slc26a-3

Overview
Nameslc26a-3 (AKN21607.1)
Smed IDSMED30009861
Length (bp)2291
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc26a-3 (SMED30009861) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc26a-3 (SMED30009861) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009861

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30009861h1SMcG0010092 Contig33181newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009861h1SMcG0010092 Contig33181uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30009861h1SMcG0010092 dd_Smed_v6_10602_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal region of the epidermisSMED30009861h1SMcG0010092 dd_Smed_v4_10602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30009861h1SMcG0010092 dd_Smed_v4_10602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009861h1SMcG0010092 dd_Smed_v4_10602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc26a-3 vs. Ensembl Human
Match: SLC26A4 (solute carrier family 26 member 4 [Source:HGNC Symbol;Acc:HGNC:8818])

HSP 1 Score: 321.627 bits (823), Expect = 1.024e-97
Identity = 226/760 (29.74%), Postives = 403/760 (53.03%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK----RSLENKLATIQKKFEKENQMPDFMEKKSTIE--------EELD--------QLNKSTEF------------SIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 2271
            S+ ++RP  S+  F Q +E    +L  +  L ES        CSR   +  L    P +  L KY+ KE LL D+I+G+  G++   QGMAY+ LA +   +GLY + FP L YF FGTS+HIS+G            P     L V             S  +++  D   H+L        TV N TT  DTA  +  R++   A+     VG+ Q++ G   +G + +YL+DP++ GFT  ++  V  SQ+K    V  + + G+ ++I T+ E+ +NI +TN+   +  ++ I + +  KE +N     +  +P+P+E+ V +     S   +L KN+   IV  I +G   P +P + +    +       ++A+A++VS+  +++ K+ Y+I  NQEF+A+G+ N+F+ FFSCF +  +LSR+AVQES GGK+Q++ +IS+ +++  +L +G+  E L   +LA+++I  LKG+FM+  ++  LWR + +D  IW+ T + ++IL ++ GLL G +  + +VVL+ Q P    LG I  TDIY +   Y   +E  G+KI ++   ++Y + + FKK +   +G + I ++ K+    R ++  + + Q +  K   + D +   +  E        EELD        Q++ ++E             S+++DC    F+D +G++++  +++E+Q I+++V+  SL+  + +K  Q   F+   +I     +L++HDA++ +  Q +  + Q
Sbjct:   19 SYMVSRPVYSELAFQQQHE---RRLQERKTLRESLAKCCS--CSRKRAFGVLKTLVPILEWLPKYRVKEWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSRHISVG------------PFPVVSLMV------------GSVVLSMAPD--EHFL--VSSSNGTVLN-TTMIDTAARDTARVLI--ASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKE-LNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEMLAASFSIAVVAYAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKTQVAGIISAAIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQLCDIPRLWRQNKIDAVIWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDD--NIRKDTFFLTVHDAILYLQNQVKSQEGQ 739          
BLAST of slc26a-3 vs. Ensembl Human
Match: SLC26A6 (solute carrier family 26 member 6 [Source:HGNC Symbol;Acc:HGNC:14472])

HSP 1 Score: 311.227 bits (796), Expect = 3.767e-94
Identity = 211/718 (29.39%), Postives = 368/718 (51.25%), Query Frame = 1
Query:  223 CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLN----------------------------------PIE---IFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKF---HQFNSPCHINDKMVYLSIHDAVVSILRQRR 2256
            CSR   Y  L    P +  L +Y  ++ LL DL++G+ V IM +PQG+AY+ LAGL PV GLY S +P  IYF FGTS+HIS+G   +                             +S  V  +T+                 N +   +TA +     V++     +  VGL Q+ +G  + G +  YLS+P++ G+T  ++V VF SQ+KY FG+ + +  G  ++I T+ EV   + ++ + T+  A +   +L+  K  +N  +  +  +P+P EL  ++G    S    L    +V +VG I  GL  P  P+ ++    V       ++ FA+++SL  IF+ +H Y + SNQE +A G+ N+    F CFP + S+SRS VQES GG SQ++  ISS+ ++ +++ +G+ F +LP  +LA+IIIV LKG+  + ++++ LW+ +  D  IWL+TF  T++L+++ GL+V  + S+  VV++TQ P   +LGQ+  TDIY +++ YSE KE+ G+K+F+   +VY+A+ E +   L Q+ G++                                  P+    +  ++ S  +K+       +++++ PD    K+        L +    S+I+D     F+D + +K++  +  +++ I + V++ +    +  +    H F++   I  K ++ S+HDAV   L+  R
Sbjct:   62 CSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRHISVGTFAV-----------------------------MSVMVGSVTE----------SLAPQALNDSMINETARDAARVQVAST---LSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVK-LLNDKLQQQLPMPIPGELLTLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVTFTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGVKVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAGPLLSACLAPQQVSSGDKMEDATANGQEDSKAPDGSTLKAL------GLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDA--SITKKHLFASVHDAVTFALQHPR 728          
BLAST of slc26a-3 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 306.99 bits (785), Expect = 6.843e-93
Identity = 181/537 (33.71%), Postives = 309/537 (57.54%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKR-------------------------SLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTE--FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDI-----RKKFHQFNSPCHINDKMVYLSIHDAVV-SILRQ 2250
            G+ Q  +G C  G +  YL++P++ GFT  ++VHVFTS +KY FGV+ + + GIF+V+ +   V++N+   N+ ++ + ++   LL+  KE  N     +   P+P+E F VV G   S  F+L +++ V +VG +  GL  P  PD  + +   VD I   I+ F+V++S+A   + KH Y +  NQE +A G+ N   S F  F  + SLSRS VQE  GGK+QL+  ++S++++ V+L  G  FE+LP  +L++I+IV LKG+FM+ ++L   WR S ++ +IWL TF+ ++ L ++YGL+   ++++ +V+ +TQ+P   +LG++ +TD+Y +I  Y E KEI GIKIFQ    +YYA+ + +   L +K G+NP  I   +R                          ++ + AT  ++ + E + P  +  KST  EE+ +     +   ++I+D +   FID++G+KT+  +++EY  + I V+L      +     R +F  F +P     ++++ SIHDAV+ S LR+
Sbjct:  150 GIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIV-IKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRF--FENPALW--ELLFHSIHDAVLGSQLRE 680          
BLAST of slc26a-3 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 306.99 bits (785), Expect = 1.547e-92
Identity = 185/537 (34.45%), Postives = 310/537 (57.73%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKL-----------ATIQK-----------KFEKEN---QMPDFMEKKSTIEEELDQLNKSTE--FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDI-----RKKFHQFNSPCHINDKMVYLSIHDAVV-SILRQ 2250
            G+ Q  +G C  G +  YL++P++ GFT  ++VHVFTS +KY FGV+ + + GIF+V+ +   V++N+   N+ ++ + ++   LL+  KE  N     +   P+P+E F VV G   S  F+L +++ V +VG +  GL  P  PD  + +   VD I   I+ F+V++S+A   + KH Y +  NQE +A G+ N   S F  F  + SLSRS VQE  GGK+QL+  ++S++++ V+L  G  FE+LP  +L++I+IV LKG+FM+ ++L   WR S ++ +IWL TF+ ++ L ++YGL+   ++++ +V+ +TQ+P   +LG++ +TD+Y +I  Y E KEI GIKIFQ    +YYA+ + +   L +K G+NP  I   +R    K            AT+ K           K E+E+   + P  +  KST  EE+ +     +   ++I+D +   FID++G+KT+  +++EY  + I V+L      +     R +F  F +P     ++++ SIHDAV+ S LR+
Sbjct:  187 GIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIV-IKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRF--FENPALW--ELLFHSIHDAVLGSQLRE 717          

HSP 2 Score: 83.9593 bits (206), Expect = 5.142e-16
Identity = 44/127 (34.65%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  100 FTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKD-FQRNF-CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            + + RP  S       + +  ++L  K ++ +S  D  ++ F C+     N +    P    L  YK+KE +L DL++GI  G++ +PQG+A++ LA + P+ GLY S +P ++Y F GTS+HISIG
Sbjct:   16 YYVERPIFS-------HPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIG 135          
BLAST of slc26a-3 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 305.834 bits (782), Expect = 4.425e-92
Identity = 181/539 (33.58%), Postives = 309/539 (57.33%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKR---------------------------SLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTE--FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDI-----RKKFHQFNSPCHINDKMVYLSIHDAVV-SILRQ 2250
            G+ Q  +G C  G +  YL++P++ GFT  ++VHVFTS +KY FGV+ + + GIF+V+ +   V++N+   N+ ++ + ++   LL+  KE  N     +   P+P+E F VV G   S  F+L +++ V +VG +  GL  P  PD  + +   VD I   I+ F+V++S+A   + KH Y +  NQE +A G+ N   S F  F  + SLSRS VQE  GGK+QL+  ++S++++ V+L  G  FE+LP  +L++I+IV LKG+FM+ ++L   WR S ++ +IWL TF+ ++ L ++YGL+   ++++ +V+ +TQ+P   +LG++ +TD+Y +I  Y E KEI GIKIFQ    +YYA+ + +   L +K G+NP  I   +R                            ++ + AT  ++ + E + P  +  KST  EE+ +     +   ++I+D +   FID++G+KT+  +++EY  + I V+L      +     R +F  F +P     ++++ SIHDAV+ S LR+
Sbjct:  187 GIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKATQDAEVDGEDATKPEEEDGEVKYPPIV-IKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRF--FENPALW--ELLFHSIHDAVLGSQLRE 719          

HSP 2 Score: 83.9593 bits (206), Expect = 5.244e-16
Identity = 44/127 (34.65%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  100 FTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKD-FQRNF-CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            + + RP  S       + +  ++L  K ++ +S  D  ++ F C+     N +    P    L  YK+KE +L DL++GI  G++ +PQG+A++ LA + P+ GLY S +P ++Y F GTS+HISIG
Sbjct:   16 YYVERPIFS-------HPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIG 135          
BLAST of slc26a-3 vs. Ensembl Celegans
Match: sulp-4 (Anion transporter SULP-4; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EEA7])

HSP 1 Score: 290.426 bits (742), Expect = 9.093e-87
Identity = 230/755 (30.46%), Postives = 387/755 (51.26%), Query Frame = 1
Query:   88 QEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILY-------KYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTAN-NEFE----RLVSNRAAGFAFFV--GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVE-IQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFR--IPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNL------YQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPD---FMEKKSTIE-EELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCH----INDKMVYLSIHDAVVSILRQRRV 2259
            + +SF + R  ++Q +FD+ ++ N   L  +++L + +K F R F     F +F   K  FIF L        +YKWK  L  D+I GI VG+M +PQG+AY+ LA    ++GLY SLFP LIY  FGTS+H S+G   +                                 V+L+T      L              TDYD ++ NE +    +L S      A  +  GL   +MG   +  LT YLSD +I+GFTVGSSVHV  SQ+K   G+  +    G F +   + +++ +I+  N  +  ++I+ I +L F KE INP++  + +  IP+P EL +V+   +      +    KV +V +I  G+P+ ++P   +    + D I   +++ +V +S++ + +K++ Y + S QE  A    ++ +SF    P++ SLSR+ V    G  +QLS   SS+++  V++F+G   E LP   L++II VAL+G+F K A+L DLW+ S +DF+IW+++ + T++LDV  GL++    ++F+ +L+ Q PK ++L  +  T  + +   Y E     GI IF+++  + + + E FKK++      +QK      E +  +   E  L T   K +  ++  D   F   +ST+     D L++      +IDCS F FID MG+  + ++  + +   I V+  + K  +R+ F +    CH    ++ +  Y ++ DA  SI RQR++
Sbjct:   36 RRVSF-VQRGAMNQAQFDEKFDYNKPHL--ENELKKQAKKFVRRF--YEPFTSFFALKL-FIFDLIPILKWFPEYKWKTDLSLDIIGGITVGVMQVPQGIAYALLAKQPAINGLYTSLFPPLIYMLFGTSRHASLGTFAV---------------------------------VSLMTGLSVEKL-----------AAPTDYDPSSFNETDIDLVKLPSPTEVSCAITITMGLILFVMGVLRLQFLTTYLSDQVIAGFTVGSSVHVLVSQLKTLLGIRGLPRHSGPFYLFRHLYDLVMSITRANPVSCGISIVSIIVLHFGKEFINPFIKRKTKSNIPIPWELVIVILSTVFVAVTGVDTEAKVQVVNKIPVGVPNFSLPSFYLIPQVLPDAISITVVSISVWLSISKMLAKRYNYELDSGQELFALSFASISSSFIPSIPNSCSLSRTLVAVGAGCTTQLSIFFSSLIVFSVVIFLGTLLETLPMAALSAIICVALQGMFRKFADLIDLWKVSKIDFTIWVVSCVSTILLDVSTGLIISVCFALFTTILREQYPKWHLLASVKGTQDFRDAERYGETVYFKGICIFRFDAPLLFHNVECFKKSIEKAYTEWQKSH----EFYVLREERETILNT---KLDGSDESIDGKMFQTAQSTLNTHSPDILSR----HFVIDCSGFTFIDLMGVSALKEIFSDMRKRGILVYFANAKAPVREMFEK----CHFFNFVSKENFYPTMRDA-TSIARQRQL 724          
BLAST of slc26a-3 vs. Ensembl Celegans
Match: sulp-6 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O45016])

HSP 1 Score: 288.886 bits (738), Expect = 1.243e-85
Identity = 230/787 (29.22%), Postives = 387/787 (49.17%), Query Frame = 1
Query:   16 MEKHSLI---TNEIELAGFRCNDGKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFA----FFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNI----------SETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYF-SLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXG-QFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKEN-QMPDFMEKKSTIE------EELDQLNKSTEFS----------IIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAV-VSILRQRRVTD 2265
            M KH L     NE E+  +  N    TQ  + +     ++Q  FD+ Y    + LS+  ++    K   +    R  +  F  G+ P    L +Y WK   L D + G++V ++ +PQ +AY  L G+ P +GL   +   +IY  FGTSKH S G   I                             +S  V  + + F          T    +   D         R+    A G A      VGL QIL G  N G L  +LSD ++ G   G++VHV TSQ+K        +   I NV  T +E  +N+           + +  ++ +++IC+ LL+ +   I+P++  +  +  PMEL +VV   L   Y  +     ++  VG+++ G+P+P +P ++ ++  +   +   II+F + +SL  + SKK  Y ++SNQE+ A G+M+  +SFF CF   +SL R+ +Q   G KSQLS+LI+SI+L+  +        ++LP  +LASI++VA+K LF++      L + S +D+ I+  TF+  ++L+V +GLL+G +  + +VVL++Q   S +LG+I  T+ Y  + LY    +I GIKIF+++  +Y+ + E F + ++Q  GLNP+ I   +   ENK    +K+ E+E+ ++P   EK++ +E      + LD+ +   E +          IIIDCS   ++D MG   +  V  +Y+ I ISV   +    +R+ F        +    +++S+ DAV  + L QR  T+
Sbjct:    1 MAKHILSPIGVNEGEILAYDVN---VTQNYTKSRQADVINQTVFDKTYLFKPEYLSLTGKIAFHLKSIGK--WKRKEWIQFARGRIPITMWLPRYTWKSNFLVDFLGGLMVSVLSVPQSLAYGMLVGVPPSYGLITGIIGPIIYALFGTSKHSSPGAFAI-----------------------------VSLMVGTVVESFGD-----VGSTNGTIDSNVDLLCCRENKPRVSDGDAIGIAASVTLLVGLFQILFGLLNAGLLAVWLSDQLVQGLISGAAVHVLTSQLK--------SMTRISNVPPT-SEPFQNVVFYMCFFKQMPDVDYASIIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNTAYEFQIPTVGQVTSGIPAPVIPPMRNAFGMMGSAMSIAIISFVIHISLCKLISKKLQYVVNSNQEWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTKSQLSTLITSIVLIIFVCGGAVGCIQHLPKPVLASIVVVAMKDLFIQIFTCFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWADSSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIHQACGLNPL-IVRGELETENKKKDARKEKEEEDAEIPKETEKETKLEVTTHQAKVLDEKHAEPEPNPADQYERLTHIIIDCSTIIYVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNFETSQFFEEVPRGRMFVSVSDAVDQAELEQRHKTE 738          
BLAST of slc26a-3 vs. Ensembl Celegans
Match: sulp-6 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O45016])

HSP 1 Score: 288.886 bits (738), Expect = 1.243e-85
Identity = 230/787 (29.22%), Postives = 387/787 (49.17%), Query Frame = 1
Query:   16 MEKHSLI---TNEIELAGFRCNDGKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFA----FFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNI----------SETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYF-SLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXG-QFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKEN-QMPDFMEKKSTIE------EELDQLNKSTEFS----------IIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAV-VSILRQRRVTD 2265
            M KH L     NE E+  +  N    TQ  + +     ++Q  FD+ Y    + LS+  ++    K   +    R  +  F  G+ P    L +Y WK   L D + G++V ++ +PQ +AY  L G+ P +GL   +   +IY  FGTSKH S G   I                             +S  V  + + F          T    +   D         R+    A G A      VGL QIL G  N G L  +LSD ++ G   G++VHV TSQ+K        +   I NV  T +E  +N+           + +  ++ +++IC+ LL+ +   I+P++  +  +  PMEL +VV   L   Y  +     ++  VG+++ G+P+P +P ++ ++  +   +   II+F + +SL  + SKK  Y ++SNQE+ A G+M+  +SFF CF   +SL R+ +Q   G KSQLS+LI+SI+L+  +        ++LP  +LASI++VA+K LF++      L + S +D+ I+  TF+  ++L+V +GLL+G +  + +VVL++Q   S +LG+I  T+ Y  + LY    +I GIKIF+++  +Y+ + E F + ++Q  GLNP+ I   +   ENK    +K+ E+E+ ++P   EK++ +E      + LD+ +   E +          IIIDCS   ++D MG   +  V  +Y+ I ISV   +    +R+ F        +    +++S+ DAV  + L QR  T+
Sbjct:    1 MAKHILSPIGVNEGEILAYDVN---VTQNYTKSRQADVINQTVFDKTYLFKPEYLSLTGKIAFHLKSIGK--WKRKEWIQFARGRIPITMWLPRYTWKSNFLVDFLGGLMVSVLSVPQSLAYGMLVGVPPSYGLITGIIGPIIYALFGTSKHSSPGAFAI-----------------------------VSLMVGTVVESFGD-----VGSTNGTIDSNVDLLCCRENKPRVSDGDAIGIAASVTLLVGLFQILFGLLNAGLLAVWLSDQLVQGLISGAAVHVLTSQLK--------SMTRISNVPPT-SEPFQNVVFYMCFFKQMPDVDYASIIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNTAYEFQIPTVGQVTSGIPAPVIPPMRNAFGMMGSAMSIAIISFVIHISLCKLISKKLQYVVNSNQEWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTKSQLSTLITSIVLIIFVCGGAVGCIQHLPKPVLASIVVVAMKDLFIQIFTCFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWADSSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIHQACGLNPL-IVRGELETENKKKDARKEKEEEDAEIPKETEKETKLEVTTHQAKVLDEKHAEPEPNPADQYERLTHIIIDCSTIIYVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNFETSQFFEEVPRGRMFVSVSDAVDQAELEQRHKTE 738          
BLAST of slc26a-3 vs. Ensembl Celegans
Match: sulp-7 (Anion transporter SULP-7a; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EGG6])

