40S ribosomal protein S24

Overview
Name40S ribosomal protein S24
Smed IDSMED30009859
Length (bp)492
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S24 (SMED30009859) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S24 (SMED30009859) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S24 (SMED30009859) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S24 (SMED30009859) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009859

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009859SMESG000035929.1 SmedASXL_018652SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009859SMESG000035929.1 dd_Smed_v4_164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009859SMESG000035929.1 Contig35397newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009859SMESG000035929.1 Contig35397uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009859SMESG000035930.1 SMESG000035929.1 Contig43503newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009859SMESG000035930.1 SMESG000035929.1 Contig43503uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30009859SMESG000035929.1 dd_Smed_v6_164_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30009859SMESG000035930.1 SMESG000035929.1 Contig43503newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009859SMESG000035930.1 SMESG000035929.1 Contig43503uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30009859SMESG000035929.1 PL06022B1C12ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S24 vs. Ensembl Human
Match: RPS24 (ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC:10411])

HSP 1 Score: 135.576 bits (340), Expect = 6.091e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Human
Match: RPS24 (ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC:10411])

HSP 1 Score: 135.191 bits (339), Expect = 6.448e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Human
Match: RPS24 (ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC:10411])

HSP 1 Score: 135.191 bits (339), Expect = 6.448e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Human
Match: RPS24 (ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC:10411])

HSP 1 Score: 135.191 bits (339), Expect = 6.519e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Human
Match: RPS24 (ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC:10411])

HSP 1 Score: 135.191 bits (339), Expect = 6.679e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Celegans
Match: rps-24 (Ribosomal Protein, Small subunit [Source:UniProtKB/TrEMBL;Acc:Q1XFY9])

HSP 1 Score: 138.272 bits (347), Expect = 1.609e-42
Identity = 60/95 (63.16%), Postives = 77/95 (81.05%), Query Frame = 3
Query:   75 IVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
            + ++TRK LTN+LL RKQMVV+V+HPGR   PK +IRE +AK+YKTTPD V  F F++  GGGKS GFAL+YDT+D+AKKFEPK+RL+R G  +K
Sbjct:    5 VTIRTRKVLTNKLLYRKQMVVEVIHPGRPTVPKADIREKIAKLYKTTPDTVIPFGFESKIGGGKSKGFALVYDTIDFAKKFEPKYRLVRMGLATK 99          
BLAST of 40S ribosomal protein S24 vs. Ensembl Celegans
Match: rps-24 (Ribosomal Protein, Small subunit [Source:UniProtKB/TrEMBL;Acc:Q1XFY9])

HSP 1 Score: 138.272 bits (347), Expect = 1.609e-42
Identity = 60/95 (63.16%), Postives = 77/95 (81.05%), Query Frame = 3
Query:   75 IVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
            + ++TRK LTN+LL RKQMVV+V+HPGR   PK +IRE +AK+YKTTPD V  F F++  GGGKS GFAL+YDT+D+AKKFEPK+RL+R G  +K
Sbjct:    5 VTIRTRKVLTNKLLYRKQMVVEVIHPGRPTVPKADIREKIAKLYKTTPDTVIPFGFESKIGGGKSKGFALVYDTIDFAKKFEPKYRLVRMGLATK 99          
BLAST of 40S ribosomal protein S24 vs. Ensembl Celegans
Match: rps-24 (Ribosomal Protein, Small subunit [Source:UniProtKB/TrEMBL;Acc:Q1XFY9])

HSP 1 Score: 138.272 bits (347), Expect = 1.609e-42
Identity = 60/95 (63.16%), Postives = 77/95 (81.05%), Query Frame = 3
Query:   75 IVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
            + ++TRK LTN+LL RKQMVV+V+HPGR   PK +IRE +AK+YKTTPD V  F F++  GGGKS GFAL+YDT+D+AKKFEPK+RL+R G  +K
Sbjct:    5 VTIRTRKVLTNKLLYRKQMVVEVIHPGRPTVPKADIREKIAKLYKTTPDTVIPFGFESKIGGGKSKGFALVYDTIDFAKKFEPKYRLVRMGLATK 99          
BLAST of 40S ribosomal protein S24 vs. Ensembl Celegans
Match: rps-24 (Ribosomal Protein, Small subunit [Source:UniProtKB/TrEMBL;Acc:Q1XFY9])

