGIRMVSD
DYDLNSGEVIGERKQTIDNETTYCDPALLCEMLKCKINMITFSTAEVDQI
LMKKLHLDFF*
back to top

protein sequence of SMED30009864-orf-2

>SMED30009864-orf-2 ID=SMED30009864-orf-2|Name=SMED30009864-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
MKMANLDSICDNIFTKIENENEILFFADICAGPGGFTEFMLWKRQMQSCG
FGFTLRGKDDFKLNKIICGPVECFHPSYGKADDGDITNQENLTKFQTEVM
HGTGNIGVHSVLADGGFDVSGHESIQELMSKQLYLCQFLCAINILRTTGN
FVCKLFDIFTDFSVGLIFLVSTLFDNVSIIKPITSRPANSERYIVFKCFT
SDTNRIENIRNFLYKVNSDLNLCKGTDQDVIKVIQNTILKKDKQFIKFIK
ESNNKILAEQIIGLAKLNAFIIDRNLSDERQMDIRKEAFELWKIPDLKRD
HFLCAKANPIAENFLSLNFHNKQDKLKPAAFKSIVSPMKETNFIQDKFVV
RNHMAAFVGGVPVCDGMNGALYVLAKDKKYVNWYPTGQDIGQDYRPNRLF
DHLKKWFNKIPSFTVLLVHFGLEYSGPKGNLKCNSVVVVDSPLIYGEDIS
ELSYEDRMHRVSHLCSLLDPKLKGLIRPIDYFPLSDIKDHVSRYISVKKA
KGLPEQKMVTCIKTDHFYSLGKLLIINVINCNIDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR030376Cap_mRNA_MeTrfase_1
IPR000467G_patch_dom
IPR001202WW_dom
IPR029063SAM-dependent_MTases
IPR002877rRNA_MeTrfase_FtsJ_dom
IPR025816RrmJ-type_MeTrfase
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0004483mRNA (nucleoside-2'-O-)-methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:00063707-methylguanosine mRNA capping
GO:0080009mRNA methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.12760coord: 1..302
e-value: 1.4E-115
score: 388.6
NoneNo IPR availablePANTHERPTHR16121UNCHARACTERIZEDcoord: 1..528
IPR002877Ribosomal RNA methyltransferase FtsJ domainPFAMPF01728FtsJcoord: 2..197
e-value: 1.5E-30
score: 106.6
IPR030376Cap-specific mRNA (nucleoside-2-O-)-methyltransferase 1PANTHERPTHR16121:SF0CAP-SPECIFIC MRNA (NUCLEOSIDE-2'-O-)-METHYLTRANSFERASE 1coord: 1..528
IPR025816RrmJ-type ribose 2-O-methyltransferase domainPROSITEPS51613SAM_MT_RRMJcoord: 1..200
score: 35.236
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 27..198