HSP 1 Score: 270.781 bits (691), Expect = 3.790e-81
Identity = 177/535 (33.08%), Postives = 285/535 (53.27%), Query Frame = 1
Query:  265 PFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNI--SETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKI 1863
            P    L  Y   E L+ D+I G+ VGI+++PQGMAY+ L GL+PV+GLY SLFP+LIY FFGTS+H+++G+  +   +S         LRV             +Q                    E + N  T+    + E E +  N        VGL QI+MG      L  YLSD II GFT G++VHV T+Q+    GV +    GI  +     ++I  I   + N+ T   +++ I +L  +K  + P    +  +P+P +LF++V G + +++F + +   V +VG+I  G P+P +PD+ +  + + D +   I++  V+VS+  + +KKH Y I   QEF A G++    S F C+P+  +L+R+ + ++ G K+Q+S++ S+++L  VL FIGQ+ E LP C+L+ I+IVAL+G+F+       LWR S  D++I+ ITF  TV LDV  GL +GT+ ++   +L+ Q     +L                +C E     +  +  S++Y +CE F + + QKI
Sbjct:   14 PITKWLPNYSISENLINDIIGGVTVGILNVPQGMAYASLVGLKPVYGLYTSLFPSLIYMFFGTSRHVALGVFAVVSLMSG-----SCNLRV-------------TQ--------------------EIISNNGTNM--TSTEVEAISINVVKSLGLAVGLIQIIMGLFKANYLISYLSDQIILGFTTGAAVHVLTAQLNKILGVALPRHSGIGKLFFIYQDLITAIIGEKVNVITFGASVVAIVILYISKYILTPRFCAKTLVPIPFDLFLIVIGTIIADWFQVEERWGVKVVGDIPTGFPNPALPDLFMFRHVIGDALAIAIVSVVVTVSMGKVIAKKHNYEIDVRQEFFALGIVASTCSMFPCWPATTALARTLINDNAGTKTQISAIFSALVLTLVLFFIGQYLEGLPMCLLSCIVIVALRGMFLHLQNFVTLWRVSKYDWAIFAITFFATVCLDVVPGLFIGTIFALLLSILRIQRSSPTLLDD--------------DCAESGKTFVVFFASSLFYFNCERFDRKI-QKI 493          
BLAST of slc26a-3 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 264.233 bits (674), Expect = 5.753e-79
Identity = 197/605 (32.56%), Postives = 308/605 (50.91%), Query Frame = 1
Query:  346 MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNP--KSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDI 2154
            MH+PQGMAY+ LAG+ PV+G+Y S F + IY FFGT++HISIG+    + ++SM      +LR+   I    N   I+  V              Y   E V              + LV   A      VG+ QI+MG   +G LT YLSD ++SGFT G++VHVFTSQ+   FG+++    GI  ++    ++I ++   N   + ++I  I  L   +  INP V     IP P+EL +V+ GI+ S  F+L   + V  V EI +G P P++P +      + D I   ++ +   +S+  +F+KKH Y   + QE  A G+ +  +SFF  +P  ASLSRS+V E  G  +QL ++ SS LL+ V+L +G F E LP CILA I+IV+LK LFM+  EL  L+R S  DF+IWL+  L T+  DV  GL++    S++++VL+ Q P   + +  +  + ++  N            +KI ++ GS+++A+   F+ ++ + IG                      K  +E+ + D                   E +II+D S+  FID MG+  +  V ++   + + VF   L  D+
Sbjct:    1 MHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGV----FAVASMMV-GAARLRLAPDIPI-SNSSDINPSV--------------YPLGEYV--------------DPLVFTSA--LTLLVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFLDLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIPRLNFLPALLSDAIPIAVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPSFSTVLHDETPRQNVPEN------------VKIVKFAGSLHFANVTAFQDDMGEAIG----------------------KLPEEDPLID-------------------ERTIILDASSVAFIDIMGVDALRDVFKDALKLGVHVFYCGLPEDV 516          
BLAST of slc26a-3 vs. Ensembl Fly
Match: Prestin (gene:FBgn0036770 transcript:FBtr0075153)

HSP 1 Score: 299.286 bits (765), Expect = 5.397e-90
Identity = 214/695 (30.79%), Postives = 366/695 (52.66%), Query Frame = 1
Query:  124 SQYEFDQNYEINTDQLS---IKSQLIESSKDFQ-----RNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSM----------NP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNIT-TDYDTANNEFERLVSNR---AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQI-DKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTS 2139
            S+ +    Y I+ D L+   +  Q   +++D       RN     NF+    G  P +  L +Y  +  L  D+I G  V IM+IP GMAY  LAG+   +GLY+++FP L Y F GTSKHISIG     + ++SM          N  D  Q+          N    +  + LI          +    ++V + T + +   N+        +   A   A  VG+  +LM    +G+L+  LS+P+++GFT  ++ HV T+Q+K   G+ +    G F +I T+ +VIK + +TN+      +  I+ ++   E + P +  + R P+P EL +V+GG L S++F+L+ ++ V  VG+I  GLP P +P + +     VD I   I+ +++ +S+   F+KKH Y +  NQE  A G+ N+    FSC P A SLSRS +Q+  GG SQ++SL+S+ L+V  L++IG FF +LP C+LA +IIVALK +FM+  ELK   +   ++   W+ TFL  VI+D++ GLL+G  +S+ ++ +K   P S +LG + +   IY +++ +    ++  ++IF+Y GS+ +A+   F++ LY+ +GL+ I +      + +  +    K  K +  P        I  +L++ + + +  +++D S    ID  G +T+  + +E ++    + L S
Sbjct:   27 SKPKIQPKYSIHRDVLTHEVVIKQTGYAARDKSIPSSLRNCWRSWNFFALFTGVIPILQWLPQYSPRRDLPGDIIAGFTVAIMNIPHGMAYGILAGVSAGNGLYMAVFPVLAYMFLGTSKHISIGT----FAVASMMTAKVVDTYANVDDHHQILPINAFGLQSNGTATASPLLLIN---------SSALADSVSSTTISPFQLLNSTLNADPITKIEVATSLALTVGIVNLLMAFLRLGTLSSLLSEPLVNGFTTAAACHVVTAQLKDVLGISVPRHKGAFKIIYTVIDVIKGVPQTNLVNFGFCMAVIAFMMICNEILKPRLSKKCRFPLPAELIMVIGGTLISKWFNLYVDYNVNPVGKIPSGLPEPVLPRLDLVPKVAVDSIAIAIVTYSIIMSMGLTFAKKHGYEVRPNQELFAMGIGNMVGGCFSCIPMACSLSRSVIQDQTGGVSQIASLVSASLVVVTLMWIGPFFSSLPRCVLAGVIIVALKPMFMQAKELKKFSKQGKLEMFTWISTFLCVVIIDIDIGLLIGICISLLALYIKGLKPYSCLLGYMPEAPGIYMDLNQHRNAMQVPEVRIFRYSGSLNFATSLFFRRALYEAVGLDKIPL----TKVSSSNSNSPSKGSKSSYSPVSQNGGKAINGKLEETSGAFKV-LVLDFSMLGHIDVAGCRTLTDLSKELKVRGARLLLAS 703          
BLAST of slc26a-3 vs. Ensembl Fly
Match: Esp (gene:FBgn0013953 transcript:FBtr0304054)

HSP 1 Score: 121.709 bits (304), Expect = 2.736e-28
Identity = 147/597 (24.62%), Postives = 256/597 (42.88%), Query Frame = 1
Query:   58 GFRCNDGKQTQEISFTITRPTLSQ----YEFDQNYEINTDQLSIKSQLIESSKDFQRNF---CSRNNF-YNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQ--TFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTK-------------------EAINP--YVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVD----------------IIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFM-KCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPK 1704
            GF+C+    T  IS  +T P  S      +  + + +  D   +K  +  S+ D  R++   C R  F    L  + P +  L KY  ++ +  DL+ GI VG+  IPQ +AY+ +AGL   +GLY S     +Y F G+ K +             M P                     S  V L+T                       Y  A   +++ V           G+ ++LMG   +G L  ++S P+ SGFT   S+ + TSQI+   G+  +  TF  I+      T+V  NI  T      + + CI +L+  +                    A+N   +++   R  + + +  ++G +L +E           +VGEI  GLPS  +P   ++ N   +                +++  +I+   ++++   F+      + ++QE +A G  N+F SF   FP   +LSR AV  + G ++ LS++ S  L++  LLF+  +F  +P   LA+III A+  +FM +   +K +WR    D    + TF+  ++L +E+G+L+G  L++  ++     PK
Sbjct:   15 GFKCS----TISISTNLTEPNGSSNSVGSQGSKEFILTEDGKKVKPTV--STLDCTRSWLQDCQRRTFNRKTLHKRLPILGWLPKYNSQDAV-GDLVAGITVGLTVIPQALAYAGIAGLPVAYGLYASFVGCFVYIFLGSCKDVP------------MGP---------------------SAIVALLT-----------------------YQAAQGSWQKSVL-----LCLLSGIVELLMGLFGLGFLIDFVSGPVSSGFTSAVSLIILTSQIQSVLGITAKGNTFVEIW------TQVFHNIEHTRAGDTVLGLTCIVILLLMRSLSSCRIGPVDEKECSSFQRAVNKILWIVGTARNAILVVVCCIMGYMLHTE----EHGAPFRVVGEIPPGLPSIQLPPTSLTANETSNGVAEGFVEMVHSMGSGLVVIPLISLMENIAICKAFANGK--PVDASQELIAIGTANIFNSFVQAFPGTGALSRGAVNNASGVRTPLSNIYSGGLVMIALLFLTPYFYFIPRPTLAAIIISAV--VFMIEVKVVKPMWRSKKSDLVPGVGTFVACLVLPLEWGILIGVGLNVIFILYHAARPK 529          
BLAST of slc26a-3 vs. Ensembl Fly
Match: Esp (gene:FBgn0013953 transcript:FBtr0084703)

HSP 1 Score: 121.709 bits (304), Expect = 2.736e-28
Identity = 147/597 (24.62%), Postives = 256/597 (42.88%), Query Frame = 1
Query:   58 GFRCNDGKQTQEISFTITRPTLSQ----YEFDQNYEINTDQLSIKSQLIESSKDFQRNF---CSRNNF-YNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQ--TFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTK-------------------EAINP--YVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVD----------------IIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFM-KCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPK 1704
            GF+C+    T  IS  +T P  S      +  + + +  D   +K  +  S+ D  R++   C R  F    L  + P +  L KY  ++ +  DL+ GI VG+  IPQ +AY+ +AGL   +GLY S     +Y F G+ K +             M P                     S  V L+T                       Y  A   +++ V           G+ ++LMG   +G L  ++S P+ SGFT   S+ + TSQI+   G+  +  TF  I+      T+V  NI  T      + + CI +L+  +                    A+N   +++   R  + + +  ++G +L +E           +VGEI  GLPS  +P   ++ N   +                +++  +I+   ++++   F+      + ++QE +A G  N+F SF   FP   +LSR AV  + G ++ LS++ S  L++  LLF+  +F  +P   LA+III A+  +FM +   +K +WR    D    + TF+  ++L +E+G+L+G  L++  ++     PK
Sbjct:   15 GFKCS----TISISTNLTEPNGSSNSVGSQGSKEFILTEDGKKVKPTV--STLDCTRSWLQDCQRRTFNRKTLHKRLPILGWLPKYNSQDAV-GDLVAGITVGLTVIPQALAYAGIAGLPVAYGLYASFVGCFVYIFLGSCKDVP------------MGP---------------------SAIVALLT-----------------------YQAAQGSWQKSVL-----LCLLSGIVELLMGLFGLGFLIDFVSGPVSSGFTSAVSLIILTSQIQSVLGITAKGNTFVEIW------TQVFHNIEHTRAGDTVLGLTCIVILLLMRSLSSCRIGPVDEKECSSFQRAVNKILWIVGTARNAILVVVCCIMGYMLHTE----EHGAPFRVVGEIPPGLPSIQLPPTSLTANETSNGVAEGFVEMVHSMGSGLVVIPLISLMENIAICKAFANGK--PVDASQELIAIGTANIFNSFVQAFPGTGALSRGAVNNASGVRTPLSNIYSGGLVMIALLFLTPYFYFIPRPTLAAIIISAV--VFMIEVKVVKPMWRSKKSDLVPGVGTFVACLVLPLEWGILIGVGLNVIFILYHAARPK 529          
BLAST of slc26a-3 vs. Ensembl Fly
Match: CG5002 (gene:FBgn0034275 transcript:FBtr0089546)

HSP 1 Score: 104.375 bits (259), Expect = 7.849e-23
Identity = 127/539 (23.56%), Postives = 228/539 (42.30%), Query Frame = 1
Query:  163 DQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSM--AIICISLLIFTKEAINPYVMLRFR------------IPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIK-------ISYNYVVDIIITG-----IIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNP 1701
            +QL   S LI   +D  R  C  +   N    KFP +  L +Y+  E +++D I G  VG+  IPQ +AY  +AGL P +GLY +      Y  FG+ K ++I    I                            +++QY T+  D+                                    A    F  G   +L+G  NMG L +++S P+I+GFT+ ++  + ++QI    G+   +        N +    KN   T++ ++ +  A++ +S L+F        +M R +            + +      V+ G   +   S   N    + G I+ G+P   +P          +S+  ++  +        +I+    V+++  FSK     + ++QE +A GM N+  SF    P   S +R+AV  + G K+ L   ++  L++  L F+ Q F  +P C LA+III A+  L ++  ++KD+W+    D   +++T L  +   +EYG+L G   ++  ++  +  P
Sbjct:   11 EQLPNVSTLI---RDGGRKLCRPSTVTN----KFPILKWLPRYR-LEYIMQDFIAGFTVGLTTIPQAIAYGVVAGLEPQYGLYSAFMGCFTYIVFGSCKDVTIATTAIMAL-------------------------MVNQYATISPDY------------------------------------AVLVCFLAGCIVLLLGLLNMGVLVRFISIPVITGFTMAAATTIGSAQINNIVGLTSPS--------NDLLPAWKNFF-THLTSIRLWDALLGVSSLVFL------LLMTRVKDIKWGNRIFWKYLGLSRNALAVIFGTFLAYILSRDGNQPFRVTGNITAGVPPFRLPPFSTTVDGEYVSFGEMISTVGASLGSIPLISILEIVAISKAFSKGKI--VDASQEMVALGMCNIMGSFVLSMPVTGSFTRTAVNNASGVKTPLGGAVTGALVLMALAFLTQTFYFIPKCTLAAIIIAAMISL-VELHKIKDMWKSKKKDLFPFVVTVLTCMFWSLEYGILCGIGANMVYILYSSARP 462          
BLAST of slc26a-3 vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0346109)

HSP 1 Score: 90.5077 bits (223), Expect = 1.801e-18
Identity = 94/385 (24.42%), Postives = 183/385 (47.53%), Query Frame = 1
Query:  724 FAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVL----------------------IVGEISKGLPSPTMPDIKISY---NYVV---------DIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFM-KCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPK----------SYILGQIDKTDIY 1743
             AF  GL ++ MG   +G +  ++  P+   FT G+++ V  +QIK   GV I+ F        +I +   NI  T+    +M I C+ +L+  +      V  +   PV   L  ++       Y S+ +N  V+                      +  ++S  +P+  +P     Y    YV           I++  I+A   +V++A  F K    ++ ++QE L  G+ N+  SFFS  P+  + +RSAV ++ G ++ ++ + + ++++  L  +  +F+ +P   L++++I A+  +FM   A +K+LW+ +  DF  W+ +F+  ++  VE GLL G +LS+  ++L+  NPK          +Y +  + ++D+Y
Sbjct:  148 LAFLAGLVELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIKGF-------PSIGDFFTNIRPTD---AAMGISCMVVLLSLRLLSQ--VNFKQDTPVTRRLKKILW------YISISRNALVVFFTGLLVFIWVKKSSIEAVPFALSSKVSSAMPTIKLPPFAFEYQNRTYVFTDILHELGSGIVVVPIVAVLANVAIAKAFVKDG--NLDASQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAV--IFMIDLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPKFEVTLKQHESTYYVHIVPQSDVY 510          