HSP 1 Score: 138.272 bits (347), Expect = 1.609e-42
Identity = 60/95 (63.16%), Postives = 77/95 (81.05%), Query Frame = 3
Query:   75 IVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
            + ++TRK LTN+LL RKQMVV+V+HPGR   PK +IRE +AK+YKTTPD V  F F++  GGGKS GFAL+YDT+D+AKKFEPK+RL+R G  +K
Sbjct:    5 VTIRTRKVLTNKLLYRKQMVVEVIHPGRPTVPKADIREKIAKLYKTTPDTVIPFGFESKIGGGKSKGFALVYDTIDFAKKFEPKYRLVRMGLATK 99          
BLAST of 40S ribosomal protein S24 vs. Ensembl Fly
Match: RpS24 (gene:FBgn0261596 transcript:FBtr0071935)

HSP 1 Score: 151.754 bits (382), Expect = 9.865e-48
Identity = 70/96 (72.92%), Postives = 80/96 (83.33%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGF 350
            S  +  ++TRKF+TNRLL RKQMV DVLHPG +   KTEIRE LA MYK TPDVVFAF F+TNFGGG+S+GFALIYDTLD+AKKFEPK+RL RHG 
Sbjct:    2 SGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYKVTPDVVFAFGFRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGL 97          
BLAST of 40S ribosomal protein S24 vs. Ensembl Zebrafish
Match: rps24 (ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-040109-5])

HSP 1 Score: 135.576 bits (340), Expect = 3.184e-41
Identity = 71/100 (71.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ V+TRKF+TNRLL RKQM+VDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F FKT FGGGK++GF +IYD+LDYAKK EPK+RL RHG   K  ++
Sbjct:    4 TVTVRTRKFMTNRLLQRKQMIVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFGMIYDSLDYAKKNEPKYRLQRHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Zebrafish
Match: rps24 (ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-040109-5])

HSP 1 Score: 135.576 bits (340), Expect = 3.560e-41
Identity = 71/100 (71.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ V+TRKF+TNRLL RKQM+VDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F FKT FGGGK++GF +IYD+LDYAKK EPK+RL RHG   K  ++
Sbjct:    4 TVTVRTRKFMTNRLLQRKQMIVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFGMIYDSLDYAKKNEPKYRLQRHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Zebrafish
Match: rps24 (ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-040109-5])

HSP 1 Score: 124.02 bits (310), Expect = 8.003e-37
Identity = 66/91 (72.53%), Postives = 76/91 (83.52%), Query Frame = 3
Query:   99 LTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +TNRLL RKQM+VDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F FKT FGGGK++GF +IYD+LDYAKK EPK+RL RHG   K  ++
Sbjct:    1 MTNRLLQRKQMIVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFGMIYDSLDYAKKNEPKYRLQRHGLYEKKKTS 91          
BLAST of 40S ribosomal protein S24 vs. Ensembl Zebrafish
Match: rps24 (ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-040109-5])

HSP 1 Score: 124.02 bits (310), Expect = 8.003e-37
Identity = 66/91 (72.53%), Postives = 76/91 (83.52%), Query Frame = 3
Query:   99 LTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +TNRLL RKQM+VDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F FKT FGGGK++GF +IYD+LDYAKK EPK+RL RHG   K  ++
Sbjct:    1 MTNRLLQRKQMIVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFGMIYDSLDYAKKNEPKYRLQRHGLYEKKKTS 91          
BLAST of 40S ribosomal protein S24 vs. Ensembl Xenopus
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:549379])

HSP 1 Score: 135.191 bits (339), Expect = 5.845e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Xenopus
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:549379])

HSP 1 Score: 135.191 bits (339), Expect = 5.924e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    3 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 102          
BLAST of 40S ribosomal protein S24 vs. Ensembl Xenopus
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:549379])

HSP 1 Score: 135.191 bits (339), Expect = 6.054e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Xenopus
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:549379])

HSP 1 Score: 134.806 bits (338), Expect = 1.014e-40
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Mouse
Match: Rps24 (ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:98147])

HSP 1 Score: 135.191 bits (339), Expect = 4.427e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Mouse
Match: Rps24 (ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:98147])