HSP 2 Score: 58.5362 bits (140), Expect = 1.555e-8
Identity = 28/59 (47.46%), Postives = 38/59 (64.41%), Query Frame = 1
Query:  298 KECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            +E    DLI GI +G+  IPQ +AY+ LAGL   +GLY +   ++IY FFGT   +SIG
Sbjct:   66 REQAFADLIAGITLGLTIIPQSIAYAALAGLSSEYGLYSAFIGSIIYVFFGTIPQVSIG 124          
BLAST of slc26a-3 vs. Ensembl Zebrafish
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 363.229 bits (931), Expect = 7.161e-114
Identity = 232/741 (31.31%), Postives = 386/741 (52.09%), Query Frame = 1
Query:  178 KSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG-LKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK------------------------RSLENKLATIQKKFEKE----------------NQMPDFMEKKSTIEEELDQLNKSTE-----FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQR 2253
            +  L E  +D  R  C+   +  ++    P +  +  Y  +E  L DL++G+ VGIMH+PQGMAY+ LA + PV GLY S +P L+YF FGTSKHISIG    I   I S++                           L  D   H+L      T   + +    DT   + +RL    AA      G+ Q+L+G    G +  YLS+P++ G+T G++ H  T+Q+KY FGV  + F G   ++ T+ E+   + +T++PT+ ++++ ++ L+  KE IN     R  +P+P+EL V+  G L S Y  +   + V +VGEI KGL  P +P++    +   D     ++ +A+S+SL  IF+ KH Y + SNQE +A G+ N    FF C+   +S+SRS +QES GGK+Q++ LIS+++++  +L +G  FE LP  +L++I+ V LKG+FM+C +L  LWR + +D  +WL+TFL TV+L+++ GL      ++ +V+ +TQ P+  +LG++  T++Y     Y   K I GI IF+    +YYA+ E + + L +K G+N  +I   K                        R L N++       E +                N    F  ++ T E+E  + N  +       SII+D S+  FID + +KTI  +  +Y  ++++V+++  +  + ++  +   F+    ++ + ++ SIHDAV+  L  R
Sbjct:   41 EPSLKEKIRDSLR--CTVGQWKVWILAWMPVLSWIPCYSIRENGLGDLVSGVSVGIMHLPQGMAYALLASVPPVFGLYTSFYPVLVYFIFGTSKHISIGTFAVISIMIGSVSE-------------------------RLAPD--GHFL------TNGTNGLVV-VDTEARDLQRL--KVAAATTLLCGIFQVLLGVVRFGFVVTYLSEPLVRGYTTGAAAHAITAQLKYMFGVSPRRFTGPLQLLYTLVELCGLLPQTHVPTLVVSLVSLTALVIVKE-INSCYSHRLPLPIPIELMVITAGTLISHYTEMKTINGVDVVGEIPKGLMPPRVPEVCFFSSVAGDAFAVAVVGYAISISLGKIFALKHGYKVDSNQELVALGLSNTIGGFFQCYAVTSSMSRSLIQESTGGKTQVAGLISAVIVLITVLKLGPLFEELPTAVLSTIVFVNLKGMFMQCRDLPALWRSNKVDLLVWLVTFLCTVLLNLDLGLAASITFTLLTVIFRTQRPRYSLLGRVPDTELYLETESYKAAKAIPGITIFRSSTMIYYANAELYHEALLEKSGINIPKILELKKRKEEEEKSKKGQAKDQDKQTGVLRELLNRMLVSLHHHETDHEHIVNDTSIATVTQGNTNCSFQSEQVTEEQEWGKTNTHSSSCEQTHSIILDFSSVSFIDTVTLKTIQNICRDYAKVDVTVYISGCQACVVQQLERGGFFSG--SVSKRRLFPSIHDAVLHCLSNR 740          
BLAST of slc26a-3 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 360.533 bits (924), Expect = 1.195e-113
Identity = 232/729 (31.82%), Postives = 388/729 (53.22%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNR---AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEK-----ENQMPD--FMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQR 2253
            S  I R   ++  F Q Y    DQ   + +L +  +  QR  CS+    + L  + P    L KYK ++ LL D+I G+ VGI+HIPQGMA++ L  + PV+GLY S FP ++Y  FGT  H+S G     + + S+                                        T    E +  I    ++++ E     + R   A+  AF  G+  + M    +G L+ YLS+PI+  FT  ++ HV  SQ++   G+ +  + G F++  T+  V++N+  TN+  + ++++C+++L+  KE +N     R R P+P+E+  V+     +  FSL   + + IVG I  G P P +P ++       D +   ++A+AVSVSLA I++ KH YSI  NQE LA+G+ N  +S F+CFP++A+L+ + + ES GG +QL+ L +S++++ VLL IG  F  LP  +LA I + +L+ +F++  +L +LWR S +DF +WL+T+L  V+L+V+ GL +G + S+ +VV +TQ     +LG+   T+IY +I+ +++C E+ G+KI  Y G +YY +   FK ++ Q +GL P  I    RS E  L  I+K+  +     E  + D  F  K      E+ +       +++IDCS+  F+D  G +   Q+  E Q I + ++L +    + K         ++N + ++++IHDAVV I +QR
Sbjct:    4 SVAIYRNIYTEDRFRQTYGTE-DQSGGRERLRD--RLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGT----FAVLSL---------------------------------------MTGSVVEQLVPIPLALNSSSPEAAEFEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVIIATGITYAFSLDSKYDIQIVGHIPAGFPEPRLPALETVPEIAGDTVAITLVAYAVSVSLAMIYADKHGYSIDPNQELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERI----RSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSEMAEGEVQ---AVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYIQQQR 678          
BLAST of slc26a-3 vs. Ensembl Zebrafish
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 362.459 bits (929), Expect = 3.141e-113
Identity = 232/745 (31.14%), Postives = 388/745 (52.08%), Query Frame = 1
Query:  178 KSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG-LKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK------------------------RSLENKLATIQKKFEKE----------------NQMPDFMEKKSTIEEELDQLNKSTE-----FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQRRVTD 2265
            +  L E  +D  R  C+   +  ++    P +  +  Y  +E  L DL++G+ VGIMH+PQGMAY+ LA + PV GLY S +P L+YF FGTSKHISIG    I   I S++                           L  D   H+L      T   + +    DT   + +RL    AA      G+ Q+L+G    G +  YLS+P++ G+T G++ H  T+Q+KY FGV  + F G   ++ T+ E+   + +T++PT+ ++++ ++ L+  KE IN     R  +P+P+EL V+  G L S Y  +   + V +VGEI KGL  P +P++    +   D     ++ +A+S+SL  IF+ KH Y + SNQE +A G+ N    FF C+   +S+SRS +QES GGK+Q++ LIS+++++  +L +G  FE LP  +L++I+ V LKG+FM+C +L  LWR + +D  +WL+TFL TV+L+++ GL      ++ +V+ +TQ P+  +LG++  T++Y     Y   K I GI IF+    +YYA+ E + + L +K G+N  +I   K                        R L N++       E +                N    F  ++ T E+E  + N  +       SII+D S+  FID + +KTI  +  +Y  ++++V+++  +  + ++  +   F+    ++ + ++ SIHDAV+  L  R ++ 
Sbjct:   41 EPSLKEKIRDSLR--CTVGQWKVWILAWMPVLSWIPCYSIRENGLGDLVSGVSVGIMHLPQGMAYALLASVPPVFGLYTSFYPVLVYFIFGTSKHISIGTFAVISIMIGSVSE-------------------------RLAPD--GHFL------TNGTNGLVV-VDTEARDLQRL--KVAAATTLLCGIFQVLLGVVRFGFVVTYLSEPLVRGYTTGAAAHAITAQLKYMFGVSPRRFTGPLQLLYTLVELCGLLPQTHVPTLVVSLVSLTALVIVKE-INSCYSHRLPLPIPIELMVITAGTLISHYTEMKTINGVDVVGEIPKGLMPPRVPEVCFFSSVAGDAFAVAVVGYAISISLGKIFALKHGYKVDSNQELVALGLSNTIGGFFQCYAVTSSMSRSLIQESTGGKTQVAGLISAVIVLITVLKLGPLFEELPTAVLSTIVFVNLKGMFMQCRDLPALWRSNKVDLLVWLVTFLCTVLLNLDLGLAASITFTLLTVIFRTQRPRYSLLGRVPDTELYLETESYKAAKAIPGITIFRSSTMIYYANAELYHEALLEKSGINIPKILELKKRKEEEEKSKKGQAKDQDKQTGVLRELLNRMLVSLHHHETDHEHIVNDTSIATVTQGNTNCSFQSEQVTEEQEWGKTNTHSSSCEQTHSIILDFSSVSFIDTVTLKTIQNICRDYAKVDVTVYISGCQACVVQQLERGGFFSG--SVSKRRLFPSIHDAVLHCLSNRDLSS 744          
BLAST of slc26a-3 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 343.584 bits (880), Expect = 2.057e-107
Identity = 226/722 (31.30%), Postives = 381/722 (52.77%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNR---AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQR 2253
            S  I R   ++  F Q Y    DQ   + +L +  +  QR  CS+    + L  + P    L KYK ++ LL D+I G+ VGI+HIPQGMA++ L  + PV+GLY S FP ++Y  FGT  H+S G     + + S+                                        T    E +  I    ++++ E     + R   A+  AF  G+  + M    +G L+ YLS+PI+  FT  ++ HV  SQ++   G+ +  + G F++  T+  V++N+  TN+  + ++++C+++L+  KE +N     R R P+P+E+  V G  L S +       K L++       P P +P ++       D +   ++A+AVSVSLA I++ KH YSI  NQE LA+G+ N  +S F+CFP++A+L+ + + ES GG +QL+ L +S++++ VLL IG  F  LP  +LA I + +L+ +F++  +L +LWR S +DF +WL+T+L  V+L+V+ GL +G + S+ +VV +TQ     +LG+   T+IY +I+ +++C E+ G+KI  Y G +YY +   FK ++ Q +GL P  I    RS E  L  I+K+  +     +     S+   + D        +++IDCS+  F+D  G +   Q+  E Q I + ++L +    + K         ++N + ++++IHDAVV I +QR
Sbjct:    4 SVAIYRNIYTEDRFRQTYGTE-DQSGGRERLRD--RLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGT----FAVLSL---------------------------------------MTGSVVEQLVPIPLALNSSSPEAAEFEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVNG--LESTWM------KCLLI----FSFPEPRLPALETVPEIAGDTVAITLVAYAVSVSLAMIYADKHGYSIDPNQELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERI----RSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYIQQQR 662          
BLAST of slc26a-3 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 343.584 bits (880), Expect = 2.057e-107
Identity = 226/722 (31.30%), Postives = 381/722 (52.77%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNR---AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQR 2253
            S  I R   ++  F Q Y    DQ   + +L +  +  QR  CS+    + L  + P    L KYK ++ LL D+I G+ VGI+HIPQGMA++ L  + PV+GLY S FP ++Y  FGT  H+S G     + + S+                                        T    E +  I    ++++ E     + R   A+  AF  G+  + M    +G L+ YLS+PI+  FT  ++ HV  SQ++   G+ +  + G F++  T+  V++N+  TN+  + ++++C+++L+  KE +N     R R P+P+E+  V G  L S +       K L++       P P +P ++       D +   ++A+AVSVSLA I++ KH YSI  NQE LA+G+ N  +S F+CFP++A+L+ + + ES GG +QL+ L +S++++ VLL IG  F  LP  +LA I + +L+ +F++  +L +LWR S +DF +WL+T+L  V+L+V+ GL +G + S+ +VV +TQ     +LG+   T+IY +I+ +++C E+ G+KI  Y G +YY +   FK ++ Q +GL P  I    RS E  L  I+K+  +     +     S+   + D        +++IDCS+  F+D  G +   Q+  E Q I + ++L +    + K         ++N + ++++IHDAVV I +QR
Sbjct:    4 SVAIYRNIYTEDRFRQTYGTE-DQSGGRERLRD--RLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGT----FAVLSL---------------------------------------MTGSVVEQLVPIPLALNSSSPEAAEFEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVNG--LESTWM------KCLLI----FSFPEPRLPALETVPEIAGDTVAITLVAYAVSVSLAMIYADKHGYSIDPNQELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERI----RSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYIQQQR 662          
BLAST of slc26a-3 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 373.244 bits (957), Expect = 1.813e-118
Identity = 233/687 (33.92%), Postives = 382/687 (55.60%), Query Frame = 1
Query:  226 SRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAA-------GFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQ------MPDFMEKKSTIEEELDQLNKS--TEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFN--SPCHINDKMVYLSIHDAVV 2235
            +++  Y+F+    P +  L +Y  KE LL D+I+G+  G+M +PQG+AY+ LAG+ PV+GLY S +P  +Y FFG+S+HISIG     + + S+                     +I      I               + + +I     T + +F+  +  R A             G+ Q+ +G    G +  YL++P++ GFT  ++VHVFTSQ+KY  GV+ + F     VI +   V+ NI   N+ T+ + + CI LL+  KE IN     +  +P+PME+ VV+     S   +L ++H V +VG+I  G   P +PDI +     VD +   I+ F++++S+A IF+ KH Y +S NQE +A G+ N   SFF  F    S+SRS VQES GG +Q++ L+SS++++ V++ IG  F+ LP  +LA+I++V LKG+F + A++  LWR S ++ SIW+++FL +V L ++YGLLV    +I +V+ +TQ+P+  ILGQ+  TDIYC++  Y E KE   IKIFQ   S+Y+A+ E +   L +K G++P  I   K+  + + A   KK  K  +      + D++   +T  +EL+       +   II+D +   F+D++G+KT+  +I+EY+ I ++V ++     + K     N   P +  D +++ SIHDAV+
Sbjct:    9 AKSQLYSFI----PILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGT----FAVISL---------------------MIGGVAVRIAP-------------DEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQKRHAREMKKANKTEKKAVLKLVSDYVNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFFDPSNKRD-ILFHSIHDAVI 651          
BLAST of slc26a-3 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 367.851 bits (943), Expect = 1.374e-115
Identity = 241/761 (31.67%), Postives = 401/761 (52.69%), Query Frame = 1
Query:   88 QEISFTITRPTLSQYEFDQNYEINTDQL-SIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAA-------GFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMP--------------DFMEKKSTIEEELDQLNKSTEFS---------------------IIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFN--SPCHINDKMVYLSIHDAVV 2235
            Q   + + RP  +Q   ++   +  D+  S+  ++ +S +   +   +++  Y+F+    P +  L +Y  KE LL D+I+G+  G+M +PQG+AY+ LAG+ PV+GLY S +P  +Y FFG+S+HISIG     + + S+                     +I      I               + + +I     T + +F+  +  R A             G+ Q+ +G    G +  YL++P++ GFT  ++VHVFTSQ+KY  GV+ + F     VI +   V+ NI   N+ T+ + + CI LL+  KE IN     +  +P+PME+ VV+     S   +L ++H V +VG+I  G   P +PDI +     VD +   I+ F++++S+A IF+ KH Y +S NQE +A G+ N   SFF  F    S+SRS VQES GG +Q++ L+SS++++ V++ IG  F+ LP  +LA+I++V LKG+F + A++  LWR S ++ SIW+++FL +V L ++YGLLV    +I +V+ +TQ+P+  ILGQ+  TDIYC++  Y E KE   IKIFQ   S+Y+A+ E +   L +K G++P  I   K+  + + A   KK  K  +                + M   S I+   +  N  +E +                     II+D +   F+D++G+KT+  +I+EY+ I ++V ++     + K     N   P +  D +++ SIHDAV+
Sbjct:   13 QRQMYCVERPVFTQEYVEEQLHLRKDEPKSLVHKIKQSCRCTSKK--AKSQLYSFI----PILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGT----FAVISL---------------------MIGGVAVRIA-------------PDEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQKRHAREMKKANKTEKKAVLKLTNDVEMAVKHELMNDDSIIDMAANGRNGLSERNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFFDPSNKRD-ILFHSIHDAVI 727          
BLAST of slc26a-3 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 350.903 bits (899), Expect = 5.569e-110
Identity = 233/704 (33.10%), Postives = 373/704 (52.98%), Query Frame = 1
Query:  226 SRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAA-------GFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMP-----DFMEKKSTIEEELDQLNKSTEFS---------------------IIIDCSNFQFIDAMGMKTINQV-IEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            +++  Y+F+    P +  L +Y  KE LL D+I+G+  G+M +PQG+AY+ LAG+ PV+GLY S +P  +Y FFG+S+HISIG     + + S+                     +I      I               + + +I     T + +F+  +  R A             G+ Q+ +G    G +  YL++P++ GFT  ++VHVFTSQ+KY  GV+ + F     VI +   V+ NI   N+ T+ + + CI LL+  KE IN     +  +P+PME+ VV+     S   +L ++H V +VG+I  G   P +PDI +     VD +   I+ F++++S+A IF+ KH Y +S NQE +A G+ N   SFF  F    S+SRS VQES GG +Q++ L+SS++++ V++ IG  F+ LP  +LA+I++V LKG+F + A++  LWR S ++ SIW+++FL +V L ++YGLLV    +I +V+ +TQ+P+  ILGQ+  TDIYC++  Y E KE   IKIFQ   S+Y+A+ E +   L +K G++P  I   K+  + + A   KK  K  +       + M   S I+   +  N  +E +                     II+D +   F+D++G+KT+  V +    + +++ F  S K DI   FH               SIHDAV+
Sbjct:    7 AKSQLYSFI----PILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGT----FAVISL---------------------MIGGVAVRIAP-------------DEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQKRHAREMKKANKTEKKAMAVKHELMNDDSIIDMAANGRNGLSERNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSVRLVVKDLTSLNFFDPSNKRDIL--FH---------------SIHDAVI 650          
BLAST of slc26a-3 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 350.903 bits (899), Expect = 7.059e-110
Identity = 227/690 (32.90%), Postives = 370/690 (53.62%), Query Frame = 1
Query:  226 SRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAA-------GFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTE------------FSIIIDCSNFQFIDAMGMKTINQV-IEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            +++  Y+F+    P +  L +Y  KE LL D+I+G+  G+M +PQG+AY+ LAG+ PV+GLY S +P  +Y FFG+S+HISIG     + + S+                     +I      I               + + +I     T + +F+  +  R A             G+ Q+ +G    G +  YL++P++ GFT  ++VHVFTSQ+KY  GV+ + F     VI +   V+ NI   N+ T+ + + CI LL+  KE IN     +  +P+PME+ VV+     S   +L ++H V +VG+I  G   P +PDI +     VD +   I+ F++++S+A IF+ KH Y +S NQE +A G+ N   SFF  F    S+SRS VQES GG +Q++ L+SS++++ V++ IG  F+ LP  +LA+I++V LKG+F + A++  LWR S ++ SIW+++FL +V L ++YGLLV    +I +V+ +TQ+P+  ILGQ+  TDIYC++  Y E KE   IKIFQ   S+Y+A+ E +   L +K G++P  I   K+  + +   ++ +   ++ + D          E +  N  ++              II+D +   F+D++G+KT+  V +    + +++ F  S K DI   FH               SIHDAV+
Sbjct:   26 AKSQLYSFI----PILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGT----FAVISL---------------------MIGGVAVRIAP-------------DEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQKRHMAVKHELMNDDSIIDMAANGRNGLSERNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSVRLVVKDLTSLNFFDPSNKRDIL--FH---------------SIHDAVI 655          
BLAST of slc26a-3 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 352.443 bits (903), Expect = 1.203e-109
Identity = 240/765 (31.37%), Postives = 396/765 (51.76%), Query Frame = 1
Query:   88 QEISFTITRPTLSQYEFDQNYEINTDQL-SIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAA-------GFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMP------------------DFMEKKSTIEEELDQLNKSTEFS---------------------IIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFN--SPCHINDKMVYLSIHDAVV 2235
            Q   + + RP  +Q   ++   +  D+  S+  ++ +S +   +   +++  Y+F+    P +  L +Y  KE LL D+I+G+  G+M +PQG+AY+ LAG+ PV+GLY S +P  +Y FFG+S+HISIG     + + S+                     +I      I               + + +I     T + +F+  +  R A             G+ Q+ +G    G +  YL++P++ GFT  ++VHVFTSQ+KY  GV+ + F     VI +   V+ NI   N+ T+ + + CI LL+  KE IN     +  +P+PME+ VV+     S   +L ++H V +VG+I  G   P +PDI +     VD +   I+ F++++S+A IF+ KH Y +S NQE +A G+ N   SFF  F    S+SRS VQES GG +Q++ L+SS++++ V++ IG  F+ LP  +LA+I++V LKG+F + A++  LWR S ++ SIW+++FL +V L ++YGLLV    +I +V+ +TQ+P+  ILGQ+  TDIYC++  Y E KE   IKIFQ   S+Y+A+ E +   L +K G++P  I   K+  + + A   KK  K  +                    + M   S I+   +  N  +E +                     II+D +   F+D++G+KT+  V     + N  + +TS    + K     N   P +  D +++ SIHDAV+
Sbjct:   13 QRQMYCVERPVFTQEYVEEQLHLRKDEPKSLVHKIKQSCRCTSKK--AKSQLYSFI----PILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGT----FAVISL---------------------MIGGVAVRIA-------------PDEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQKRHAREMKKANKTEKKAVLKLVSDYTNDVEMAVKHELMNDDSIIDMAANGRNGLSERNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSVSTLCNMFN-PLCITSAGGLVVKDLTSLNFFDPSNKRD-ILFHSIHDAVI 730          
BLAST of slc26a-3 vs. Ensembl Mouse
Match: Slc26a4 (solute carrier family 26, member 4 [Source:MGI Symbol;Acc:MGI:1346029])