HSP 1 Score: 135.191 bits (339), Expect = 4.585e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Mouse
Match: Rps24 (ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:98147])

HSP 1 Score: 135.191 bits (339), Expect = 4.585e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Mouse
Match: Rps24 (ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:98147])

HSP 1 Score: 135.191 bits (339), Expect = 5.539e-41
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Mouse
Match: Rps24 (ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:98147])

HSP 1 Score: 124.02 bits (310), Expect = 7.768e-37
Identity = 65/91 (71.43%), Postives = 77/91 (84.62%), Query Frame = 3
Query:   99 LTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    1 MTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 91          
BLAST of 40S ribosomal protein S24 vs. UniProt/SwissProt
Match: sp|O42387|RS24_TAKRU (40S ribosomal protein S24 OS=Takifugu rubripes OX=31033 GN=rps24 PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.030e-50
Identity = 75/100 (75.00%), Postives = 86/100 (86.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHG-FGSKDTS 368
            ++ V+TRKF+TNRLL RKQMVVDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F F+T FGGGK++GFA++YD+LDYAKK EPKHRL RHG F  K TS
Sbjct:    4 TVTVRTRKFMTNRLLQRKQMVVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFRTQFGGGKTTGFAMVYDSLDYAKKNEPKHRLARHGLFEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. UniProt/SwissProt
Match: sp|Q962Q6|RS24_SPOFR (40S ribosomal protein S24 OS=Spodoptera frugiperda OX=7108 GN=RpS24 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.368e-49
Identity = 75/103 (72.82%), Postives = 82/103 (79.61%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +E +  ++TRKF+TNRLL RKQMV DVLHPG+    KTEIRE LAKMYK TPDVVF F FKTNFGGGKS+GFALIYDTLD AKKFEPKHRL RHG   K   T
Sbjct:    2 TEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPT 104          
BLAST of 40S ribosomal protein S24 vs. UniProt/SwissProt
Match: sp|Q90YQ0|RS24_ICTPU (40S ribosomal protein S24 OS=Ictalurus punctatus OX=7998 GN=rps24 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 9.611e-49
Identity = 71/100 (71.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            S+ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDVVF F FKT FGGGK++GFA++YD+LDYAKK EPK+RL RHG   K  ++
Sbjct:    4 SVTLRTRKFMTNRLLQRKQMVLDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFAMVYDSLDYAKKNEPKYRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. UniProt/SwissProt
Match: sp|Q9W6X9|RS24_ORYLA (40S ribosomal protein S24 OS=Oryzias latipes OX=8090 GN=rps24 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.809e-48
Identity = 70/100 (70.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMVVDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F F+T FGGGK++GFA++YD+LDYAKK EPKHRL  HG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFRTQFGGGKTTGFAMVYDSLDYAKKNEPKHRLATHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. UniProt/SwissProt
Match: sp|Q5RAQ8|RS24_PONAB (40S ribosomal protein S24 OS=Pongo abelii OX=9601 GN=RPS24 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.097e-40
Identity = 69/100 (69.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMV+DVLHPG+A  PKTEIRE LAKMYKTTPDV+F F F+T+FGGGK++GF +IYD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. TrEMBL
Match: A0A0K8SQ58 (40S ribosomal protein S24 OS=Lygus hesperus OX=30085 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 4.306e-50
Identity = 77/103 (74.76%), Postives = 86/103 (83.50%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +E ++ +KTRKF+TNRLLCRKQMVVDV HPG+    KTEIRE LAKMYK TPDVVF F F+TNFGGGKSSGFAL+YDTLD+AKKFEPKHRL RHG   K T T
Sbjct:    2 TEGTVTIKTRKFMTNRLLCRKQMVVDVTHPGQPSVKKTEIREKLAKMYKVTPDVVFCFGFRTNFGGGKSSGFALVYDTLDFAKKFEPKHRLARHGLFEKKTQT 104          
BLAST of 40S ribosomal protein S24 vs. TrEMBL
Match: A5HMP1 (40S ribosomal protein S24 OS=Lygus lineolaris OX=50650 GN=S24e PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 5.320e-50
Identity = 77/103 (74.76%), Postives = 86/103 (83.50%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +E ++ +KTRKF+TNRLLCRKQMVVDV HPG+    KTEIRE LAKMYK TPDVVF F F+TNFGGGKSSGFAL+YDTLD+AKKFEPKHRL RHG   K T T
Sbjct:    2 TEGTVTIKTRKFMTNRLLCRKQMVVDVTHPGQPSVKKTEIREKLAKMYKVTPDVVFCFGFRTNFGGGKSSGFALVYDTLDFAKKFEPKHRLARHGLFEKKTQT 104          
BLAST of 40S ribosomal protein S24 vs. TrEMBL
Match: A0A0A9Z7E1 (40S ribosomal protein S24 OS=Lygus hesperus OX=30085 GN=RpS24_0 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 5.320e-50
Identity = 77/103 (74.76%), Postives = 86/103 (83.50%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +E ++ +KTRKF+TNRLLCRKQMVVDV HPG+    KTEIRE LAKMYK TPDVVF F F+TNFGGGKSSGFAL+YDTLD+AKKFEPKHRL RHG   K T T
Sbjct:    2 TEGTVTIKTRKFMTNRLLCRKQMVVDVTHPGQPSVKKTEIREKLAKMYKVTPDVVFCFGFRTNFGGGKSSGFALVYDTLDFAKKFEPKHRLARHGLFEKKTQT 104          
BLAST of 40S ribosomal protein S24 vs. TrEMBL
Match: A0A087U7Q3 (40S ribosomal protein S24 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01054 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 7.659e-50
Identity = 73/99 (73.74%), Postives = 88/99 (88.89%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
             E ++ ++T+KF++NRLLCRKQMVVDV+HPG+   PKTEIRE LAK+YKTTPDV+F F F+T FGGGKSSGFALIYDTLDYAKKFEPK+RLIR+GFG +
Sbjct:    2 GESTVTLRTKKFMSNRLLCRKQMVVDVIHPGKGSVPKTEIREKLAKLYKTTPDVIFCFGFRTQFGGGKSSGFALIYDTLDYAKKFEPKYRLIRNGFGER 100          
BLAST of 40S ribosomal protein S24 vs. TrEMBL
Match: A0A224XZS8 (40S ribosomal protein S24 OS=Panstrongylus lignarius OX=156445 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 8.031e-50
Identity = 78/103 (75.73%), Postives = 85/103 (82.52%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +E ++ VKTRKF+TNRLLCRKQMVVDV HPG+    KTEIRE LAKMYK TPDVVF F F+TNFGGGKSSGFALIYDTLD+AKKFEPKHRL RHG   K   T
Sbjct:    2 TEGTVTVKTRKFMTNRLLCRKQMVVDVTHPGQPSVKKTEIREKLAKMYKVTPDVVFCFGFRTNFGGGKSSGFALIYDTLDFAKKFEPKHRLARHGLYEKKQQT 104          
BLAST of 40S ribosomal protein S24 vs. Ensembl Cavefish
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:103026806])