HSP 1 Score: 317.39 bits (812), Expect = 2.290e-96
Identity = 221/766 (28.85%), Postives = 394/766 (51.44%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEIN-TDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGL-----KFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK----RSLENKLATIQKKFEKENQMPDFMEKKST-------------------IEEELD---------QLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 2271
            S+T++RP  S+  F Q  E    ++ +++  L  S        CSR   +  +    P +  L KY+ KE LL D+I+G+  G++   QGMAY+ LA +    GLY + FP L YF FGTS+HIS+G        +   + SM P D                               H+L        +  N TT  DT   +  R++   A+     VG+ Q++ G   +G + +YL+DP++ GFT  ++  V  SQ+K    V  + + GI ++I T+ E+ +NI +TNI      ++ I + +  KE +N     R  +P+P+E+ V +     S   +L KN+   IV  I  G   P +P + +  + +       ++A+A++VS+  +++ KH Y I  NQEF+A+G+ NVF+ FFSCF +  +LSR+AVQES GGK+Q++ LIS+++++  ++ +G+  E L   +LA+++I  LKG+FM+  ++  LW+ +  D  IW+ T + ++IL ++ GLL G + ++ +VVL+ Q P    LG +  TDIY +I+ Y   +E  G+KI ++   ++Y + + FKK +   +G + I ++ K+    R ++  +   Q +  K   + D     +                    IE ++D          + K    S+++DC    F+D +G++++  +++E+Q I+++V+   L+ D+ +K  Q   F+   +I     +L++HDA++ +  Q +  + Q
Sbjct:   19 SYTVSRPVYSELAFQQQRERRLPERRTLRDSLARSCS------CSRKRAFGVVKTLLPILDWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVQFGLYSAFFPILTYFVFGTSRHISVGPFPVVSLMVGSVVLSMAPDD-------------------------------HFL--VPSGNGSALNSTT-LDTGTRDAARVL--LASTLTLLVGIIQLVFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGILSIIYTLIEIFQNIGDTNIADFIAGLLTIIVCMAVKE-LNDRFKHRIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPSGFLPPVLPSVGLFSDMLAASFSIAVVAYAIAVSVGKVYATKHDYVIDGNQEFIAFGISNVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWKQNKTDAVIWVFTCIMSIILGLDLGLLAGLLFALLTVVLRVQFPSWNGLGSVPSTDIYKSITHYKNLEEPEGVKILRFSSPIFYGNVDGFKKCINSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRATKNGIISDIGSSNNAFEPDEDVEEPEELNIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFALLQDDVLEKMEQCGFFDD--NIRKDRFFLTVHDAILHLQNQVKSREGQ 739          
BLAST of slc26a-3 vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 310.457 bits (794), Expect = 1.747e-94
Identity = 179/529 (33.84%), Postives = 299/529 (56.52%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLA--------------TIQKKFEKENQMPDFMEK----------KSTIEEELDQLNKSTE--FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVS 2238
            G+ Q  +G C  G +  YL++P++ GFT  ++VHVFTS +KY FGV+ + + GIF+V+ +   V++N+   N+ ++ + ++   LL+  KE  N     +   P+P+E F VV G   S  F+LH+++ V +VG +  GL  P  PD  + +   VD I   I+ F+V++S+A   + KH Y +  NQE +A G+ N   S F  F  + SLSRS VQE  GGK+QL+  ++S++++ V+L  G  FE+LP  +L++I+IV LKG+FM+ ++L   WR S ++ +IWL TF+ ++ L ++YGL+   ++++ +V+ +TQ+P   +LGQ+  TD+Y +I  Y E KEI GIKIFQ    +YYA+ + +   L +K G+NP  I   +R    K A               +  + + EN      E           K+T  EEL +     E   ++I+D +   F+D++G+KT+  +++EY  + I V+L      +     +   F +P     ++++ SIHDAV+ 
Sbjct:  150 GIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPAL--KELLFHSIHDAVLG 675          
BLAST of slc26a-3 vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 310.457 bits (794), Expect = 4.424e-94
Identity = 179/529 (33.84%), Postives = 299/529 (56.52%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLA--------------TIQKKFEKENQMPDFMEK----------KSTIEEELDQLNKSTE--FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVS 2238
            G+ Q  +G C  G +  YL++P++ GFT  ++VHVFTS +KY FGV+ + + GIF+V+ +   V++N+   N+ ++ + ++   LL+  KE  N     +   P+P+E F VV G   S  F+LH+++ V +VG +  GL  P  PD  + +   VD I   I+ F+V++S+A   + KH Y +  NQE +A G+ N   S F  F  + SLSRS VQE  GGK+QL+  ++S++++ V+L  G  FE+LP  +L++I+IV LKG+FM+ ++L   WR S ++ +IWL TF+ ++ L ++YGL+   ++++ +V+ +TQ+P   +LGQ+  TD+Y +I  Y E KEI GIKIFQ    +YYA+ + +   L +K G+NP  I   +R    K A               +  + + EN      E           K+T  EEL +     E   ++I+D +   F+D++G+KT+  +++EY  + I V+L      +     +   F +P     ++++ SIHDAV+ 
Sbjct:  187 GIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPAL--KELLFHSIHDAVLG 712          

HSP 2 Score: 89.7373 bits (221), Expect = 5.894e-18
Identity = 49/133 (36.84%), Postives = 78/133 (58.65%), Query Frame = 1
Query:   82 QTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKD-FQRNF-CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            +TQ   + + RP  S       + +  ++L +K ++ ES  D  ++ F C+     N +    P    L  YK+KE +L DL++GI  G++ +PQG+A++ LA + PV GLY S +P ++Y FFGTS+HISIG
Sbjct:   12 ETQR--YYVERPIFS-------HPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIG 135          
BLAST of slc26a-3 vs. Ensembl Mouse
Match: Slc26a2 (solute carrier family 26 (sulfate transporter), member 2 [Source:MGI Symbol;Acc:MGI:892977])

HSP 1 Score: 282.722 bits (722), Expect = 9.368e-84
Identity = 176/504 (34.92%), Postives = 286/504 (56.75%), Query Frame = 1
Query:  730 FFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEEL--DQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            F  G+ Q+ MG   +G ++ YLSD ++SGF  G+S  + TSQ KY  G+ +   +G+ +VI T   + +NI  TNI  +  +++C+ +L+ +KE +N +   + + P+P+EL VVV   LAS +  L+ N+   I G I  G   P  PD  +  N  VD I   II FA++VSL+++F+KKH Y++ +NQE  A G  N+  SFF C  ++A+L+++ V+ES G ++QLS+++++++L+ VLL I   F +L  C+L  I IV L+G  +K  +L  +WR S MD  IW +T L + +L  E GLLVG   S+F V+L+TQ PK+ +LG  ++++ + +IS Y   +   GIK+F++   +YY + E FK  LY+K  LNP+        L         K + + +M  F      +  +L  D L   T   I+IDCS  QF+D  G+ T+ +V  +Y+ + I V L      +R    +        + +++ S+ +AV 
Sbjct:  227 FMAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSHGVGSVITTWIHIFRNIRNTNICDLITSLLCLLVLVPSKE-LNEHFKDKLKAPIPVELIVVVAATLASHFGKLNGNYNSSIAGHIPTGFMPPKAPDWSLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALYKK-ALNPV--------LVKAAWKKAAKRKLKEEMVTFRGDPDEVSMQLSHDPLEVHT---IVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKEEETLLFYSLSEAVA 717          

HSP 2 Score: 88.1965 bits (217), Expect = 1.880e-17
Identity = 59/169 (34.91%), Postives = 90/169 (53.25%), Query Frame = 1
Query:   19 EKHSLITNEI--ELAGFRCNDGKQTQEISFTITRPTLSQY----------EFDQNYEINTDQLSIKSQLIESSKDFQRNFCS----RNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGL 477
            E+H L   ++  E  GF      +TQ  S T  R + + +          E  +  + +  Q  I+    E  K  Q   CS    R+  ++F    FP +  L KY  K+ +L D+++G+IVGI+ +PQ +AYS LAG  P++GLY S F ++IYF FGTS+HIS+G+
Sbjct:    7 EQHDLSPRDLPEEAFGFPSELPLETQRRSGTDLRQSETGHGRRAFRRIHMELREKPDTDIKQFVIR----ELQKSCQ---CSAAKVRDGAFDF----FPVLRWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVGI 164          
BLAST of slc26a-3 vs. Ensembl Mouse
Match: Slc26a2 (solute carrier family 26 (sulfate transporter), member 2 [Source:MGI Symbol;Acc:MGI:892977])

HSP 1 Score: 275.789 bits (704), Expect = 1.191e-83
Identity = 173/495 (34.95%), Postives = 281/495 (56.77%), Query Frame = 1
Query:  757 MGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEEL--DQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            MG   +G ++ YLSD ++SGF  G+S  + TSQ KY  G+ +   +G+ +VI T   + +NI  TNI  +  +++C+ +L+ +KE +N +   + + P+P+EL VVV   LAS +  L+ N+   I G I  G   P  PD  +  N  VD I   II FA++VSL+++F+KKH Y++ +NQE  A G  N+  SFF C  ++A+L+++ V+ES G ++QLS+++++++L+ VLL I   F +L  C+L  I IV L+G  +K  +L  +WR S MD  IW +T L + +L  E GLLVG   S+F V+L+TQ PK+ +LG  ++++ + +IS Y   +   GIK+F++   +YY + E FK  LY+K  LNP+        L         K + + +M  F      +  +L  D L   T   I+IDCS  QF+D  G+ T+ +V  +Y+ + I V L      +R    +        + +++ S+ +AV 
Sbjct:    1 MGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSHGVGSVITTWIHIFRNIRNTNICDLITSLLCLLVLVPSKE-LNEHFKDKLKAPIPVELIVVVAATLASHFGKLNGNYNSSIAGHIPTGFMPPKAPDWSLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALYKK-ALNPV--------LVKAAWKKAAKRKLKEEMVTFRGDPDEVSMQLSHDPLEVHT---IVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKEEETLLFYSLSEAVA 482          
BLAST of slc26a-3 vs. UniProt/SwissProt
Match: sp|Q65AC2|S26A2_HORSE (Sulfate transporter OS=Equus caballus OX=9796 GN=SLC26A2 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 6.543e-100
Identity = 222/683 (32.50%), Postives = 368/683 (53.88%), Query Frame = 1
Query:  223 CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVH-----NITTDYDTANNEFERLVSNRA-------AGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            CS     N + G  P +  L KY  K+ +L D+++G+IVGI+ +PQ +AYS LAG  P++GLY S F +LIYF  GTS+HIS+G+  +                             +   +  + D  R  L   Y   +TVH      + ++  T+ N+    + +R+       +   F  G+ Q+ MG   +G ++ YLSD ++SGF  G+S  + TSQ KY  G+ +    G+ ++I T   + +NI +TN+  +  +++C+ +L+ TKE +N +   + + P+P EL VVV   LAS +  LH+ +   I G I  G   P  PD  +  +  VD I   II FA++VSL+++F+KKH Y++ +NQE  A G  N+  SFF CF ++A+L+++ V+ES G +SQLS ++++++L+ VLL I   F +L   +L  I IV L+G   K  +L  +WR S MD  IW +T L + ++  E GLL+G   S+F V+L+TQ PK  +LG +++T+I+ ++S Y   +   GIKIF++   +YY + E FK  LY+K  LNP+ +   ++    +    Q            ++ + +++   D L   T   I+IDCS  QF+D  G+ T+ +V  +Y+ I I V L      +R    +        + +++ S+++A+ 
Sbjct:   82 CSPTKAKNMIFGFLPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFLLGTSRHISVGIFGV-----------------------------LCLMIGEVVD--RELLKAGY---DTVHIAPSLGMVSNGSTSLNQTSDRICDRSCYAIKVGSTVTFLAGIYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSSGVGSLITTWIHIFRNIHKTNVCDLITSLLCLLVLLPTKE-LNEHFKSKLKAPIPTELVVVVAATLASHFGKLHEKYNTSIAGHIPTGFMPPKAPDWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQSQLSGVMTALVLLLVLLVIAPLFYSLQKSVLGVITIVNLRGALRKFRDLPKMWRVSRMDTVIWFVTMLSSALISTELGLLIGVCFSMFCVILRTQKPKVSLLGLVEETEIFESMSAYKNLQARPGIKIFRFVAPLYYINKECFKSALYKKT-LNPVLVKAAQKKAAKRKIKKQP------VTLSGIQNEISVQLSHDPLELRT---IVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKDEEENLLFYSVYEAMA 719          
BLAST of slc26a-3 vs. UniProt/SwissProt
Match: sp|O43511|S26A4_HUMAN (Pendrin OS=Homo sapiens OX=9606 GN=SLC26A4 PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 4.916e-97
Identity = 226/760 (29.74%), Postives = 403/760 (53.03%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK----RSLENKLATIQKKFEKENQMPDFMEKKSTIE--------EELD--------QLNKSTEF------------SIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 2271
            S+ ++RP  S+  F Q +E    +L  +  L ES        CSR   +  L    P +  L KY+ KE LL D+I+G+  G++   QGMAY+ LA +   +GLY + FP L YF FGTS+HIS+G            P     L V             S  +++  D   H+L        TV N TT  DTA  +  R++   A+     VG+ Q++ G   +G + +YL+DP++ GFT  ++  V  SQ+K    V  + + G+ ++I T+ E+ +NI +TN+   +  ++ I + +  KE +N     +  +P+P+E+ V +     S   +L KN+   IV  I +G   P +P + +    +       ++A+A++VS+  +++ K+ Y+I  NQEF+A+G+ N+F+ FFSCF +  +LSR+AVQES GGK+Q++ +IS+ +++  +L +G+  E L   +LA+++I  LKG+FM+  ++  LWR + +D  IW+ T + ++IL ++ GLL G +  + +VVL+ Q P    LG I  TDIY +   Y   +E  G+KI ++   ++Y + + FKK +   +G + I ++ K+    R ++  + + Q +  K   + D +   +  E        EELD        Q++ ++E             S+++DC    F+D +G++++  +++E+Q I+++V+  SL+  + +K  Q   F+   +I     +L++HDA++ +  Q +  + Q
Sbjct:   19 SYMVSRPVYSELAFQQQHE---RRLQERKTLRESLAKCCS--CSRKRAFGVLKTLVPILEWLPKYRVKEWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSRHISVG------------PFPVVSLMV------------GSVVLSMAPD--EHFL--VSSSNGTVLN-TTMIDTAARDTARVLI--ASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKE-LNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEMLAASFSIAVVAYAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKTQVAGIISAAIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQLCDIPRLWRQNKIDAVIWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDD--NIRKDTFFLTVHDAILYLQNQVKSQEGQ 739          
BLAST of slc26a-3 vs. UniProt/SwissProt
Match: sp|Q9R155|S26A4_MOUSE (Pendrin OS=Mus musculus OX=10090 GN=Slc26a4 PE=1 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 1.602e-95
Identity = 221/766 (28.85%), Postives = 394/766 (51.44%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEIN-TDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGL-----KFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK----RSLENKLATIQKKFEKENQMPDFMEKKST-------------------IEEELD---------QLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 2271
            S+T++RP  S+  F Q  E    ++ +++  L  S        CSR   +  +    P +  L KY+ KE LL D+I+G+  G++   QGMAY+ LA +    GLY + FP L YF FGTS+HIS+G        +   + SM P D                               H+L        +  N TT  DT   +  R++   A+     VG+ Q++ G   +G + +YL+DP++ GFT  ++  V  SQ+K    V  + + GI ++I T+ E+ +NI +TNI      ++ I + +  KE +N     R  +P+P+E+ V +     S   +L KN+   IV  I  G   P +P + +  + +       ++A+A++VS+  +++ KH Y I  NQEF+A+G+ NVF+ FFSCF +  +LSR+AVQES GGK+Q++ LIS+++++  ++ +G+  E L   +LA+++I  LKG+FM+  ++  LW+ +  D  IW+ T + ++IL ++ GLL G + ++ +VVL+ Q P    LG +  TDIY +I+ Y   +E  G+KI ++   ++Y + + FKK +   +G + I ++ K+    R ++  +   Q +  K   + D     +                    IE ++D          + K    S+++DC    F+D +G++++  +++E+Q I+++V+   L+ D+ +K  Q   F+   +I     +L++HDA++ +  Q +  + Q
Sbjct:   19 SYTVSRPVYSELAFQQQRERRLPERRTLRDSLARSCS------CSRKRAFGVVKTLLPILDWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVQFGLYSAFFPILTYFVFGTSRHISVGPFPVVSLMVGSVVLSMAPDD-------------------------------HFL--VPSGNGSALNSTT-LDTGTRDAARVL--LASTLTLLVGIIQLVFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGILSIIYTLIEIFQNIGDTNIADFIAGLLTIIVCMAVKE-LNDRFKHRIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPSGFLPPVLPSVGLFSDMLAASFSIAVVAYAIAVSVGKVYATKHDYVIDGNQEFIAFGISNVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWKQNKTDAVIWVFTCIMSIILGLDLGLLAGLLFALLTVVLRVQFPSWNGLGSVPSTDIYKSITHYKNLEEPEGVKILRFSSPIFYGNVDGFKKCINSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRATKNGIISDIGSSNNAFEPDEDVEEPEELNIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFALLQDDVLEKMEQCGFFDD--NIRKDRFFLTVHDAILHLQNQVKSREGQ 739          
BLAST of slc26a-3 vs. UniProt/SwissProt
Match: sp|Q9BEG8|S26A2_BOVIN (Sulfate transporter OS=Bos taurus OX=9913 GN=SLC26A2 PE=3 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 4.002e-95
Identity = 223/679 (32.84%), Postives = 372/679 (54.79%), Query Frame = 1
Query:  223 CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLT--------QILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            CS     N + G  P +  L KY  K+ +L D+++G+IVGI+ +PQ +AYS LAG  P++GLY S F +LIYF  GTS+HIS+G+  I                             +   +  + D  R      Y   +TVH  + +    N   ++   +R+  +A  VG T        Q+ MG   +G ++ YLSD ++ GF  G+S  + TSQ+KY  G+ +    G+ ++I T   V +NI +TNI  +  +++C+ +L+ TKE +N     + + P+P+ELFV+V   LAS +  L++ +   I G I  G   P  PD  +     VD I   II FA++VSL+++F+KKH Y++ +NQE  A G  N+  SFF CF ++A+L+++ V+ES G ++Q+S ++++++L+ VLL I   F +L   +L  I IV L+G   K  +L  +WR S MD  IW +T L + ++  E GLL G   S+F V+L+TQ PK+ +LG ++ ++++ ++S Y   +   GIKIF++   +YY + E FK  LY+K  LNP+ +    ++ + K A  ++K ++E   P  ++ + +++   D L   T   I+IDCS  QF+D  G+ T+ +V  +Y+ + I V L      +R    +        + +++ SI++A+ 
Sbjct:   81 CSSTKAKNTIFGFLPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFILGTSRHISVGIFGI-----------------------------LCLMIGEVVD--RELYIAGY---DTVHAASNESSLVNQISDK-TCDRSC-YAIIVGSTVTFVAGVYQVAMGFFQVGFVSVYLSDALLGGFVTGASFTILTSQVKYLLGLSLPRSAGVGSLITTWLHVFRNIRKTNICDLITSLLCLLVLLPTKE-LNERFKSKLKAPIPVELFVIVAATLASHFGKLNEKYGTSIAGHIPTGFMPPKAPDWNLIPRVAVDAIAIAIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQTQVSGVMTALVLLLVLLVIAPLFFSLQKSVLGVITIVNLRGALCKFKDLPQMWRISRMDTVIWFVTMLSSALISTEIGLLTGVCFSMFCVILRTQKPKASLLGLVEDSEVFESMSAYKNLQAKSGIKIFRFVAPLYYVNKEYFKSVLYKKT-LNPVLV----KAAQRKAA--KRKIKRETVTPSGIQDEVSVQLSHDPLEFHT---IVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKDEENLLFYSIYEAMT 712          
BLAST of slc26a-3 vs. UniProt/SwissProt
Match: sp|Q9JKQ2|S26A5_MERUN (Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26A5 PE=1 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 9.007e-95
Identity = 184/531 (34.65%), Postives = 302/531 (56.87%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLA--------------TIQKKFEKENQMPDFMEK----------KSTIEEELDQLNKSTE--FSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDI-----RKKFHQFNSPCHINDKMVYLSIHDAVVS 2238
            G+ Q  +G C  G +  YL++P++ GFT  ++VHVFTS +KY FGV+ + + GIF+V+ +   V++N+   N+ ++ + ++   LL+  KE  N     +   P+P+E F VV G   S  F+LH+++ V +VG +  GL  P  PD  + +   VD I   I+ F+V++S+A   + KH Y +  NQE +A G+ N   S F  F  + SLSRS VQE  GGK+QL+  ++S++++ V+L  G  FE+LP  +L++I+IV LKG+FM+ ++L   WR S ++ +IWL TF+ ++ L ++YGL+   ++++ +V+ +TQ+P   +LGQ+  TD+Y +I  Y E KEI GIKIFQ    +YYA+ + +   L +K G+NP  I   +R    K A               +  + + EN      E           K+T  EEL +    TE   +II+D +   FID++G+KT+  +++EY  + I V+L      +     R +F  F +P     ++++ SIHDAV+ 
Sbjct:  187 GIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANIANAAVVKVDGEVDGENATKPEEEDDEVKYPPIVIKTTFPEELQRFMPQTENVHTIILDFTQVNFIDSVGVKTLAVMVKEYGDVGIYVYLAGCSPQVVNDLTRNRF--FENPAL--KELLFHSIHDAVLG 712          