HSP 1 Score: 151.369 bits (381), Expect = 5.513e-47
Identity = 69/100 (69.00%), Postives = 83/100 (83.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ V+TRKF+TNRLL RKQMV+DVLHPG+A  PK EIRE LAKMYKTTPDVVF F FKT FGGGK++GFA++YD+LD AKK EPK+RL RHG   K  ++
Sbjct:   42 TVTVRTRKFMTNRLLNRKQMVLDVLHPGKATVPKIEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFAMVYDSLDSAKKNEPKYRLARHGLYEKKKTS 141          
BLAST of 40S ribosomal protein S24 vs. Ensembl Cavefish
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:103026806])

HSP 1 Score: 151.369 bits (381), Expect = 5.513e-47
Identity = 69/100 (69.00%), Postives = 83/100 (83.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ V+TRKF+TNRLL RKQMV+DVLHPG+A  PK EIRE LAKMYKTTPDVVF F FKT FGGGK++GFA++YD+LD AKK EPK+RL RHG   K  ++
Sbjct:   42 TVTVRTRKFMTNRLLNRKQMVLDVLHPGKATVPKIEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFAMVYDSLDSAKKNEPKYRLARHGLYEKKKTS 141          
BLAST of 40S ribosomal protein S24 vs. Ensembl Cavefish
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:103026806])