HSP 2 Score: 89.3521 bits (220), Expect = 5.775e-17
Identity = 47/127 (37.01%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  100 FTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKD-FQRNF-CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            + + RP  S       + +  ++L +K ++ ES  D  ++ F C+     N +    P    L  YK+KE +L DL++GI  G++ +PQG+A++ LA + PV GLY S +P ++Y FFGTS+HISIG
Sbjct:   16 YHVERPIFS-------HPVLQERLHVKDKVSESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIG 135          
BLAST of slc26a-3 vs. TrEMBL
Match: A0A0H3YFG7 (Slc26a-3 OS=Schmidtea mediterranea OX=79327 GN=slc26a-3 PE=2 SV=1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 506/506 (100.00%), Postives = 506/506 (100.00%), Query Frame = 1
Query:  757 MGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 2274
            MGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM
Sbjct:    1 MGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 506          
BLAST of slc26a-3 vs. TrEMBL
Match: A0A0H3YFH1 (Slc26a-8 OS=Schmidtea mediterranea OX=79327 GN=slc26a-8 PE=2 SV=1)

HSP 1 Score: 514.612 bits (1324), Expect = 8.232e-169
Identity = 288/539 (53.43%), Postives = 395/539 (73.28%), Query Frame = 1
Query:  694 ERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSE-----------CKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPD--FMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 2271
            E L +NR AGFAF VG+ Q++MG  N+G LTKYLSDP+ISGFTVG+S+HVFTSQIKYCFG+ I   +G+FN+  T   + KN+ +TNIPT+ + ++ I +L  TKE INP V+ + R+P+PMEL VV+ G + S+Y  L++NHKV IVGEIS+GLP+P++PD+     YV DI IT IIAF+V +SLA +FSKKH Y I +NQE +AYG+MN  ASFF C+PSA+SLSRSAVQESVGGK+QL+SL+SS LL+FVLLFIG  F  LPNCIL++IIIVALKG+FM+ AELK+LW FS+ DFS W++ FLGT  +DVEYGL++G   SI  ++L+TQNPKS+ILGQI  TD+Y N+ +Y+E           C+EI GIKIF+YEGS+YYA  +NFK +LY KI  NP  I   K  +      ++K  +  N   +  F E+K+ +E EL++L       +IIDCS + +ID +G+KT+NQVIEEY+ INI+V L + K D+R    + ++   I+D+++++S+HDAV++ + +R++ +V 
Sbjct:  210 ELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLI---KLRILKLERKLKKLKQHNNNFENSPFFEEKTQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVN 745          

HSP 2 Score: 137.117 bits (344), Expect = 1.366e-29
Identity = 61/124 (49.19%), Postives = 85/124 (68.55%), Query Frame = 1
Query:  103 TITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            +I RP  +Q+EFD N+  N  + S K + +   +  ++ + ++      +  K PFI I+ KYKW+E LL D I G+IVGIMHIPQ MAY+ LAGL+P++GLY S FP ++YFFFGTS+HISIG
Sbjct:   30 SIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIG 153          
BLAST of slc26a-3 vs. TrEMBL
Match: A0A0H3YKD1 (Slc26a-4 OS=Schmidtea mediterranea OX=79327 GN=slc26a-4 PE=2 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 5.374e-163
Identity = 266/522 (50.96%), Postives = 368/522 (70.50%), Query Frame = 1
Query:  286 KYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFF--RHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKK 1845
            +YKWK  LL DLI G+IVG M IPQ  AY+QL G++P++GLY++ FP ++Y+FFG+S+HISIG   I                                 V+L++  F  +  + F    T+TV N++     A+ + E + ++R AG   FVG++Q++MG  N+G LTKYLSDP+ISGFTVGS++ VF++Q+KYCFGV I  +YGIF+V NT+  V K +  TNIPT  +  I I LL  TK  INP +M +   P+P+EL VVV G ++S+Y  LH  + V +VG I +G+P+P +P I    NY+ +II+T IIAF+VS+SL  +F+KKH Y I + QEF+A+G+MN+F+SFF C+PSA S+SRSAVQE+ GGK+Q++SL+S IL++FVLLFIG  F+ LPNCILAS+IIVALK + MK  ELK+LW FS+ DFS+W++TFL T+ LDV+YGL+ G  LSI S+VL+TQ+P S+ILGQI  TD+Y N+++Y +C EI GIKIF+YEGS+YYA  ++FKK
Sbjct:    2 RYKWKTWLLLDLIAGLIVGTMQIPQSFAYAQLVGIQPIYGLYLAFFPVMVYYFFGSSRHISIGTIAI---------------------------------VSLLSGSFLEQSLIDFPLNTTKTVGNVS-----ASVQNEAIKASRVAGLTLFVGISQLIMGVFNLGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGVPAPVIPVIDNMSNYISNIIVTAIIAFSVSISLGKMFAKKHGYKIDATQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKK 485          
BLAST of slc26a-3 vs. TrEMBL
Match: A0A1I8GRH2 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 4.953e-151
Identity = 285/755 (37.75%), Postives = 444/755 (58.81%), Query Frame = 1
Query:   91 EISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDF----------------QRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG-LKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKI-SYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFS----------IIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDI-----RKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRR 2256
            E SF + RP  +Q +FD+ +     +  + ++L +S+K                    + CSR      L G  PFI IL +Y  ++ LL D I+G+ VGIMHIPQGMAY+ LA L P  GLY S FP LIYFFFGTS+ +S+G +  I   +  +     +        +      + SQ +TL                ++     + +  +++   R     A      VGL Q+ MG   +G LT+YLSDP+ISGFT+G ++HVF+SQIKY  G+++    G+F++     ++++NI+ETN  T+ +A++ I +L  TKE +NP V  R + P+P+EL +V  G + S +  L KN+ V IVG I  G+P P +PD  I   +  ++I+   IIAF+V VSLA IF KKH Y ++ +QE +AYG+ N   SFF C+P+  SLSRSAVQ+S+GGK+Q+++L SS LL+ VLLFIG++FE++PNC L++IIIVA+KG+  +  E   LWR S  DF  W++  LG V L V+YGL++G   S+ S++++TQ+P S +LG+I  TD+Y N+  Y + + + G+KIF+YEGS+Y+A  ENF+ +LY K G++P ++   +R L  K A +  K  K  + P+ ++K+ +   + ++     EF           +I+D S + +ID +G++ +NQ I+EY+ + I V+L + K  I     R  F++ N P      ++Y+S+HDAV++   ++R
Sbjct:   82 ERSFRVIRPVYTQQQFDEKHGGRLVRRPLLARLRDSAKKLVTCGAGSGRSDDGDGESGHNCSRAK--TQLLGFLPFIGILKRYNIRDWLLADFISGLTVGIMHIPQGMAYAFLAELPPYIGLYTSFFPPLIYFFFGTSRQVSMGTVAIISLLVGGLQEFPSYARLSSWSFDNETTTAIASQQLTL-----------DLNGNDSTVGSGSPFQWSSDPVSRNRVALACVTCLCVGLIQLAMGVLRLGFLTRYLSDPLISGFTMGVAIHVFSSQIKYVLGIKVPRRNGVFSLPLHYFDLLRNITETNFVTVGIAVVSIVILYVTKELVNPKVRKRIKAPLPIELLIVSLGTILSYFLDLKKNYNVKIVGTIPTGIPPPELPDFSILRASMAIEIVTIAIIAFSVCVSLAKIFGKKHNYEVAPSQELIAYGICNTVGSFFHCWPAGTSLSRSAVQDSMGGKTQVAALFSSTLLLLVLLFIGKYFESVPNCCLSAIIIVAIKGMLEQAKEAPVLWRLSPYDFWTWIVACLGVVFLAVDYGLILGLAFSVCSIIVRTQSPTSSMLGRIPDTDLYKNVLAYDDIELVDGVKIFRYEGSLYFACAENFRDSLYHKSGVHPRKMLLARRKLTEKYAKLAAK--KLQKSPEVLKKEFSKLTDSERSEALKEFGLQWPPVPVDHVILDASTWGYIDYVGVRALNQTIQEYKEVGIRVYLANPKCGIRACLQRSDFYEKNEP-----DIIYVSVHDAVLAAQCEQR 816          
BLAST of slc26a-3 vs. TrEMBL
Match: A0A267GHC8 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000646g3 PE=3 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 7.568e-151
Identity = 283/733 (38.61%), Postives = 437/733 (59.62%), Query Frame = 1
Query:   91 EISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKF----PFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG-LKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKI-SYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENK-----------LATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVS 2238
            E S  + RP  +Q +FD  +     +  +  +L +  K   +  C  +     LCG      PF+ I+ +Y  +E LL DLI+G+ VGIMHIPQGMAY+ LA L P  GLY S FP LIYFFFGTS+ IS+G L  +   I S+       +R        +N   ++  VT   D           F     ++ TD    ++   R   + A      VGL Q+LMG   +G LT+YLSDP+ISGFT+G +VHVF+SQIKY  G+ +    G+ ++     ++  NI +TN  T+ +A + + +L  TKE +NP V  + + P+P EL +V  G + S  F L KN+ V IVG I  G+P P  PD+ +   +  V+II   IIAF+V VSLA IF KK+ Y ++ +QE +AYG+ N   +FF C+P+ +SLSRSAVQ+S+GGK+Q+++L+SS LL+ VLLF+G++FE +PNC L++II+VA+KG+  +  E   LWR S  DF  W++T LG V+L V+YGL++G   S+FS++++TQ+P S ILG+I  TD+Y N+  Y + +E+ G+KIF++EGS+Y+A  ENF+++LY+K G+NP  I  ++R L  K            AT+++ F +   M +  + ++     LD      +  +I+D S + +ID +G++ ++Q I+EY+ I ++V++ + K  IR    + +        ++Y+S+HDAV++
Sbjct:  132 ERSVRVLRPVSTQQQFDDRHGGRLVRRPLLHRLRDRLKS-AKTGCPPDR--GRLCGALVQLLPFLGIMREYNLREWLLPDLISGLTVGIMHIPQGMAYAFLAELPPYLGLYTSFFPPLIYFFFGTSRQISMGTLAIVSLLIGSL-------VR--------KNLPAVAMQVTPAGDNVT-----AEAFIVNATSMATDQSWGSDPLIRSRVSLACATCLCVGLIQLLMGILRLGFLTRYLSDPLISGFTMGVAVHVFSSQIKYVLGISVPGRNGLASLPLHYYDLACNIGQTNFVTLGIAAVAVVILYVTKEFVNPRVRKKIKAPLPTELIIVTLGTVISYVFDLKKNYNVKIVGTIPTGIPPPEFPDLSVLQPSMAVEIITVAIIAFSVCVSLAKIFGKKYNYEVAPSQELIAYGICNTVGAFFHCWPAGSSLSRSAVQDSMGGKTQVAALVSSTLLLLVLLFVGKYFETVPNCCLSAIILVAIKGMLEQVKEAPILWRLSPYDFWTWIVTCLGVVLLSVDYGLIMGLAFSVFSIIVRTQSPTSSILGRITGTDLYKNVHAYDDIEEVAGLKIFRFEGSLYFACAENFRESLYRKTGVNPRRIVQQRRRLGEKYARVTATSDASTATVKRTFTR---MSESEKAEAAKAVGLDWPRVPVQH-VILDASTWGYIDYVGVRALSQAIQEYRDIGVAVYIANPKCGIRACLERSDFYEKNRYDIIYVSVHDAVLA 837          
BLAST of slc26a-3 vs. Ensembl Cavefish
Match: slc26a10 (solute carrier family 26 member 10 [Source:NCBI gene;Acc:103043095])

HSP 1 Score: 349.362 bits (895), Expect = 1.967e-109
Identity = 230/727 (31.64%), Postives = 389/727 (53.51%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNR---AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKE--NQMPDFMEKKS-TIEEEL--DQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQR 2253
            S  + R   ++  F Q Y     Q S K+ L E+     R  CSR+   + L  + P +  L KY+ ++ +L D + G+ VGI+HIPQGMA++ L  + P++GLY S FP ++Y  FGT  H+S G   +                                 V+L+T              E +       ++++ E   L + R   A+  AF  G+  + M    +G L+ YLS+PII  FT  ++ HV  SQ++   G+ +    G F++  T+  V++N+  TN+  + ++++C+++LI  KE +N       R P+P+E+  V+     +  FSL   + V IVG I  G P P +P +    +   D +    + +AVSVSLA I++ KH YSI  NQE LA+G+ N  +S F+CFPS+A+L+ + + ES GG +QLS L +S++++ VLL IG  F  LP  +LA I + +L+ +F++  +L DLWR S +DF +WL+T+L  V+L+V+ GL +G + S+ +V+ +TQ     +LG+   T+IY  I+ +++C EI G+KI  Y G +YY +   FK ++ Q +GL P  I    RS E     ++K+ E+E  N +   +   S + E E    +++++   ++++DCS   F+D  G K   Q+  E Q + + ++L +   ++ K         ++N + +++++HDAV+ I +QR
Sbjct:    4 SVAVYRNIYTEDRFRQTYGTEA-QPSGKAGLRETLSRPCR--CSRDTCLHLLKERVPVVSWLPKYRLRKWILGDTVAGLTVGILHIPQGMAFALLTSVAPIYGLYTSFFPVVLYMLFGTGCHVSTGTFAV---------------------------------VSLMTG----------SVVEQLVPSPPALNSSSPEAAELEAQRIGVASAIAFLSGVMMLCMFGLQLGFLSTYLSEPIIKAFTSAAAFHVTISQLQSMLGLRLPRHTGTFSLFKTLASVLENLPHTNLAELLISLVCLAVLIPIKE-VNTRFRQHLRTPIPVEILTVIIATGVAYAFSLDSTYDVQIVGHIPAGFPQPRLPALHTVPDIAGDTVAITFVGYAVSVSLAMIYADKHGYSIHPNQELLAHGISNTVSSLFTCFPSSATLATTNILESAGGYTQLSGLFTSLVVLVVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPDLWRVSRIDFMVWLVTWLSVVVLNVDLGLAIGVVFSMMTVICRTQRAGCSVLGRASNTEIYRPINNHNKCYEIPGVKILTYNGPIYYGNRSFFKADVNQLLGLTPERI----RSREKARKALEKR-EREAINTVERGVANTSFSSENEFFKSEMSENEVQAVLMDCSGVVFVDVAGAKLFIQMCIECQKMGVRIYLANCNENVLKILTSSGLMNYMNPQHIFVTVHDAVIYIEQQR 678          
BLAST of slc26a-3 vs. Ensembl Cavefish
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103026473])

HSP 1 Score: 332.798 bits (852), Expect = 7.369e-103
Identity = 228/720 (31.67%), Postives = 382/720 (53.06%), Query Frame = 1
Query:  133 EFDQNYEINTDQLSIKSQLIESSKDFQRN--FCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENK-------------LATIQKKFEKENQMPDFMEKKSTIE-EELD-QLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFH--QFNSPCHINDKMVYLSIHDAVV 2235
            E D   EI  D ++ K  +  S KD  +    CS     +      P +  L +Y +KE    DL++GI VGIMH+PQGMAY+ LA + PV GLY S +P LIYF FGTSKHIS+G                              + ++S  +  +T+       FT      + N +++ +    + ER+    AA   F  G+ Q+L+G    G +  YLS+P++  +T  +++HV  SQ+KY FG+    F G  ++I T+ EV   + +TNI T+ ++I+ I  LI  KE +N ++  +  +PVP+EL  ++   + S  F     +KV +VG I  GL  P +P   +  + + D     ++ + +++SL  IF+ K+ Y + SNQE +A G+ N     F CF  + S+SR+ VQ S GGK+Q++  +S+I+++ +LL+IG  FE+LP  +LA+II V L G+  + A++  LWR + +D  +WL+TF+ T++L+ + GL      S+ +V+ +TQ PK  +LGQ+  TDIY  +  Y++  +I GI IF+   ++Y+A+ E +  +LY+K G++  ++   K+ LE K               T++      N      +    +   +LD  L+ S   +II+D S   F+D +G+KT+  +I++Y    + VFL+  +  + +      F S   I   +++ ++HDAV+
Sbjct:   16 ERDVMDEIVVDSVADKLDVTTSVKDKLKESMRCSGPQVKSCFLSCIPLLAWLPRYPFKENAFGDLVSGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVG-----------------------------TYAVMSVMIGSVTERLAPDSDFT--LWNNISN-SSEINFEARDIERV--KIAAAVTFLSGIFQLLLGLVQFGFVVTYLSEPLVRAYTTAAAIHVIVSQLKYSFGISATRFSGPLSLIYTVLEVCSLLGQTNIGTLVVSIVTIVCLIIAKE-LNSWLARKLPVPVPVELIAIIIATVLSWQFDFKTEYKVEVVGSIPSGLQPPKLPAFSMMGSMIGDAFALAVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGVFQCFAISCSMSRTMVQISTGGKTQVAGALSAIVMLVILLWIGSLFEDLPKAVLAAIIYVNLHGMMKQFADIPSLWRSNKVDMLVWLVTFVLTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSLLGQVPGTDIYRPVEDYNQVTQIPGIVIFRSSATLYFANAEMYTDHLYEKSGVDVTKLLNHKKKLEAKRLRQEKKEAKKKAKETVEVSELTGNGQQSGKDVVVVVAGPQLDPSLDPSLPKAIILDLSPVNFLDTVGVKTLRNIIKDYGDAGVKVFLSGCQSCVIENLETGDFFSE-KITKAVIFSTVHDAVL 699          
BLAST of slc26a-3 vs. Ensembl Cavefish
Match: slc26a2 (solute carrier family 26 member 2 [Source:NCBI gene;Acc:103047169])

HSP 1 Score: 326.635 bits (836), Expect = 8.823e-101
Identity = 220/689 (31.93%), Postives = 372/689 (53.99%), Query Frame = 1
Query:  223 CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSN--RAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQ---------LNKSTEF-SIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFL----TSLKYDIRKKF---HQFNSPCHINDKMVYLSIHDAV 2232
            CS       L    P +  L +Y+ K+ ++ D+++G+IVGI+ +PQ +AYS LAG  P++GLY S F ++IY   GTS+HIS+G                                +      L+       L      T+   N+T+  ++     +R        A   F  G+ Q+LMG   +G ++ +LSD ++SGF  G+S+ + TSQ+KY  G+++    G  ++I T   ++ N+ +TNI  +  ++IC+ +LI TKE +N     + + P+P ELFVV+   LAS +    + +   + G I  G   P +PD  +  N  VD     I+ FA++VSL+++F+KKH Y +  NQE  A G  N+F SFF CF ++A+L+++ V+ES G ++Q+S LI++++L+ VLL I   F +L  C+LA II+V L+G   K  ++  +WR + +D +IWL+T   + +++ E GLLVG ++S FSV+ +TQ  +++ LGQ    +I+ +++ Y       G+ +F+YE  +YYA+   FKK+LY+ +GL+P+           K    +KK EK+N       K+ T+E+ + Q         L++   F ++IIDCS   F+D  G+  + +V ++Y+ + + + L    TS+   +R+     H+  SP +I     + +I DAV
Sbjct:   49 CSPTRAKALLFDSIPILKWLPRYQIKDWIIGDMMSGVIVGILLVPQSIAYSLLAGQDPIYGLYTSFFSSIIYALLGTSRHISVG--------------------------------IFGVLCLLVGQVVDRELAVAGYLTDLPSNMTSLENSTAPYCDRSCYAIIVGATVTFTAGVYQVLMGLLQVGFVSVFLSDSLLSGFATGASLTILTSQLKYLLGLKLPRAQGWGSLIKTWISLLTNLGQTNICDLITSLICLLVLIPTKE-LNDRFKSKLKAPIPFELFVVIIATLASHFGQFQEKYGSGVAGAIPTGFMPPQLPDWSLIPNVAVDAFSIAIVGFAITVSLSEMFAKKHGYVVDPNQEMYAIGFCNIFPSFFRCFTTSAALTKTLVKESTGCQTQVSGLITALVLLLVLLVIAPLFYSLQKCVLAVIIVVNLRGALRKFRDVPQMWRTNRVDATIWLVTMATSALVNTELGLLVGVLVSAFSVLGRTQRAQAFKLGQAGDYEIFEDLASYKGLHTHPGVAVFRYEAPIYYANQTLFKKSLYRNVGLDPV-----------KEKARRKKLEKQN-------KQKTLEDGVKQDHEASTNMFLSQGPAFHTLIIDCSAVLFLDTAGVGALKEVHKDYKELGVRLLLAQCNTSVIDSLRRAGYYDHKTGSPENI-----FHTISDAV 681          
BLAST of slc26a-3 vs. Ensembl Cavefish
Match: slc26a3.1 (chloride anion exchanger-like [Source:NCBI gene;Acc:103036484])