HSP 1 Score: 150.599 bits (379), Expect = 1.220e-46
Identity = 69/100 (69.00%), Postives = 83/100 (83.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ V+TRKF+TNRLL RKQMV+DVLHPG+A  PK EIRE LAKMYKTTPDVVF F FKT FGGGK++GFA++YD+LD AKK EPK+RL RHG   K  ++
Sbjct:   42 TVTVRTRKFMTNRLLNRKQMVLDVLHPGKATVPKIEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFAMVYDSLDSAKKNEPKYRLARHGLYEKKKTS 141          
BLAST of 40S ribosomal protein S24 vs. Ensembl Cavefish
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:103026806])

HSP 1 Score: 147.132 bits (370), Expect = 7.989e-46
Identity = 68/98 (69.39%), Postives = 81/98 (82.65%), Query Frame = 3
Query:   78 VVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            + +TRKF+TNRLL RKQMV+DVLHPG+A  PK EIRE LAKMYKTTPDVVF F FKT FGGGK++GFA++YD+LD AKK EPK+RL RHG   K  ++
Sbjct:    3 IFRTRKFMTNRLLNRKQMVLDVLHPGKATVPKIEIREKLAKMYKTTPDVVFVFGFKTQFGGGKTTGFAMVYDSLDSAKKNEPKYRLARHGLYEKKKTS 100          
BLAST of 40S ribosomal protein S24 vs. Ensembl Sea Lamprey
Match: rps24 (ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-040109-5])

HSP 1 Score: 134.42 bits (337), Expect = 1.773e-41
Identity = 68/96 (70.83%), Postives = 83/96 (86.46%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGF 350
            SE ++ ++TRKF+TNRLL RKQMVVDVLHPG+A  PKTE+RE LAK+YKTT DVVF + F+T FGGGK++GF +IYDTLD+AKK EPKHRL+RHG 
Sbjct:    2 SEAAVTIRTRKFMTNRLLQRKQMVVDVLHPGKATVPKTEVREKLAKLYKTTMDVVFVYGFRTQFGGGKTTGFGMIYDTLDFAKKNEPKHRLVRHGL 97          
BLAST of 40S ribosomal protein S24 vs. Ensembl Yeast
Match: RPS24A (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S24, no bacterial homolog; RPS24A has a paralog, RPS24B, that arose from the whole genome duplication [Source:SGD;Acc:S000000876])

HSP 1 Score: 116.316 bits (290), Expect = 1.432e-34
Identity = 52/96 (54.17%), Postives = 69/96 (71.88%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
            ++ ++TRK ++N LL RKQ VVDVLHP RA   K E+RE LA++YK   D V  F F+T FGGGKS GF L+Y+++  AKKFEP +RL+R+G   K
Sbjct:    4 AVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEK 99          
BLAST of 40S ribosomal protein S24 vs. Ensembl Yeast
Match: RPS24B (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S24, no bacterial homolog; RPS24B has a paralog, RPS24A, that arose from the whole genome duplication [Source:SGD;Acc:S000001331])

HSP 1 Score: 116.316 bits (290), Expect = 1.432e-34
Identity = 52/96 (54.17%), Postives = 69/96 (71.88%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSK 359
            ++ ++TRK ++N LL RKQ VVDVLHP RA   K E+RE LA++YK   D V  F F+T FGGGKS GF L+Y+++  AKKFEP +RL+R+G   K
Sbjct:    4 AVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEK 99          
BLAST of 40S ribosomal protein S24 vs. Ensembl Nematostella
Match: EDO37521 (40S ribosomal protein S24 [Source:UniProtKB/TrEMBL;Acc:A7SFM1])

HSP 1 Score: 152.14 bits (383), Expect = 2.915e-48
Identity = 70/96 (72.92%), Postives = 80/96 (83.33%), Query Frame = 3
Query:   63 SEMSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGF 350
            S+ +  ++TRKFLTNRLL RKQMVVD+LHPGRA  PKTEIRE LAKMYK+T DV+  F FKT FGGG+S+GFALIYD LD AKKFEPK+RL RHG 
Sbjct:    2 SDGTATIRTRKFLTNRLLARKQMVVDILHPGRASVPKTEIREKLAKMYKSTADVIVCFGFKTAFGGGRSTGFALIYDNLDAAKKFEPKYRLARHGL 97          
BLAST of 40S ribosomal protein S24 vs. Ensembl Medaka
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:100049365])