HSP 1 Score: 301.212 bits (770), Expect = 1.341e-90
Identity = 220/769 (28.61%), Postives = 382/769 (49.67%), Query Frame = 1
Query:   76 GKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKD-FQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTAN-NEFERLVSNR-----AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPY-VMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKEN-----QMPDFMEKKSTIE----EELD----------QLNKSTEF------------SIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQRR 2256
             K+  +  + + RP  S+  F   Y+           L+++ KD F    C      N      P I  +  Y++KE LL D++ G+  G++ + QG+A++ LA + P +GLY + FPAL+Y F GTSKHIS+             P     L             ++   VT +                    + +D   AN   FE L  ++     A+   F +G+ Q+ MG   +G +  YLSD ++SGFT  ++VH+  SQ+K+  G+ +  F G  N+  T+  +   I+ TNI  +  +I+ ++++   KE  + Y   L   IP+ + + ++V G+     F   +   V ++G +  G  +P+ P++++  +  VD   T I+ FAV+ S+A ++S KH Y I  NQE +A+G  N+F + F  F ++ +LSR+AVQES GGK+Q++ L+S+++ + V + IG   E LP  +L +++IV LKG+ M+  E+  LW     DF IW++T + ++IL ++ GL VG  + + +VV +TQ P+  IL  I  TDIY +   Y    E  G+KIF+    +++A+ E F+  L Q +G +P+ +  K+     K+  + K  + +      +  DF   K+  +    E+LD          Q+N   E             S+++D S   FID   +K +   ++E+  +++ V++ +    + +K H    F+    I   M Y +IHDA++ IL + +
Sbjct:    2 AKEPVDGQYMVARPLFSEDSFSGQYK---KVYRPHKGLLDNVKDCFH---CDSKRAKNAALSLLPIIGWIKTYRFKEWLLGDIVAGVSTGLVSVLQGLAFALLASIPPGYGLYAAFFPALMYIFLGTSKHISV------------GPFPVLSL-------------MVGAVVTKL--------------------VPSDGPPANITGFEGLTMDQQRVIVASSVTFLMGIFQLAMGVLRVGFIVIYLSDTLVSGFTTAAAVHILVSQLKFVLGLTVPGFSGPLNMFYTLESIFLQITSTNIADLITSIVIMAVVFVVKEINDRYRSKLPVPIPIEIIITIIVCGVSYGANF--EERFNVTVIGTMVNGYETPSAPNVEVMQHGAVDAFTTAIVGFAVAFSVAKVYSVKHDYVIDGNQELIAFGASNMFGAAFQSFAASTALSRTAVQESTGGKTQIAGLVSAMIALIVTVGIGFLLEPLPRSVLGALVIVNLKGMLMQFREIPYLWTRDKADFVIWMVTCVASIILGLDLGLAVGIGIELIAVVFRTQFPRCSILANIKGTDIYRDHKDYLCIYEPEGVKIFKIPSPIFFANIEFFRDKLIQAVGFSPLRVLRKRNKALRKIRKMLKNGDLQMTPMGLKTVDFSSTKNWDDEGSAEDLDQPVDFSDLPVQVNWRAELPGSISVPPVDIHSLVLDFSAVSFIDISALKGLKTTLKEFVRVDVEVYIVACDVYVFEKLHNCMFFDD--EIKTSMFYPTIHDAMLHILEKNQ 715          
BLAST of slc26a-3 vs. Ensembl Cavefish
Match: slc26a5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:103036170])

HSP 1 Score: 300.442 bits (768), Expect = 2.212e-90
Identity = 193/577 (33.45%), Postives = 318/577 (55.11%), Query Frame = 1
Query:  655 NITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKK-----------STIEEELDQLNKSTEF-----------------------------SIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLT----SLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQR 2253
            N+T   D    +  R+    A      VGL Q+ +G    G +  YL++P++ GFT  +++HVF SQ+KY FGV+ + F G  +V+ ++  V K+I+ TN+ T+ + ++CI  L   K+ +N     +  IP+P E+ VV+     S   +L +N++V IVG I  GL  P +PD  +  N V D +   +++F++ +SLA IF+ K+ YS+  NQE +A G+ N  +SFF  F   +S+SRS VQES GGK+Q++ L+ S+L++ V++ IG  FE LP  +LA++I+V L G+F +  ++  LWR S ++ ++WL+ F+ +V+L +++GLLV    +I +V+ +TQ PKS ILGQI  T +Y +I  Y E  E  G+KIF    S+Y+A+ + +  +L  K G++P  +  +++S +    T  KK EK+N       +K               E LD+  K  E                              SII+D +   F+D++G+K I  VI+EY  +++ V L     +L  D+R K   F+ P  +   +++ +IHDAV+    +R
Sbjct:  170 NVTGLVDFEARDARRV--QVAVALTTLVGLIQLFLGVLRFGFVAIYLAEPLVRGFTTAAAIHVFVSQLKYLFGVKTKRFSGPLSVLYSLIAVFKDITSTNVTTLIVGLVCIVFLYSVKD-VNERFKKKLPIPIPGEIIVVIVSTGVSYGMALFENYQVDIVGSIPVGLLPPVIPDFTLFPNLVADAVAIAVVSFSMGISLAKIFALKYGYSVDGNQEMIALGLCNFASSFFQTFVITSSMSRSLVQESTGGKTQIAGLLGSLLVLLVIVAIGFMFEPLPQTVLAAVIMVNLLGMFKQVRDIPALWRTSKIELAVWLVAFVASVLLGLDFGLLVAVGFAILTVIYRTQRPKSVILGQIPNTGLYYDIDEYEEASECSGVKIFHSNSSIYFANSDQYVNHLKDKTGIDPTRLLAERKSQQKHAKT--KKEEKKNLKDSSSPQKRNAVAKLDMELGVAHEVLDESEKQVELHGNGQLPEAQSEICDSEKVLFLQPLCPVHSIILDFTPVNFMDSVGIKAIKAVIKEYAAVDVRVVLAGCNRTLLSDLR-KMQFFSGP--VTTDIIFPTIHDAVLYCQHKR 738          

HSP 2 Score: 83.9593 bits (206), Expect = 2.955e-16
Identity = 41/101 (40.59%), Postives = 60/101 (59.41%), Query Frame = 1
Query:  172 SIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            SI  +L ES +      CS     + +    P +  L  Y  KE L  D+++G+  G+M +PQG+AY+ LA + PV+GLY S +P L+Y  FGTS+HIS+G
Sbjct:   48 SIGQRLAESCR------CSSERAKSAIFSFLPILSWLPSYPVKEYLFGDIVSGLSTGVMQLPQGLAYAMLAAVPPVYGLYSSFYPVLLYTLFGTSRHISMG 142          
BLAST of slc26a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003427.1 (pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-1 gene:ENSPMAG00000003117.1 transcript:ENSPMAT00000003427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 351.673 bits (901), Expect = 9.075e-111
Identity = 227/690 (32.90%), Postives = 380/690 (55.07%), Query Frame = 1
Query:  223 CSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTL---ITDFFRHYL*FTYKFTETVHNITTDYDTANNE--FERLVSNRAAG---FAFFVGLT--------QILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQI-DKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNP-IEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEF-SIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVV 2235
            CS +   +F    FP +  L KYK +E +L D ++G+IVGI+ +PQ +AYS LAG  P++GLY S F  +IYF  GTSKHIS+G+    + +  +                     +I Q V     +  F    +    K  + V N + ++  ++ E  F  ++     G   FA  VG T        Q++MG   MG ++ YLS+P++SGF  GSS+ V TSQ+KY  G+ I    G   ++ T   +   IS TN+  +  +IICI +L+  KE +N +   R + P P+EL VVV   LAS +    +N+   I G I  G   P  P+  +      D +   II FA++VSL+++F+KKH Y++ +NQE +A G  N+  +FF  F ++A+L+++ V+E+ G ++Q+S+++++ +L+ VLL I   F +L  C+L  I IV L+G F K  ++  +W+ S +D SIW +T L + ++  E GLLVG  +S+   +++TQ P++ + G + D  + Y ++  YS   E+ G+++F ++  +YYA+ E FK  L+ K  +NP +E+  +K+  E KL   +K    +N   + + K++ +  E ++L  + +F +I+IDCS  QF+D++G+  +  ++++YQ I I V L      +    H+      I D + +  IHDAV+
Sbjct:   43 CSPHELKSFFLNLFPVLRWLPKYKVREWILGDFMSGLIVGILLVPQCIAYSLLAGQDPIYGLYTSFFACIIYFLMGTSKHISVGI----FGVLCL---------------------MIGQVVDRELQVAGFAEEGI----KGHDHVVNNSMNFSNSDEENGFTVMIGGLPCGRSCFAIAVGTTVTFMAGVYQVVMGIFQMGFVSIYLSEPMLSGFVTGSSLTVLTSQMKYLLGIHIPRASGAGALLKTWYHIFSQISNTNVCDVVTSIICILVLVPAKE-LNEHFKARLKAPFPIELVVVVAATLASHFGGFKENYSSSIAGHIPTGFLPPRAPEWTLIPRIAADAVPIAIIGFAITVSLSEMFAKKHGYTVRANQEMIAIGFCNIVPAFFYSFTTSAALAKTLVKEATGCQTQMSAVVTAGVLLLVLLLIAPLFYSLQKCVLGVITIVNLRGAFRKFLDIPRMWQESRVDTSIWFVTMLASALISTEIGLLVGVCVSLLVFIVRTQRPRAALYGCVHDTNNFYADLEAYSNVAEVPGVRVFHFDAPLYYANKEYFKSQLFLKTRVNPALEVAAQKKRQE-KLQKRKKLSGSDNG--EIVNKQAML--EFNKLLPTFDFHTIVIDCSAMQFMDSVGVGAVKSIMKDYQSIGIRVILACCNPTVMDSLHRGKCISTIEDNLTFCLIHDAVL 697          
BLAST of slc26a-3 vs. Ensembl Sea Lamprey
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 278.87 bits (712), Expect = 8.016e-85
Identity = 171/546 (31.32%), Postives = 294/546 (53.85%), Query Frame = 1
Query:  715 AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQ-EFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPN---CILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKST--------------------------IEEELDQLNKSTEFS-IIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVVSILRQ 2250
            A    F  G+ Q+ +G    G +  YLS+P++ GFT   S+HV  +Q+KY FGV +  + G      T  E   ++  TN+ ++ + +IC   L  +KE  + Y   R   P+P+EL +VV   LAS    L++ H V I+G+I  GL  P +P   +    VVD I   I+ F++++S+   F+ KH Y+I SNQ E +A G+ N+F S F  F  + ++SRS VQ++ GG++Q++ L+S++L++ V+L I   F  LP      LA++++V LKG+F + A++  LWR   +D ++W++TF  +V+L ++ GL V    ++ SVV++TQ PK  ILG+I  TDIY ++  Y+E KE+ GI+IFQ   S+Y+A+ + + + L  K GL+P  +     ++  K    Q++ E++ +     E KS                           +EE  +Q   S  +  +++D     F+D  G+K + ++ +E++ + + V L   +  +  +  +    + P   +   ++LS+ DAV    RQ
Sbjct:    4 AIAVTFLCGIYQLSLGMLRFGVVATYLSEPMVRGFTTACSIHVCVTQLKYMFGVSVSRYSGPLASEQTTIEFCSHLGHTNLVSLLLCVICTVGLAGSKELGDRYRN-RLPAPIPLELILVVLATLASSGLELNEKHAVDIIGDIPTGLKPPVVPSFTLFGKVVVDAITLAIVGFSIAISMGKTFALKHGYNIDSNQQELVAIGLSNIFGSIFHSFTISCAMSRSLVQDATGGQTQVAGLVSALLVLIVILAISSLFRPLPRSGQAALAAVVLVNLKGMFKQFADVPQLWRTCRIDLAMWMVTFWASVLLGLDLGLAVAVSFALLSVVIRTQTPKYSILGKIPNTDIYLDLKEYAEAKEVSGIRIFQTNASLYFANADMYTEALISKTGLDPRSLI----AVRKKFLAHQQRLERKRRREAGTEAKSATLNLGEAVTRGGEAVDGAEAGHVVLPLEESEEQGLTSPAYRFLVLDFGAVTFVDTPGVKMLKRIFQEHKEVGVQVCLAGCRAVVVTQLERTGFLSGPS--SKAQLFLSVPDAVAHCQRQ 542          
BLAST of slc26a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003699.1 (pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 gene:ENSPMAG00000003383.1 transcript:ENSPMAT00000003699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 4.468e-42
Identity = 89/226 (39.38%), Postives = 143/226 (63.27%), Query Frame = 1
Query:  748 QILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYG---IFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQ 1416
            Q++M +  +G +  YLSDP++S FT  +++HV  SQIK   G+++  F G   IF V  T+ ++ + +  TNI  +  +++C+++LI  +E IN     + + P+P+EL ++V   + S Y  L +   V +VG I  GLP P +P +    + + D +   I+ +AVSVSLA IF+KKH Y++ +NQE  A+G+ N+F SFF CFPSAAS+SR+++QE  GG +Q
Sbjct:    1 QLIMFSLQLGFVAIYLSDPLVSAFTNAAAIHVLVSQIKNMLGLQVPRFSGPASIFMVFQTMVDIFQKLPNTNIAELVTSLVCLTVLIPVRE-INQRYKSKLKAPIPVELLLIVLATVISFYARLEEKFGVTVVGNIPAGLPVPQLPTVTNFSSLIADGLAIAIVGYAVSVSLAKIFAKKHGYTVDANQELFAHGVCNLFGSFFQCFPSAASISRTSIQEGTGGNTQ 225          
BLAST of slc26a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006617.1 (pep scaffold:Pmarinus_7.0:GL482475:5949:18084:-1 gene:ENSPMAG00000005984.1 transcript:ENSPMAT00000006617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 2.503e-22
Identity = 54/178 (30.34%), Postives = 100/178 (56.18%), Query Frame = 1
Query:  748 QILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYG-IFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKH 1278
            Q+ +G    G +  YLS+P++ GF+  +SV V  SQ+K+  G+ +   +  +   ++T  +V + + + N+ T  ++++ +  ++  K  ++    LR R+PVP EL +VV G + SE   L  +H V +VG I  GL +P  P + +S   V D +   ++ + V+VSL  +F++KH
Sbjct:    6 QVGLGLLRFGVVATYLSEPLVRGFSTAASVTVLVSQLKHLLGLALPRRHDQVLGTLHTARDVCRGVLQVNVVTALVSLLSLCSMLLLKRVVHSVPRLR-RVPVPAELLLVVLGTVLSEQLQLSPDHSVDVVGLIPSGLAAPEWPSLALSVGLVGDALALAVVGYTVAVSLGKMFAQKH 182          
BLAST of slc26a-3 vs. Ensembl Sea Lamprey
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 76.6406 bits (187), Expect = 7.891e-15
Identity = 87/336 (25.89%), Postives = 163/336 (48.51%), Query Frame = 1
Query:  730 FFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFG---VEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPM-ELFVVVGGILASEYFSL-------HKNHKVLIVGEISKGLP---SPT---------MPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLS 1668
            F  G  Q+LMG   +G L +++S P++ GFT  +++ +  SQIK   G   +  Q F  ++   + I E    +++  +   S+ ++ +  +I  +  I P + +  RI   +  +F  V   +     +L        + H   + G I++GLP    P          +P ++I  +  + +++  ++ F  S+++A  F+ K+ Y I  +QE +A G+ NV  SF S +P   S  R+AV    G  +    L++  +++  L F+  +F  +P   L++III A+  LF  C  L  LW+    D  ++++TF    + ++ YGLL G + S
Sbjct:   86 FLSGAIQLLMGILRLGFLVEFISLPVLKGFTCAAAITIGFSQIKTLLGLKDIPQQFFQEVYYTFSRIAE--TRLADALLGGSSLLLLILLRVIAARSPIPPPIPVSVRISNSITSIFGTVRNAVVVLAAALVAFACESQRLHPFTLTGHIAQGLPPFHPPAFSETKEGTFIPFLQIVRDLGLALLVIPLLGFLESIAIAKAFATKNMYRIDPSQELIAIGLTNVLGSFTSSYPVTGSFGRTAVNSETGVATPAGGLVTGTVVLLSLAFLTPWFYFIPQAALSAIIICAVAPLF-DCRILWRLWKIKKSDALVFVLTF-ALCLWEIPYGLLGGVVAS 417          

HSP 2 Score: 53.1434 bits (126), Expect = 1.713e-7
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 1
Query:  316 DLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            DL+ G+ VG+  +PQ +AY+Q+AGL   +GLY +     +Y   GTSK +++G
Sbjct:    9 DLVAGLTVGLTVVPQSLAYAQVAGLPAQYGLYSAFMGCFVYCLLGTSKDVTLG 61          
BLAST of slc26a-3 vs. Ensembl Yeast
Match: SUL2 (High affinity sulfate permease; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000004082])

HSP 1 Score: 85.5001 bits (210), Expect = 1.515e-17
Identity = 131/585 (22.39%), Postives = 227/585 (38.80%), Query Frame = 1
Query:  244 NFLCGKFPFIFIL--YKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVE--IQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTK---EAINPYVMLRFRIPVP---------------------MELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPS------PTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQI---DKTDIYCN-----ISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLN 1872
            ++L   FP I  L  Y + W      DLI GI +G + +PQ M+Y+Q+A L   +GLY S   A  Y FF TSK + IG   +                                               + +  + + ++T  Y   ++     V   A   A   G+    +G   +G L + +S   ++GF  GS+ ++   Q+    G    + T    + V   + E +K++ +T +  +   +I + LL   K       P +  R+    P                     + +F  +G  +            + I+G +  GL        P     K+  N    II+  +   A+S S    F + + Y +  +QE +A G+ N+  +FF+ +P+  S SRSA++     ++ LS L S   ++  L  +   F  +P   L+++II A+  L        + W+ + +DF  +++T L TV   +E G+      S   ++LK   P    LG++   + TD Y       +S  SE     GI   +  G     S   +  N  +KI  N
Sbjct:  117 SYLKSVFPIINWLPHYNFSW---FTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAV----------------------------------------------MSLQTAKVIADVTAKYPDGDSAITGPVI--ATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKV---VIETLKHLPDTKLDAV-FGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRG--KSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKS----FGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNN--GISTLEDGGEDDKESSTKYVTNSSKKIETN 638          
BLAST of slc26a-3 vs. Ensembl Yeast
Match: SUL1 (High affinity sulfate permease of the SulP anion transporter family; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000000498])