HSP 1 Score: 158.688 bits (400), Expect = 2.011e-50
Identity = 71/100 (71.00%), Postives = 85/100 (85.00%), Query Frame = 3
Query:   72 SIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            ++ ++TRKF+TNRLL RKQMVVDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F F+T FGGGK++GFA++YD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    4 TVTIRTRKFMTNRLLQRKQMVVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFRTQFGGGKTTGFAMVYDSLDYAKKNEPKHRLARHGLYEKKKTS 103          
BLAST of 40S ribosomal protein S24 vs. Ensembl Medaka
Match: rps24 (ribosomal protein S24 [Source:NCBI gene;Acc:100049365])

HSP 1 Score: 147.517 bits (371), Expect = 4.063e-46
Identity = 67/91 (73.63%), Postives = 77/91 (84.62%), Query Frame = 3
Query:   99 LTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            +TNRLL RKQMVVDVLHPG+A  PKTEIRE LAKMYKTTPDVVF F F+T FGGGK++GFA++YD+LDYAKK EPKHRL RHG   K  ++
Sbjct:    1 MTNRLLQRKQMVVDVLHPGKATVPKTEIREKLAKMYKTTPDVVFVFGFRTQFGGGKTTGFAMVYDSLDYAKKNEPKHRLARHGLYEKKKTS 91          
BLAST of 40S ribosomal protein S24 vs. Planmine SMEST
Match: SMESG000035929.1 (SMESG000035929.1)