HSP 1 Score: 66.6254 bits (161), Expect = 9.327e-12
Identity = 46/140 (32.86%), Postives = 67/140 (47.86%), Query Frame = 1
Query:   61 FRCNDGKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFI--FILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            ++ N  KQ     F +T+  LS   +D         +++K     S K    N  +  +  ++L   FP I  F  Y + W      DL+ GI VG + +PQ M+Y+Q+A L P +GLY S   A IY  F TSK + IG
Sbjct:   48 WKVNSSKQ----KFGVTKNELSDVLYDSIPAYEESTVTLKEYYDHSIK----NNLTAKSAGSYLVSLFPIIKWFPHYNFTWG---YADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIG 176          
BLAST of slc26a-3 vs. Ensembl Yeast
Match: YPR003C_mRNA (Putative sulfate permease; physically interacts with Hsp82p; green fluorescent protein (GFP)-fusion protein localizes to the ER; YPR003C is not an essential gene [Source:SGD;Acc:S000006207])

HSP 1 Score: 63.929 bits (154), Expect = 5.969e-11
Identity = 80/353 (22.66%), Postives = 154/353 (43.63%), Query Frame = 1
Query:  943 SETNIPTMSMAIICISLLIFT---KEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEIS----KGLPSP-TMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLF----------MKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLY-----------SECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENK 1914
            ++ +IPT   +  C+ +L  T   K  +  Y   +  I  P  L VV+  IL S  F+L   + + I+G+ S      L +P T P  K+  +     +I  ++ F  S + +      +  ++SSN+E +A G MN+  S F   P+     RS +    G +S +S +   ++ +  +  + QF   +PNC+L+ I  +    L           ++C    +L+ F+        +TF  T+   +E G+ +G + SI +++  +   +  IL ++  T  + N+  Y              +EI G  I +    + + + E+ K+ L +       +I   ++SL +K
Sbjct:  284 AQYHIPTAIFSGCCLIVLFLTRLLKRKLMKY--HKSAIFFPDILLVVIVTILISMKFNLKHRYGISIIGDFSMDNFDELKNPLTRPRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFA--------VTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSK 626          
BLAST of slc26a-3 vs. Ensembl Nematostella
Match: EDO49691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG03])

HSP 1 Score: 242.276 bits (617), Expect = 1.564e-69
Identity = 174/513 (33.92%), Postives = 280/513 (54.58%), Query Frame = 1
Query:  715 AAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKK--RSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILR 2247
            A   A  +G+ QILMG C +G +  YLSDP+ISGFT GS+V V  SQ+K+ FG  +    G F  I     ++K I+ +N   +   ++C+ +L+ T + IN     R  IP+P EL VV  G   S   SL     V ++GEI KGLP  ++P  K     V D  +  ++ FA ++SLA +F+KK+  ++ +NQE LAYGM NV  SFFSCFP   +L+R+ VQE++   +QL S+    L++ VLLF+   F  LP  ILA+++I  L GL  + A L+ LW     D   W +T  G ++L V+ GL +G + +IF V+++   P+  ILG I  T++Y +     +   I  +KI ++E S+++A+    K+ +     +NP+    ++    +    A +  +   E +  D   K++  E+ ++   K    ++I+D S F FID++G+  I  +I E     + V L +  Y +RK+         +N+  +++SIHDAV+  L+
Sbjct:  200 AVTLALLIGIMQILMGLCRLGFVATYLSDPLISGFTTGSAVLVVLSQLKHIFGQVVPQNTGAFASIKVAAHMLKFIASSNPGAIITGVLCLVILV-TLKFINEKYKKRLPIPIPAELLVVALGTAISYGASLSDEFGVKVLGEIPKGLPPISIPSFKRMRTIVPDAFVISVVIFATNISLARMFAKKNGQTVDANQELLAYGMCNVGGSFFSCFPICNALARTVVQENL-ASTQLCSIPVICLILLVLLFMAPLFYYLPKAILAAVVIANLGGLLKQFARLRQLWCICRTDAVTWFVTCFGVILLGVDLGLGLGVITTIFVVIIRQSRPRVSILGHIKDTELYRDTQECPQAAGIPNVKILRFESSLFFANAGFIKERIMSF--MNPLTPTKRECIPGITTDEAEVTMELNAEKESLD-TTKRTNREQGVNANIK----AVIVDASAFTFIDSVGITAIKTIITEGDSRGVHVCLAACSYHLRKQLEAGGLEPSLNNDHLFVSIHDAVLFTLQ 703          

HSP 2 Score: 80.4925 bits (197), Expect = 1.284e-15
Identity = 35/71 (49.30%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  262 FPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            FP +  L KY +++  + DL  G+ VG+MHIPQG+A++ LA L PV GLY +L P +IY   GTSK++S G
Sbjct:   73 FPIVQWLPKYNFRKEFVADLTGGMTVGVMHIPQGLAFAMLASLPPVTGLYTALIPVMIYMLMGTSKYLSQG 143          
BLAST of slc26a-3 vs. Ensembl Nematostella
Match: EDO48275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ6])

HSP 1 Score: 86.6557 bits (213), Expect = 1.226e-17
Identity = 96/385 (24.94%), Postives = 182/385 (47.27%), Query Frame = 1
Query:  739 GLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVE--IQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIF----------------TKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVL-IVGEISKGLPSPTMPDIKISYNYVV----DII--------ITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLS----IFSVVLK--TQNPKSYILGQIDKTDIYCNIS-LYSECKEI 1779
            G+ Q+LMG   +G L  ++S P++SGFT  +++ +  SQIK   G++   + F      +  I +  KNI +T    + + +ICI +L+                 T   I     + + I +     V++   + +    +H +  V  + G +  GLP    P + I+   V     D++        I  +I F  S+++A  F++K+ Y + ++QE +A G+ NV +SF S +P   S SR+AV    G  +    + +  +++  L  +  FF+ +P   LA++II ++  + ++   +  +WR   +D    L+TF G    ++EYG+L G  +S    ++ V+    T+  + YI  +I     Y  +  + SE +E+
Sbjct:  137 GVIQLLMGILKLGFLVNFISIPVVSGFTSSAAIIIAISQIKDVLGLKNIPRPF------MKRIYQTFKNIGDTRRWDLVLGLICIIVLLLMRKLGRTRWVKDVIPETPRTIKVLKKICWLIAIARNAIVILVASVVAVLLYIHGHKSVFSLTGHLEPGLPPFKAPPMTITNGNVTYSTSDVLSQLGPGLAIVPLIGFLESIAIAKAFARKNRYKVDASQELIALGLANVLSSFVSSYPVTGSFSRTAVNAQSGVATPAGGIFTGAIVILALGVLTPFFKYIPKASLAALIISSVLTM-VEFQIVPRIWRVKKIDLIPLLVTFFGC-FYEIEYGILAGMGVSLAIFLYPVIWPTLTKTEQDYITIRIKGDLAYTGVEHVVSELEEL 513          

HSP 2 Score: 63.5438 bits (153), Expect = 1.697e-10
Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  259 KFPFIFILYKY--KWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            +FP    L KY   + +C   DLI G+ VG+M +PQG+AY+ +AGL P +GLY +     +Y  FGTSK I++G
Sbjct:   38 RFPIAKWLSKYNLHFLQC---DLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLG 108          
BLAST of slc26a-3 vs. Ensembl Nematostella
Match: EDO48274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ5])

HSP 1 Score: 70.0922 bits (170), Expect = 4.413e-14
Identity = 58/199 (29.15%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  283 YKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVE 879
            Y +   +C   D+I G+ VG+M IPQG+AY+ +AGL  V+GLY +     IY  FGTSK +S+G   I                                 ++LI + + HY                   +  +E  R     A   AFF GL Q  MG    G L +++S P+ISGFT  +++ +   Q+K   G++
Sbjct:   10 YSFNNLQC---DMIGGLTVGLMVIPQGLAYATIAGLPTVYGLYSAFMGCFIYCIFGTSKDVSLGPTAI---------------------------------MSLIVNQYCHY-------------------SEEDEDTRF----AIALAFFSGLIQFAMGFFRFGFLVRFISVPVISGFTSAAAITIAAGQLKSILGLQ 149          
BLAST of slc26a-3 vs. Ensembl Nematostella
Match: EDO34158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ57])

HSP 1 Score: 63.5438 bits (153), Expect = 1.618e-12
Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  259 KFPFIFILYKYK--WKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            +FP    L KY   + +C   DLI G+ VG+M +PQG+AY+ +AGL P +GLY +     +Y  FGTSK I++G
Sbjct:   15 RFPIAKWLSKYNLHFLQC---DLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLG 85          
BLAST of slc26a-3 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 356.681 bits (914), Expect = 1.505e-111
Identity = 236/769 (30.69%), Postives = 406/769 (52.80%), Query Frame = 1
Query:  100 FTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLN--PIEIFFKKRSLENKLAT--IQKKFEKENQMPDFMEKKSTI-----------------------------------------EEELD-QLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDV 2268
            + + R  L +   ++  +  T   SIK  + E  K+  R  CS  +  + L    P +  L KY ++E +L D+++G  VGIMH+PQGMAY+ LA LRPV+GLY SLFP L+Y  FGTS+H+SIG   +                             IS  V  +T+  R      + F  T  ++T + D A + +       A       G+ QIL+G    G +  YLS+P++ G+T G++ HV  SQ+KY FGV+   F G F++I TI ++ + + +T +P + ++++ +++LI  KE IN     +  +PVP+EL VV+G  +   +  + +++ + +VGEI  GL +P  PD+      + D I   I+++A+++SL   F+ K+ Y + SNQE +A G+ N   SFF C+   ASLSRS VQES GG +Q++ ++SS+L++ +++ IG  FE+LP  +L++I+ V LKG+F +  ++  LW+ + +D  +WL+TF+ TV+ +++ GL +    S+ + + KTQ P   ILG +  TD+Y +   + + KEI GIKIF+   ++ + + E + + L Q+ GL+   +++  KKR+ + K+A   ++K   KE  +   M K   I                                         E E D +   S   SII+D S   F+D + +K +  +  ++  +++ ++L   +  + ++  +      I    +++++HDAV+ ILR+   TD+
Sbjct:   12 YAVHRDVLDELGLEEVAQKGT--WSIKPTVGEKLKESLR--CSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAV-----------------------------ISIMVGSVTE--RLAPDEAFYFNGTNGSLTVNID-ARDAYR---VQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISLGKTFALKYGYKVDSNQELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQVKEIPGIKIFRSSATICFTNAELYLEALQQRSGLDVRKLQMEKKKRAKQEKMAKKEVKKSLNKEKNLS--MHKDVAIFLTNTSSNGFGHVNSAYQYDATTSEIDSGCHGENNLTPISYEHEKDGRTCMSVTHSIILDISTTGFVDTVTVKMLKNIFGDFADVDVDIYLAGCQACVVEQLEKAAFFESIPKTRLFVTVHDAVLHILRKLGQTDI 738          
BLAST of slc26a-3 vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 347.436 bits (890), Expect = 1.719e-108
Identity = 234/740 (31.62%), Postives = 389/740 (52.57%), Query Frame = 1
Query:   79 KQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNIT--TDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKF----------------EKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVV 2235
            +  + + + + R  L + E D+    +        ++ +S +      CS       L    P +  L +Y +KE  + DLI+GI VGIM +PQGMAY+ LA + P+ GLY S +P LIYF FGTSKHIS+G     Y + S+             I        +++ +   +DF             T  N+T  T  DT   + ER+    AA   F  G+ QIL+G    G +  YLS+P++ G+T  +++HV  SQ+KY FG+    + G  ++I T+ E+   + +TNI T+ + ++ I  L   KE +N Y+  +  +P+P EL  ++   + S    L   + + +VGEI  GL  P  PD+K+    + D     ++ + +++SL  IF+ K+ Y + SNQE +A G+ N     F CF  + S+SRS VQES GGK+Q++  +S+++++F+ L+IG  FE+LP  +LA+II V L+G+  +  ++  LW+ S +D  IW+ TF+ T++L+ + GL      S+ +V+ +TQ PK  ILG+++ TDIY  +  YS+ KE+ GI IF+   ++Y+A+ E +++ L +K G++  +I   K+ LE K    +KK                 + +N+ P   E  + I  +  + N S   +II+D S   F+D +G+KTI  +  +Y  I I V L + +  +         FN    +    ++ +IHDAV+
Sbjct:    2 EDRRRMDYRVQRQILDEGEVDELAHKDDSHFPFSERVKKSVR------CSGPRLKKALFSTIPILSWLPRYPFKEYAVGDLISGISVGIMQLPQGMAYALLASVPPIFGLYSSFYPVLIYFIFGTSKHISLGT----YAVMSV------------MIGG------VTERLAPDSDFM------------TWDNVTNATLIDTVARDAERV--RVAAAVTFMSGIFQILLGVVQFGFVVTYLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSGLQPPVFPDVKLFAPVIGDAFALSVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSKVKELPGILIFRSSATLYFANAEMYQEALGKKSGIDITKILSAKKKLEAKRIRHEKKVAKKAKKEQKINGVNMEQHDNEEP---EDIAVIHVD-PEPNPSLPQAIILDLSPVNFLDTVGVKTIRNIRRDYGEIGIEVVLAACQPGVVDNLEAGGFFNE--KVTKSCLFSTIHDAVL 692          
BLAST of slc26a-3 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 345.51 bits (885), Expect = 4.837e-107
Identity = 217/657 (33.03%), Postives = 366/657 (55.71%), Query Frame = 1
Query:   94 ISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLN--PIEIFFKKRSLENKLATIQKKFEKENQMPDFMEK--KSTIEEELDQLNKSTEFSIIIDCSNF 2052
            + + + R  L +   ++  +  T   SIK  + E  K+  R  CS  +  + L    P +  L KY ++E +L D+++G  VGIMH+PQGMAY+ LA LRPV+GLY SLFP L+Y  FGTS+H+SIG   +                             IS  V  +T+  R      + F  T  ++T + D A + +       A       G+ QIL+G    G +  YLS+P++ G+T G++ HV  SQ+KY FGV+   F G F++I TI ++ + + +T +P + ++++ +++LI  KE IN     +  +PVP+EL VV+G  +   +  + +++ + +VGEI  GL +P  PD+      + D I   I+++A+++SL   F+ K+ Y + SNQE +A G+ N   SFF C+   ASLSRS VQES GG +Q++ ++SS+L++ +++ IG  FE+LP  +L++I+ V LKG+F +  ++  LW+ + +D  +WL+TF+ TV+ +++ GL +    S+ + + KTQ P   ILG +  TD+Y +   + + KEI GIKIF+   ++ + + E + + L Q+ GL+   +++  KKR+ + K+A  + K        D ++    ST   ++ +LNK    S+  D + F
Sbjct:    9 VKYAVHRDVLDELGLEEVAQKGT--WSIKPTVGEKLKESLR--CSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAV-----------------------------ISIMVGSVTE--RLAPDEAFYFNGTNGSLTVNID-ARDAYR---VQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISLGKTFALKYGYKVDSNQELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQVKEIPGIKIFRSSATICFTNAELYLEALQQRSGLDVRKLQMEKKKRAKQEKMAKKEVKKSVIEIHKDLLDHPCNSTSSSKVSELNKEKNLSMHKDVAIF 625          
BLAST of slc26a-3 vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 339.732 bits (870), Expect = 5.922e-106
Identity = 227/724 (31.35%), Postives = 376/724 (51.93%), Query Frame = 1
Query:   79 KQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNIT--TDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQ---FNSPCHINDKMVYLSIHDAVV 2235
            +  + + + + R  L + E D+    +        ++ +S +      CS       L    P +  L +Y +KE  + DLI+GI VGIM +PQGMAY+ LA + P+ GLY S +P LIYF FGTSKHIS+G     Y + S+             I        +++ +   +DF             T  N+T  T  DT   + ER+    AA   F  G+ QIL+G    G +  YLS+P++ G+T  +++HV  SQ+KY FG+    + G  ++I T+ E+   + +TNI T+ + ++ I  L   KE +N Y+  +  +P+P EL  ++   + S    L   + + +VGEI  GL  P  PD+K+    + D     ++ + +++SL  IF+ K+ Y + SNQE +A G+ N     F CF  + S+SRS VQES GGK+Q++  +S+++++F+ L+IG  FE+LP  +LA+II V L+G+  +  ++  LW+ S +D  IW+ TF+ T++L+ + GL      S+ +V+ +TQ PK  ILG+++ TDIY  +  YS+ KE+ GI IF+   ++Y+A+ E +++ L                          KK + +N+ P   E  + I  +  + N S   +II+D S   F+D +G+KTI  +  +Y  I I V L + +  +         FN    +    ++ +IHDAV+
Sbjct:    2 EDRRRMDYRVQRQILDEGEVDELAHKDDSHFPFSERVKKSVR------CSGPRLKKALFSTIPILSWLPRYPFKEYAVGDLISGISVGIMQLPQGMAYALLASVPPIFGLYSSFYPVLIYFIFGTSKHISLGT----YAVMSV------------MIGG------VTERLAPDSDFM------------TWDNVTNATLIDTVARDAERV--RVAAAVTFMSGIFQILLGVVQFGFVVTYLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSGLQPPVFPDVKLFAPVIGDAFALSVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSKVKELPGILIFRSSATLYFANAEMYQEAL-------------------------GKKEQHDNEEP---EDIAVIHVD-PEPNPSLPQAIILDLSPVNFLDTVGVKTIRNIRRDYGEIGIEVVLAACQPGVVDNLEAGGFFNE--KVTKSCLFSTIHDAVL 651          
BLAST of slc26a-3 vs. Ensembl Medaka
Match: slc26a10 (solute carrier family 26 member 10 [Source:NCBI gene;Acc:101171246])

HSP 1 Score: 329.331 bits (843), Expect = 6.886e-102
Identity = 219/732 (29.92%), Postives = 382/732 (52.19%), Query Frame = 1
Query:   97 SFTITRPTLSQYEFDQNYEINTDQ---LSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFK---KRSLENK-----LATIQKKFEKE--NQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQR 2253
            S  + R   ++  F Q Y    D    + ++ +L        R  CSR  F + L  + P    L +YK ++ +L D I G+ VGI+HIPQGMA++ L  + P+ GLY S FP ++Y  FGT  H+S G   +                                 V+L+T      L         +   ++  + A  E +R+    A+  A   G+  I M   ++G L+ YLS+PI+  F   ++ HV  SQ++   G+ +    G F+   T+  V++N+  TN   + ++++ +++L+  KE IN     R R P+P+E+  V+         SL   + + IVG+I  G P P +P I        D +   ++ +A+SVSLA I++ KH YSI  NQE LA+G+ N  ++FF+CFPS+A+L+ + + ES GG +QL  L +S++++ VLL IG  F  LP  +LA I + +L+ + ++  +L +LWR S +DF +W++T+L  V+L+V+ GL +G + S+ +++ +TQ     +LG+   T+IY  +  +++C E+ G+KI  Y G +YY +   F++ + + +GL P +I  +   K++LE +     + T+++       + + DF   KS  E +L+        +++IDCS+  FID  G +   Q+  + Q I +SV+L +   ++ K         H+N + +++++HDAV  I +Q+
Sbjct:    4 SVAVYRDIFTEDRFKQAYGSEEDTGGGVRLRDRLA------GRCRCSREAFLHLLRERVPIFRWLPRYKLRKWILGDTIAGLTVGILHIPQGMAFALLTSVAPIFGLYTSFFPVVLYMIFGTGHHVSTGTFAV---------------------------------VSLMTGSVVEQL-----VPTPLEMNSSSPEAAGFEAQRI--GVASAVALLSGIFMICMFALHLGFLSTYLSEPIVKAFISAAAFHVTISQLQSMLGLRLPRHTGNFSFFKTLVSVMENLPHTNTAELIISLVSLAVLVPVKE-INVRFRHRLRTPIPVEILTVIIATCVVYASSLDSIYNIEIVGDIPAGFPRPQLPAINTFPAIAGDTVAITLVGYALSVSLAMIYADKHGYSIQPNQELLAHGISNAVSAFFTCFPSSATLATTNILESAGGHTQLCGLFTSLVVLVVLLLIGPLFYFLPKAVLACINVTSLRQMLLQFQDLPELWRISKLDFMVWIVTWLSVVVLNVDLGLAIGVVFSMMTIICRTQRVACSVLGRASNTEIYRPLENHNKCYEVPGVKILTYNGPIYYGNRSFFREQMSKLLGLTPEKIRRREKAKKALEKQESETVICTVERGIANTSFSSVSDFF--KSASESDLE--------AVLIDCSSVIFIDVAGARLFTQMCTQCQNIGVSVYLANCNENVLKIMTSSGLMSHMNPQHIFVTVHDAVTYIQQQK 678          
BLAST of slc26a-3 vs. Planmine SMEST
Match: SMESG000064565.1 (SMESG000064565.1)

HSP 1 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 699/753 (92.83%), Postives = 705/753 (93.63%), Query Frame = 1
Query:   16 MEKHSLITNEIELAGFRCNDGKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 2274
            +EKHSLITNEIELAGFRCNDGKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG   I                                  +L+T+ F       +   +TVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM
Sbjct:   29 LEKHSLITNEIELAGFRCNDGKQTQEISFTITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGSMAI---------------------------------ASLMTNKFLEKSLVDFPI-QTVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 747          

HSP 2 Score: 52.7582 bits (125), Expect = 9.062e-7
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 3
Query:  510 SLGSMAIASLMTNKFLEKSLVDFPIRNIN 596
            S+GSMAIASLMTNKFLEKSLVDFPI+ ++
Sbjct:  179 SIGSMAIASLMTNKFLEKSLVDFPIQTVH 207          
BLAST of slc26a-3 vs. Planmine SMEST
Match: SMESG000064565.1 (SMESG000064565.1)

HSP 1 Score: 1107.43 bits (2863), Expect = 0.000e+0
Identity = 590/643 (91.76%), Postives = 595/643 (92.53%), Query Frame = 1
Query:  346 MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 2274
            MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG   I                                  +L+T+ F       +   +TVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM
Sbjct:    1 MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGSMAI---------------------------------ASLMTNKFLEKSLVDFPI-QTVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 609          

HSP 2 Score: 53.1434 bits (126), Expect = 7.046e-7
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 3
Query:  510 SLGSMAIASLMTNKFLEKSLVDFPIRNIN 596
            S+GSMAIASLMTNKFLEKSLVDFPI+ ++
Sbjct:   41 SIGSMAIASLMTNKFLEKSLVDFPIQTVH 69          
BLAST of slc26a-3 vs. Planmine SMEST
Match: SMESG000064565.1 (SMESG000064565.1)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 589/643 (91.60%), Postives = 594/643 (92.38%), Query Frame = 1
Query:  346 MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFFRHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 2274
            MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG   I                                  +L+T+ F       +   +TVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVV GGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM
Sbjct:    1 MHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGSMAI---------------------------------ASLMTNKFLEKSLVDFPI-QTVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVV-GGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQM 608          

HSP 2 Score: 53.1434 bits (126), Expect = 6.861e-7
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 3
Query:  510 SLGSMAIASLMTNKFLEKSLVDFPIRNIN 596
            S+GSMAIASLMTNKFLEKSLVDFPI+ ++
Sbjct:   41 SIGSMAIASLMTNKFLEKSLVDFPIQTVH 69          
BLAST of slc26a-3 vs. Planmine SMEST
Match: SMESG000064566.1 (SMESG000064566.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 316/660 (47.88%), Postives = 455/660 (68.94%), Query Frame = 1
Query:  286 KYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGLKFI*YFISSMNP*DQWQLRV**QINF*RNH*LISQYVTLITDFF--RHYL*FTYKFTETVHNITTDYDTANNEFERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRV 2259
            +YKWK  LL DLI G+IVG M IPQ  AY+QL G++P++GLY++ FP ++Y+FFG+S+HISIG   I                                 V+L++  F  +  + F    T+TV N++     A+ + E + ++R AG   FVG++Q++MG  N+G LTKYLSDP+ISGFTVGS++ VF++Q+KYCFGV I  +YGIF+V NT+  V K +  TNIPT  +  I I LL  TK  INP +M +   P+P+EL VVV G ++S+Y  LH  + V +VG I +G+P+P +P I    NY+ +II+T IIAF+VS+SL  +F+KKH Y I + QEF+A+G+MN+F+SFF C+PSA S+SRSAVQE+ GGK+Q++SL+S IL++FVLLFIG  F+ LPNCILAS+IIVALK + MK  ELK+LW FS+ DFS+W++TFL T+ LDV+YGL+ G  LSI S+VL+TQ+P S+ILGQI  TD+Y N+++Y +C EI GIKIF+YEGS+YYA  ++FKK+LY KI  +PI +  +   ++ K+  I +  E E +  D + K++  +EELD L       IIIDCS + +ID +G+K ++QVIEEY+ +NISV L + K D+R+ F++  +   I+D+ +++S+HDAV++ L   ++
Sbjct:    2 RYKWKTWLLLDLIAGLIVGTMQIPQSFAYAQLVGIQPIYGLYLAFFPVMVYYFFGSSRHISIGTIAI---------------------------------VSLLSGSFLEQSLIDFPLNTTKTVGNVS-----ASVQNEAIKASRVAGLTLFVGISQLIMGVFNLGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGVPAPVIPVIDNMSNYISNIIVTAIIAFSVSISLGKMFAKKHGYKIDATQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRIEKIQKKIKKINQSLE-EMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYNHKI 622          
BLAST of slc26a-3 vs. Planmine SMEST
Match: SMESG000064562.1 (SMESG000064562.1)

HSP 1 Score: 523.087 bits (1346), Expect = 7.291e-176
Identity = 290/526 (55.13%), Postives = 396/526 (75.29%), Query Frame = 1
Query:  694 ERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVXXXXXXXXXXXXXLSRSAVQESVGGKSQXXXXXXXXXXXXXXXXXGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 2271
            E L +NR AGFAF VG+ Q++MG  N+G LTKYLSDP+ISGFTVG+S+HVFTSQIKYCFG+ I   +G+FN+  T   + KN+ +TNIPT+ + ++ I +L  TKE INP V+ + R+P+PMEL VV+ G + S+Y  L++NHKV IVGEIS+GLP+P++PD+     YV DI IT IIAF+V +SLA +FSKKH Y I +NQE +AYG+MN  ASFF C+PSA+SLSRSAVQESVGGK+QL+SL+SS LL+FVLLFIG  F  LPNCIL++IIIVALKG+FM+ AELK+LW FS+ DFS W++ FLGT  +DVEYGL++G   SI  ++L+TQNPKS+ILGQI  TD+Y N+ +Y+EC+EI GIKIF+YEGS+YYA  +NFK +LY KI  NP  I  +   LE KL  +++        P F E+K+ +E EL++L       +IIDCS + +ID +G+KT+NQVIEEY+ INI+V L + K D+R    + ++   I+D+++++S+HDAV++ + +R++ +V 
Sbjct:  210 ELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNECEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSP-FFEEKAQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVN 734          

HSP 2 Score: 137.117 bits (344), Expect = 3.402e-33
Identity = 61/124 (49.19%), Postives = 85/124 (68.55%), Query Frame = 1
Query:  103 TITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIG 474
            +I RP  +Q+EFD N+  N  + S K + +   +  ++ + ++      +  K PFI I+ KYKW+E LL D I G+IVGIMHIPQ MAY+ LAGL+P++GLY S FP ++YFFFGTS+HISIG
Sbjct:   30 SIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIG 153          
The following BLAST results are available for this feature:
BLAST of slc26a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A41.024e-9729.74solute carrier family 26 member 4 [Source:HGNC Sym... [more]
SLC26A63.767e-9429.39solute carrier family 26 member 6 [Source:HGNC Sym... [more]
SLC26A56.843e-9333.71solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A51.547e-9234.45solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A54.425e-9233.58solute carrier family 26 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sulp-49.093e-8730.46Anion transporter SULP-4; SULfate Permease family ... [more]
sulp-61.243e-8529.22SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-61.243e-8529.22SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-73.790e-8133.08Anion transporter SULP-7a; SULfate Permease family... [more]
sulp-85.753e-7932.56Anion transporter SULP-8a; Anion transporter SULP-... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prestin5.397e-9030.79gene:FBgn0036770 transcript:FBtr0075153[more]
Esp2.736e-2824.62gene:FBgn0013953 transcript:FBtr0304054[more]
Esp2.736e-2824.62gene:FBgn0013953 transcript:FBtr0084703[more]
CG50027.849e-2323.56gene:FBgn0034275 transcript:FBtr0089546[more]
CG61251.801e-1824.42gene:FBgn0038337 transcript:FBtr0346109[more]
back to top
BLAST of slc26a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-117c9.27.161e-11431.31si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
slc26a101.195e-11331.82solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
si:ch211-117c9.23.141e-11331.14si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
slc26a102.057e-10731.30solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a102.057e-10731.30solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A51.813e-11833.92solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A51.374e-11531.67solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A55.569e-11033.10solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A57.059e-11032.90solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A51.203e-10931.37solute carrier family 26 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc26a42.290e-9628.85solute carrier family 26, member 4 [Source:MGI Sym... [more]
Slc26a51.747e-9433.84solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a54.424e-9433.84solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a29.368e-8434.92solute carrier family 26 (sulfate transporter), me... [more]
Slc26a21.191e-8334.95solute carrier family 26 (sulfate transporter), me... [more]
back to top
BLAST of slc26a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q65AC2|S26A2_HORSE6.543e-10032.50Sulfate transporter OS=Equus caballus OX=9796 GN=S... [more]
sp|O43511|S26A4_HUMAN4.916e-9729.74Pendrin OS=Homo sapiens OX=9606 GN=SLC26A4 PE=1 SV... [more]
sp|Q9R155|S26A4_MOUSE1.602e-9528.85Pendrin OS=Mus musculus OX=10090 GN=Slc26a4 PE=1 S... [more]
sp|Q9BEG8|S26A2_BOVIN4.002e-9532.84Sulfate transporter OS=Bos taurus OX=9913 GN=SLC26... [more]
sp|Q9JKQ2|S26A5_MERUN9.007e-9534.65Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26... [more]
back to top
BLAST of slc26a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFG70.000e+0100.00Slc26a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFH18.232e-16953.43Slc26a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKD15.374e-16350.96Slc26a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1I8GRH24.953e-15137.75STAS domain-containing protein OS=Macrostomum lign... [more]
A0A267GHC87.568e-15138.61STAS domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a101.967e-10931.64solute carrier family 26 member 10 [Source:NCBI ge... [more]
slc26a67.369e-10331.67solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a28.823e-10131.93solute carrier family 26 member 2 [Source:NCBI gen... [more]
slc26a3.11.341e-9028.61chloride anion exchanger-like [Source:NCBI gene;Ac... [more]
slc26a52.212e-9033.45solute carrier family 26 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003427.19.075e-11132.90pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-... [more]
si:ch211-117c9.28.016e-8531.32si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
ENSPMAT00000003699.14.468e-4239.38pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 ge... [more]
ENSPMAT00000006617.12.503e-2230.34pep scaffold:Pmarinus_7.0:GL482475:5949:18084:-1 g... [more]
slc26a117.891e-1525.89solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SUL21.515e-1722.39High affinity sulfate permease; sulfate uptake is ... [more]
SUL19.327e-1232.86High affinity sulfate permease of the SulP anion t... [more]
YPR003C_mRNA5.969e-1122.66Putative sulfate permease; physically interacts wi... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO496911.564e-6933.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482751.226e-1724.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482744.413e-1429.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341581.618e-1244.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc26a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-117c9.21.505e-11130.69solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a61.719e-10831.62solute carrier family 26 member 6 [Source:NCBI gen... [more]
si:ch211-117c9.24.837e-10733.03solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a65.922e-10631.35solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a106.886e-10229.92solute carrier family 26 member 10 [Source:NCBI ge... [more]
back to top
BLAST of slc26a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064565.19.062e-792.83SMESG000064565.1[more]
SMESG000064565.17.046e-791.76SMESG000064565.1[more]
SMESG000064565.16.861e-791.60SMESG000064565.1[more]
SMESG000064566.10.000e+047.88SMESG000064566.1[more]
SMESG000064562.17.291e-17655.13SMESG000064562.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009861
GenBankAKN21607.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009861 ID=SMED30009861|Name=slc26a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2291bp
CTATATAAATCTTATATGGAAAAACATAGTTTGATCACAAATGAGATTGA
ATTGGCGGGATTTCGTTGCAATGATGGCAAACAAACCCAGGAAATTAGCT
TTACCATCACTCGTCCGACACTTTCACAATATGAATTCGATCAGAATTAT
GAAATTAATACTGATCAATTGTCGATCAAAAGTCAGTTAATCGAGTCATC
GAAAGATTTTCAACGAAATTTTTGTTCTCGGAATAATTTCTACAATTTTC
TTTGTGGGAAATTTCCTTTTATTTTTATTCTTTATAAATACAAGTGGAAA
GAATGCTTGCTTGAGGACTTAATAACTGGCATAATCGTAGGAATAATGCA
TATTCCACAAGGAATGGCGTATTCCCAATTAGCTGGACTGAGACCAGTCC
ACGGACTTTATGTTTCATTATTCCCTGCTTTAATATATTTCTTTTTTGGC
ACTTCAAAACATATTTCTATAGGTTTGAAATTTATTTAATATTTTATAAG
TTCTATGAATCCCTAGGATCAATGGCAATTGCGAGTTTGATGACAAATAA
ATTTTTAGAGAAATCACTAGTTGATTTCCCAATACGTAACATTAATTACA
GATTTTTTTCGCCATTATTTATAATTTACATATAAATTTACAGAAACCGT
TCATAACATCACAACAGATTATGATACCGCAAATAATGAGTTTGAGCGTC
TCGTATCAAACCGCGCCGCCGGCTTTGCATTCTTTGTTGGTTTAACGCAA
ATTTTGATGGGAACGTGCAATATGGGATCATTGACAAAATATCTCTCTGA
TCCAATCATTTCAGGCTTCACTGTCGGTTCGTCTGTCCATGTGTTCACCA
GTCAAATCAAGTATTGTTTTGGTGTAGAAATTCAAACCTTTTATGGGATT
TTCAATGTGATTAATACTATTACTGAAGTTATAAAAAACATTTCGGAAAC
AAATATTCCTACAATGTCAATGGCAATTATTTGTATTTCGTTGCTGATAT
TTACCAAAGAAGCAATAAATCCTTACGTCATGCTGCGATTCCGGATTCCA
GTGCCAATGGAATTATTTGTTGTCGTTGGTGGTATATTGGCATCGGAATA
TTTCAGTCTTCATAAAAACCATAAAGTGCTAATTGTTGGTGAGATTTCAA
AAGGGTTACCTTCACCTACAATGCCAGATATTAAAATATCATATAATTAT
GTCGTTGACATAATTATTACAGGAATTATAGCCTTTGCAGTATCTGTTTC
TCTGGCCGACATTTTCTCCAAAAAACATTGTTATAGTATAAGTTCAAATC
AAGAGTTTTTAGCATATGGAATGATGAATGTATTTGCATCGTTTTTCTCC
TGCTTTCCTTCGGCGGCGTCGTTGAGTAGATCAGCTGTTCAAGAGTCAGT
TGGCGGTAAATCGCAGTTAAGTTCCCTTATATCCTCCATTCTATTAGTAT
TTGTCCTGTTGTTTATTGGGCAATTCTTTGAAAATTTACCAAATTGTATA
TTGGCATCAATTATAATCGTTGCATTGAAAGGACTATTTATGAAATGTGC
CGAATTGAAGGATCTTTGGAGATTTTCTCTAATGGACTTTAGCATATGGT
TAATTACATTCCTCGGTACTGTTATATTGGATGTGGAATATGGACTATTA
GTTGGGACGATGCTCTCAATATTTTCAGTCGTTTTAAAAACTCAAAATCC
AAAATCTTATATACTTGGTCAAATAGACAAAACAGACATTTATTGCAATA
TTTCTTTGTATTCAGAGTGTAAAGAAATATTGGGAATAAAAATTTTCCAA
TACGAAGGAAGTGTCTATTACGCAAGCTGTGAAAATTTTAAAAAGAATTT
ATATCAAAAAATAGGATTAAATCCAATAGAGATTTTTTTCAAAAAAAGGA
GTTTAGAAAATAAATTGGCGACAATTCAGAAAAAGTTTGAGAAAGAAAAT
CAGATGCCTGATTTTATGGAAAAGAAATCAACAATTGAAGAAGAATTAGA
TCAGTTAAACAAATCTACCGAATTCTCCATAATAATAGACTGTTCCAACT
TTCAATTCATTGATGCAATGGGAATGAAAACCATCAATCAAGTAATTGAA
GAATATCAAATTATCAACATTTCAGTATTCCTAACAAGCCTTAAATACGA
TATTCGGAAAAAATTCCATCAATTCAACTCTCCGTGTCACATCAATGACA
AAATGGTTTATTTATCAATTCATGACGCAGTTGTCAGTATTTTGCGTCAG
CGCAGAGTCACAGATGTTCAAATGTAATAATGTTTACATTT
back to top

protein sequence of SMED30009861-orf-1

>SMED30009861-orf-1 ID=SMED30009861-orf-1|Name=SMED30009861-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFN
VINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVP
MELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVV
DIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCF
PSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILA
SIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVG
TMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYE
GSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQM
PDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEY
QIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRR
VTDVQM*
back to top

protein sequence of SMED30009861-orf-2

>SMED30009861-orf-2 ID=SMED30009861-orf-2|Name=SMED30009861-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
LYKSYMEKHSLITNEIELAGFRCNDGKQTQEISFTITRPTLSQYEFDQNY
EINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWK
ECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFG
TSKHISIGLKFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR036513STAS_dom_sf
IPR001902SLC26A/SulP_fam
IPR011547SLC26A/SulP_dom
IPR002645STAS_dom
Vocabulary: biological process
TermDefinition
GO:0008272sulfate transport
GO:0006810transport
GO:0055085transmembrane transport
GO:1902358sulfate transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015116sulfate transmembrane transporter activity
GO:0008271secondary active sulfate transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 380..400
NoneNo IPR availablePANTHERPTHR11814:SF180ANION TRANSPORTER SULP-4coord: 2..496
NoneNo IPR availableCDDcd07042STAS_SulP_like_sulfate_transportercoord: 335..488
e-value: 1.00767E-10
score: 56.8662
NoneNo IPR availableTMHMMTMhelixcoord: 246..265
NoneNo IPR availableTMHMMTMhelixcoord: 219..241
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 185..207
IPR036513STAS domain superfamilyGENE3DG3DSA:3.30.750.24coord: 314..497
e-value: 1.6E-34
score: 120.3
IPR036513STAS domain superfamilySUPERFAMILYSSF52091SpoIIaa-likecoord: 343..491
IPR002645STAS domainPFAMPF01740STAScoord: 336..491
e-value: 1.8E-19
score: 69.5
IPR002645STAS domainPROSITEPS50801STAScoord: 334..495
score: 18.205
IPR011547SLC26A/SulP transporter domainPFAMPF00916Sulfate_transpcoord: 1..284
e-value: 4.3E-76
score: 256.1
IPR001902SLC26A/SulP transporterPANTHERPTHR11814SULFATE TRANSPORTERcoord: 2..496