HSP 1 Score: 212.231 bits (539), Expect = 1.235e-71
Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 3
Query:   69 MSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 371
            MSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST
Sbjct:    1 MSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTPDVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTST 101          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S24 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS246.091e-4169.00ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS246.448e-4169.00ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS246.448e-4169.00ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS246.519e-4169.00ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS246.679e-4169.00ribosomal protein S24 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps-241.609e-4263.16Ribosomal Protein, Small subunit [Source:UniProtK... [more]
rps-241.609e-4263.16Ribosomal Protein, Small subunit [Source:UniProtK... [more]
rps-241.609e-4263.16Ribosomal Protein, Small subunit [Source:UniProtK... [more]
rps-241.609e-4263.16Ribosomal Protein, Small subunit [Source:UniProtK... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpS249.865e-4872.92gene:FBgn0261596 transcript:FBtr0071935[more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps243.184e-4171.00ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rps243.560e-4171.00ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rps248.003e-3772.53ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rps248.003e-3772.53ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps245.845e-4169.00ribosomal protein S24 [Source:NCBI gene;Acc:549379... [more]
rps245.924e-4169.00ribosomal protein S24 [Source:NCBI gene;Acc:549379... [more]
rps246.054e-4169.00ribosomal protein S24 [Source:NCBI gene;Acc:549379... [more]
rps241.014e-4069.00ribosomal protein S24 [Source:NCBI gene;Acc:549379... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps244.427e-4169.00ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps244.585e-4169.00ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps244.585e-4169.00ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps245.539e-4169.00ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps247.768e-3771.43ribosomal protein S24 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O42387|RS24_TAKRU4.030e-5075.0040S ribosomal protein S24 OS=Takifugu rubripes OX=... [more]
sp|Q962Q6|RS24_SPOFR4.368e-4972.8240S ribosomal protein S24 OS=Spodoptera frugiperda... [more]
sp|Q90YQ0|RS24_ICTPU9.611e-4971.0040S ribosomal protein S24 OS=Ictalurus punctatus O... [more]
sp|Q9W6X9|RS24_ORYLA1.809e-4870.0040S ribosomal protein S24 OS=Oryzias latipes OX=80... [more]
sp|Q5RAQ8|RS24_PONAB3.097e-4069.0040S ribosomal protein S24 OS=Pongo abelii OX=9601 ... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K8SQ584.306e-5074.7640S ribosomal protein S24 OS=Lygus hesperus OX=300... [more]
A5HMP15.320e-5074.7640S ribosomal protein S24 OS=Lygus lineolaris OX=5... [more]
A0A0A9Z7E15.320e-5074.7640S ribosomal protein S24 OS=Lygus hesperus OX=300... [more]
A0A087U7Q37.659e-5073.7440S ribosomal protein S24 (Fragment) OS=Stegodyphu... [more]
A0A224XZS88.031e-5075.7340S ribosomal protein S24 OS=Panstrongylus lignari... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps245.513e-4769.00ribosomal protein S24 [Source:NCBI gene;Acc:103026... [more]
rps245.513e-4769.00ribosomal protein S24 [Source:NCBI gene;Acc:103026... [more]
rps241.220e-4669.00ribosomal protein S24 [Source:NCBI gene;Acc:103026... [more]
rps247.989e-4669.39ribosomal protein S24 [Source:NCBI gene;Acc:103026... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps241.773e-4170.83ribosomal protein S24 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPS24A1.432e-3454.17Protein component of the small (40S) ribosomal sub... [more]
RPS24B1.432e-3454.17Protein component of the small (40S) ribosomal sub... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO375212.915e-4872.9240S ribosomal protein S24 [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps242.011e-5071.00ribosomal protein S24 [Source:NCBI gene;Acc:100049... [more]
rps244.063e-4673.63ribosomal protein S24 [Source:NCBI gene;Acc:100049... [more]
back to top
BLAST of 40S ribosomal protein S24 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000035929.11.235e-71100.00SMESG000035929.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009859 ID=SMED30009859|Name=40S ribosomal protein S24|organism=Schmidtea mediterranea sexual|type=transcript|length=492bp
TAGTACTTGCATACAAAACTTTGTTTAAATAATTTGATTAAGACCAAATA
TTACAATTTAAATCTGAGATGTCCATTGTAGTTAAAACAAGAAAATTCTT
GACCAACCGGCTCCTTTGCAGAAAGCAAATGGTTGTTGATGTTCTTCACC
CTGGTCGTGCTATTGCTCCAAAAACTGAAATTCGTGAACATTTAGCTAAA
ATGTACAAAACTACTCCTGATGTTGTTTTTGCTTTCCACTTTAAAACCAA
TTTTGGTGGTGGAAAATCTTCAGGATTTGCTTTGATCTATGACACTTTAG
ATTATGCCAAAAAATTCGAACCTAAACATCGTTTGATCAGACACGGATTT
GGAAGCAAAGACACATCTACCAGAAAGCAACGTAAAGAAAAGAAGAACAG
AATGAAGAAGCTCCGTGGAACAGCTAAAACAAAGAAAGTTACTGCTAAAG
CAGCAAAATAATTTTATAAATACAACTTGGATATAAAAAAAA
back to top

protein sequence of SMED30009859-orf-1

>SMED30009859-orf-1 ID=SMED30009859-orf-1|Name=SMED30009859-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MSIVVKTRKFLTNRLLCRKQMVVDVLHPGRAIAPKTEIREHLAKMYKTTP
DVVFAFHFKTNFGGGKSSGFALIYDTLDYAKKFEPKHRLIRHGFGSKDTS
TRKQRKEKKNRMKKLRGTAKTKKVTAKAAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000204ovary
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR012677Nucleotide-bd_a/b_plait_sf
IPR001976Ribosomal_S24e
IPR018098Ribosomal_S24e_CS
IPR012678Ribosomal_L23/L15e_core_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.70.3370coord: 1..130
e-value: 1.0E-59
score: 201.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 106..130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 92..130
NoneNo IPR availablePRODOMPD006052coord: 11..82
e-value: 2.0E-29
score: 316.0
IPR001976Ribosomal protein S24ePFAMPF01282Ribosomal_S24ecoord: 22..98
e-value: 4.2E-37
score: 125.9
IPR001976Ribosomal protein S24ePANTHERPTHR1049640S RIBOSOMAL PROTEIN S24coord: 3..127
IPR018098Ribosomal S24e conserved sitePROSITEPS00529RIBOSOMAL_S24Ecoord: 62..84
IPR012678Ribosomal protein L23/L15e core domain superfamilySUPERFAMILYSSF54189Ribosomal proteins S24e, L23 and L15ecoord: 5..103